HHsearch alignment for GI: 254780595 and conserved domain: TIGR03206

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=98.35  E-value=5.2e-06  Score=53.80  Aligned_cols=198  Identities=11%  Similarity=0.009  Sum_probs=105.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
T Consensus         5 valITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDil   84 (250)
T TIGR03206         5 TAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGPVDVL   84 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99996857689999999999879999999798899999999999539928999944899999999999999975999799


Q ss_pred             EEEECCCCCCC---EEECCC----CCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---000122----101----------34432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCIISM----SKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~~----~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
T Consensus        85 vnnAg~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~-----------~~~~~~~Y~  153 (250)
T TIGR03206        85 VNNAGWDKFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARV-----------GSSGEAVYA  153 (250)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHHH
T ss_conf             989888999890349999999999998299999999999999974991799965577576-----------899858899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCC-C----CCCCCCCEEC-CHHHHHHHHHHHHHH
Q ss_conf             5544555543200123---45676420347777898503444311345-4----3222110001-024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNS-L----RLVKKNQVFN-RIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~-~----~~~~~~~~~~-~ihv~Dva~~i~~l~  200 (289)
T Consensus       154 asKaav~~ltk~lA~ela~~gIrVNaV~PG~i~T~---~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~~v~fL~  230 (250)
T TIGR03206       154 ACKGGLVAFSKTMAREHARHGITVNVVCPGPTDTA---LLDDICGGAENPEKLREAFTRAIPLGRLGQPDDLPGAILFFS  230 (250)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCH---HHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999996532918999976888867---789876443886999999984799899839999999999995


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
T Consensus       231 Sd~s~~itG~~i~VDGG  247 (250)
T TIGR03206       231 SDDASFITGQVLSVSGG  247 (250)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             83433845883886869