HHsearch alignment for GI: 254780595 and conserved domain: TIGR01829

>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283 This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=97.99  E-value=4.7e-05  Score=48.33  Aligned_cols=181  Identities=15%  Similarity=0.148  Sum_probs=97.3

Q ss_pred             EEECC-CHHHHHHHHHHHHCCCEEEEEEC--CHHHHH-HHHHCCCEE-----EECCCCCCC------HHHHHHHCCCCEE
Q ss_conf             99888-88899999999988988999967--944634-556449828-----980678640------2346541156327
Q gi|254780595|r    4 MIFGA-GYTGKFIADAALKVGVYTCGTTR--SVSNLL-TLKHKGISP-----FLFADQKIN------NLLREKLYFTTHI   68 (289)
Q Consensus         4 lI~Ga-G~iG~~l~~~L~~~g~~V~~~~r--~~~~~~-~l~~~~~~~-----~~~~~~~~~------~~~~~~~~~~~~v   68 (289)
T Consensus         4 LVTGg~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lGpvDvL   83 (244)
T TIGR01829         4 LVTGGTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELGPVDVL   83 (244)
T ss_pred             EEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             88578774468999999875988988178982589999998626985147898727677789999999999711953689


Q ss_pred             EEEECCCCCCC----------EE-------ECCCCCHHHHHH-H-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331----------00-------012210134432-0-12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD----------PC-------IISMSKDFYKFM-P-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~----------~~-------~~~~~~~~~~~~-~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
T Consensus        84 VNNAGITRD~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eRGwGRIiNISSvN--G~-KGQf--------GQtNYS  152 (244)
T TIGR01829        84 VNNAGITRDKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRERGWGRIINISSVN--GQ-KGQF--------GQTNYS  152 (244)
T ss_pred             EECCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEC--CC-CCCC--------CHHHHH
T ss_conf             868864403031249984688898631324415540014766216884168841214--77-5654--------304589


Q ss_pred             HHHHHH---HHHHHHCCCCCCCCCCCCCCCCCCCC-----CCCHHHH-HHCCCCC-CCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             554455---55432001234567642034777789-----8503444-3113454-322211000102477779999999
Q gi|254780595|r  130 TQRFNA---EKEWLAITKKLNIKLAVLRLSGIYGP-----KRNPFIK-IRQKNSL-RLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       130 ~~k~~~---E~~~~~~~~~~~~~~~ilR~~~iyGp-----~r~~~~~-~~~g~~~-~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
T Consensus       153 AAKAG~iGFTkALA~E~A~kGvTVN~i~PGYi~T~MV~A~redVl~~rIva~IP~~RLg~Pe---------EIA~aV~fL  223 (244)
T TIGR01829       153 AAKAGMIGFTKALAQEGARKGVTVNVIAPGYIATDMVMAVREDVLQSRIVAQIPVKRLGRPE---------EIAAAVAFL  223 (244)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH---------HHHHHHHHH
T ss_conf             88621567779999721103856754558898866778636888740577889832157815---------788899886


Q ss_pred             HCCCC
Q ss_conf             51355
Q gi|254780595|r  200 MTHHL  204 (289)
Q Consensus       200 ~~~~~  204 (289)
T Consensus       224 ase~a  228 (244)
T TIGR01829       224 ASEEA  228 (244)
T ss_pred             HHHCC
T ss_conf             54103