HHsearch alignment for GI: 254780595 and conserved domain: TIGR01214

>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen. dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=100.00  E-value=2.2e-36  Score=227.10  Aligned_cols=275  Identities=16%  Similarity=0.170  Sum_probs=194.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHCCCEEEECCCCCCCHHHHHHH-CCCCEEEEEECCC---
Q ss_conf             3999888-888999999999889889999679-446345564498289806786402346541-1563278761244---
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRS-VSNLLTLKHKGISPFLFADQKINNLLREKL-YFTTHIVQCIKPS---   75 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~-~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~-~~~~~v~~~~~~~---   75 (289)
T Consensus         1 rilitGa~GQlG~~L~~~l~~~g~~~~~~~~~~~~~~~------~~~~~~Dl~dP~~l~~~~r~~~Pd~vvntAAYT~VD   74 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSKPGRVVVALTRSTRLKLA------ARWSQLDLTDPEALEELLRAIRPDAVVNTAAYTDVD   74 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCCCCCEEEEECCCCCCCHH------HHHHHHCCCCHHHHHHHHHHHCCCEEEECCHHCCCC
T ss_conf             97887387567999999707888278643687776113------365440622468899999852875376230110100


Q ss_pred             -CCCCEE-----ECCCCCHHHHHHHC-CCCCCCCCCEEECCC----CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             -433100-----01221013443201-233433332010257----6212345321123431134554455554320012
Q gi|254780595|r   76 -SEGDPC-----IISMSKDFYKFMPH-VKWIGYLSSTSIYGN----REGQWVDEHSFVHPISCVATQRFNAEKEWLAITK  144 (289)
Q Consensus        76 -~~~~~~-----~~~~~~~~~~~~~~-~~~~i~~SS~~VYg~----~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~  144 (289)
T Consensus        75 ~AE~~~~~AyavNa~A~~~lA~~A~~~Ga~~vh~STDYVFDGdfGG~~~~PY~e~D~~nPlnvYG~SK~~GE~a~~~~~~  154 (317)
T TIGR01214        75 GAESDPEKAYAVNALAPQNLARAAARVGARLVHISTDYVFDGDFGGEGKRPYREDDETNPLNVYGQSKLAGEQAVRAAGP  154 (317)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             00377778765740789999999986691599986342344755788866887646879843121115689999998379


Q ss_pred             CCCCCCCCCCCCCCCCC--C--CCH---HHHHH-CCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC---------CCCCC
Q ss_conf             34567642034777789--8--503---44431-13454322211000102477779999999513---------55786
Q gi|254780595|r  145 KLNIKLAVLRLSGIYGP--K--RNP---FIKIR-QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH---------HLGGI  207 (289)
Q Consensus       145 ~~~~~~~ilR~~~iyGp--~--r~~---~~~~~-~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~---------~~~~i  207 (289)
T Consensus       155 ~e--~~lIvRTsWlY~~~g~~g~NF~~tMlrLaG~~~~~l~vV~DQ~GsPTy~~dLA~~~~~ll~~~~Wdv~~~a~~~Gv  232 (317)
T TIGR01214       155 DE--NALIVRTSWLYGAGGGSGRNFVKTMLRLAGKEREELRVVDDQIGSPTYAKDLARAIAALLERLNWDVEDAARARGV  232 (317)
T ss_pred             CC--CEEEEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCE
T ss_conf             98--5788985213448998842179999985378998403785576873589999999999997613340010136734


Q ss_pred             EECCCCCHHHHHHHHHHHHHHHCCCC-----C-CCCCCCCCCCCHHHHHHHCCCCEECHHHHHHCCCCC--CCCCHHHHH
Q ss_conf             16268433338999999999955799-----8-634310125682446553069451689999739844--899999999
Q gi|254780595|r  208 FNLSDDEPAPPQNVIMEAASLMKITP-----P-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL--LYPNYRISL  279 (289)
Q Consensus       208 yni~~~~~~s~~e~~~~i~~~~g~~~-----~-~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p--~~p~~~~gl  279 (289)
T Consensus       233 YH~~~~G~~SWyeFA~~If~~~~~~g~~~~~~~~v~Pis~~~-yp~pA~RPayS-~Ld~~~~~~~~g~P~~~lp~Wr~al  310 (317)
T TIGR01214       233 YHLANSGQVSWYEFAQAIFEVAGECGLLLKVPEEVKPISSKE-YPTPARRPAYS-VLDNTKLVKTLGKPLLVLPDWREAL  310 (317)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEECHHC-CCCCCCCCCCH-HHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             677505431368899999999985471048720001011320-77899886430-4456899996086667998789999


Q ss_pred             HHHHHHH
Q ss_conf             9999975
Q gi|254780595|r  280 KQLWKEI  286 (289)
Q Consensus       280 ~~~~~~~  286 (289)
T Consensus       311 ~~~l~~~  317 (317)
T TIGR01214       311 RAVLKEA  317 (317)
T ss_pred             HHHHHCC
T ss_conf             9997409