HHsearch alignment for GI: 254780595 and conserved domain: PRK13984

>PRK13984 putative oxidoreductase; Provisional.
Probab=96.04  E-value=0.068  Score=30.31  Aligned_cols=73  Identities=12%  Similarity=-0.008  Sum_probs=49.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCH---------------------HHHHHHHHCCCEEEECCCCCCCHHHHH
Q ss_conf             39998888889999999998898899996794---------------------463455644982898067864023465
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSV---------------------SNLLTLKHKGISPFLFADQKINNLLRE   60 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~---------------------~~~~~l~~~~~~~~~~~~~~~~~~~~~   60 (289)
T Consensus       285 KVAVIGsGPAGLaaA~~Lar~Gh~VtVFE~~~~~GGlL~yGIP~fRLpk~vv~rei~~i~~~GV~f~~n~~VGkDit~ee  364 (604)
T PRK13984        285 KVAIVGSGPAGLSAAYFLATMGYEVEVYESLSKPGGVMRYGIPSYRLPDEALDKDIAFIEALGVKIHTNTRVGKDISLEE  364 (604)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCCCCHHH
T ss_conf             89998986899999999998698689974567789723315872228789999999999972989976857798478999


Q ss_pred             HHCCCCEEEEEECC
Q ss_conf             41156327876124
Q gi|254780595|r   61 KLYFTTHIVQCIKP   74 (289)
Q Consensus        61 ~~~~~~~v~~~~~~   74 (289)
T Consensus       365 L~~~yDAVfLa~Ga  378 (604)
T PRK13984        365 LREKHDAVFVSTGF  378 (604)
T ss_pred             HHHCCCEEEEECCC
T ss_conf             97058999995388