HHsearch alignment for GI: 254780595 and conserved domain: TIGR01777

>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099 This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=100.00  E-value=3e-43  Score=266.25  Aligned_cols=273  Identities=19%  Similarity=0.222  Sum_probs=206.3

Q ss_pred             EEEE-C-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEC----CCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9998-8-888899999999988988999967944634556449828980----678640234654115632787612444
Q gi|254780595|r    3 LMIF-G-AGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF----ADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         3 IlI~-G-aG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~----~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
T Consensus         1 ~litGgnTGfiG~~L~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~W-~~l~~~DaviNLAG~~i   79 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLTKSGHEVTILTRSPQAESNTKKVGYKNWLAEGKLGIVIAESGW-SALEGADAVINLAGEPI   79 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHCCCCCCCCCCCCCCCCCCHHCC-CCCCCCCEEEECCCCCC
T ss_conf             96415330237899999998479989999616864320002554455552212452072205-66788627985568885


Q ss_pred             CC-C------------EEECCCCCHHHH---H----HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC-CCHHHHHHHHH
Q ss_conf             33-1------------000122101344---3----20123343333201025762123453211234-31134554455
Q gi|254780595|r   77 EG-D------------PCIISMSKDFYK---F----MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP-ISCVATQRFNA  135 (289)
Q Consensus        77 ~~-~------------~~~~~~~~~~~~---~----~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P-~~~y~~~k~~~  135 (289)
T Consensus        80 ~~P~RWt~~~K~~i~~SRi~-~T~~L~~~i~~~~r~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~~~~ddFla~lc~~W  158 (307)
T TIGR01777        80 ADPKRWTEERKQEIRDSRID-TTRALVEAIAAAPRAEQKPKVFISASAVGYYGHSEDRVFTEEDASGPGDDFLAELCRDW  158 (307)
T ss_pred             CCCCCCCHHHHHHHHHCCHH-HHHHHHHHHHHCCCCCCCCCEEEEEEEEEEECCCCCCEEECCCCCCCCCCCHHHHHHHH
T ss_conf             77888787775756523347-89999999984656678871688501666306899821511667888777218999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHH----HCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC-CCCCCEEC
Q ss_conf             5543200123456764203477778985034443----113454322211000102477779999999513-55786162
Q gi|254780595|r  136 EKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI----RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNL  210 (289)
Q Consensus       136 E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~----~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~-~~~~iyni  210 (289)
T Consensus       159 E~~A~~a-~~~g~Rvv~~R~G~VLg~~GGaL~~m~~pf~~glGGplG~G~Q~~SWIH~~D~v~~I~~~l~~~~~~Gp~N~  237 (307)
T TIGR01777       159 EEAAQAA-EQLGTRVVLLRTGIVLGPKGGALAKMLPPFRLGLGGPLGSGRQWFSWIHIEDLVQLILFALENASVSGPVNA  237 (307)
T ss_pred             HHHHHHH-HHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             9985105-336873898764134708987034545667651574236884145053588999999999855899632541


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHH
Q ss_conf             68433338999999999955799863431--0125682446553069451689999739844899999999
Q gi|254780595|r  211 SDDEPAPPQNVIMEAASLMKITPPLEQCF--DTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISL  279 (289)
Q Consensus       211 ~~~~~~s~~e~~~~i~~~~g~~~~~~~~~--~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl  279 (289)
T Consensus       238 tAP~Pv~n~~F~~~la~~l~RP~~~~vP~~~~~~~LGe~a~~-~L~gQrV~P~kl~~~GF~F~Y~~l~~AL  307 (307)
T TIGR01777       238 TAPEPVRNKEFAKALARALHRPAFLPVPAFVLRLLLGEMADL-LLKGQRVLPEKLLEAGFQFQYPDLDEAL  307 (307)
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCCEEECCCCCCCC
T ss_conf             078863578999999998189701011089999884255888-9865789999999749766213320249