HHsearch alignment for GI: 254780595 and conserved domain: TIGR03219

>TIGR03219 salicylate_mono salicylate 1-monooxygenase. Members of this protein family are salicylate 1-monooxygenase, also called salicylate hydroxylase. This enzyme converts salicylate to catechol, which is a common intermediate in the degradation of a number of aromatic compounds (phenol, toluene, benzoate, etc.). The gene for this protein may occur in catechol degradation genes, such as those of the meta-cleavage pathway.
Probab=95.74  E-value=0.018  Score=33.61  Aligned_cols=33  Identities=18%  Similarity=0.120  Sum_probs=29.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCH
Q ss_conf             939998888889999999998898-899996794
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGV-YTCGTTRSV   33 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~-~V~~~~r~~   33 (289)
T Consensus         1 mkV~IVGaGiaGL~lA~~L~r~g~i~V~V~Er~~   34 (414)
T TIGR03219         1 LRVAIIGGGIAGVALALNLCKHSHLNVQLFEAAP   34 (414)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             9899999448999999999853999889994289