HHsearch alignment for GI: 254780595 and conserved domain: TIGR01472

>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=99.90  E-value=5.7e-22  Score=144.87  Aligned_cols=285  Identities=16%  Similarity=0.119  Sum_probs=187.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----HHHH------HHCCC--EEEECCCCCCCHHHHHHHC--CCC
Q ss_conf             999888-888999999999889889999679446-----3455------64498--2898067864023465411--563
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----LLTL------KHKGI--SPFLFADQKINNLLREKLY--FTT   66 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----~~~l------~~~~~--~~~~~~~~~~~~~~~~~~~--~~~   66 (289)
T Consensus         3 ALiTGiTGQDGSYLAE~LL~~GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~kP~   82 (365)
T TIGR01472         3 ALITGITGQDGSYLAEFLLEKGYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEIKPT   82 (365)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             68834555767899999872696876458625542522456764053541016613542044210689999997404886


Q ss_pred             EEEEEEC----------CCCCCCEEECCCCCHHHHHHH-C----CC--CCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             2787612----------444331000122101344320-1----23--34333320102576212345321123431134
Q gi|254780595|r   67 HIVQCIK----------PSSEGDPCIISMSKDFYKFMP-H----VK--WIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        67 ~v~~~~~----------~~~~~~~~~~~~~~~~~~~~~-~----~~--~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
T Consensus        83 EiYNLAAQSHV~VSFe~PeYTa~~~g~GTLrlLEA~r~hni~gl~~~~rFYQAStSElYG~v~~~PQ~E~TPF~PRSPYA  162 (365)
T TIGR01472        83 EIYNLAAQSHVKVSFEIPEYTADVDGIGTLRLLEAVRSHNILGLIKEIRFYQASTSELYGEVQEIPQNETTPFYPRSPYA  162 (365)
T ss_pred             EEECCCCCCCEEEECCCCCCHHCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             34202023710354165200001244317789998742334141203025524523113655578888888768887689


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--H--------HHHHHCCCCCCCCCCC--CEECCHHHHHHHHHHH
Q ss_conf             55445555432001234567642034777789850--3--------4443113454322211--0001024777799999
Q gi|254780595|r  130 TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN--P--------FIKIRQKNSLRLVKKN--QVFNRIRVEDVARCVI  197 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~--~--------~~~~~~g~~~~~~~~~--~~~~~ihv~Dva~~i~  197 (289)
T Consensus       163 aAK~yA~w~tvNYREAYgL~A~nGILFNHESP~RGetFVTRKITra~a~I~~G~~~~lyLGNLdA~RDWGhAkDYV~aMW  242 (365)
T TIGR01472       163 AAKLYAYWITVNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAAKIKLGLQEKLYLGNLDAKRDWGHAKDYVEAMW  242 (365)
T ss_pred             HHHHHHHHHEEEEECCCCCCHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             99884543102121003410003521046788778853225899999998615631112027544106650566999988


Q ss_pred             HHHCCCCCCCEECCCCCHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCHH------H----HHHHCCCC---------
Q ss_conf             99513557861626843333899999999995579--986343101256824------4----65530694---------
Q gi|254780595|r  198 FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT--PPLEQCFDTANISPF------T----RFFYADNK---------  256 (289)
Q Consensus       198 ~l~~~~~~~iyni~~~~~~s~~e~~~~i~~~~g~~--~~~~~~~~~~~~~~~------~----~~~~~~~~---------  256 (289)
T Consensus       243 LMLQ~d~P~DYViATG~t~SVrefve~SF~~~G~~l~W~~~g~~E~G~~~~~dekranalklnlshlkkGk~~V~iD~rY  322 (365)
T TIGR01472       243 LMLQQDKPDDYVIATGETHSVREFVEVSFELVGITLEWKDKGIEEVGLIKETDEKRANALKLNLSHLKKGKVVVEIDPRY  322 (365)
T ss_pred             HHCCCCCCCCEEEECCCEEEHHHHHHHHHHHCCCEEEECCCCCCEECCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             75278688976887573333888999988740973686268820211301233555777765344413770799964865


Q ss_pred             ---------EECHHHHHH-CCCCCCCCCHHHHHHHHHH-HHHC
Q ss_conf             ---------516899997-3984489999999999999-7513
Q gi|254780595|r  257 ---------RISNAKIKS-LGFQLLYPNYRISLKQLWK-EIEN  288 (289)
Q Consensus       257 ---------~is~~kl~~-lG~~p~~p~~~~gl~~~~~-~~~~  288 (289)
T Consensus       323 fRPTEVDlL~GD~~KAk~~LgW~~~~-~f~~Lvk~Mv~~Dl~~  364 (365)
T TIGR01472       323 FRPTEVDLLLGDATKAKEKLGWKPEV-SFEELVKEMVEEDLEL  364 (365)
T ss_pred             CCCHHHHHCCCCCHHHHHHCCCCCCC-CHHHHHHHHHHHHHHC
T ss_conf             78514230178834889736882455-7789999999997850