HHsearch alignment for GI: 254780595 and conserved domain: TIGR03325

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=98.33  E-value=1.4e-05  Score=51.31  Aligned_cols=205  Identities=11%  Similarity=0.088  Sum_probs=104.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC---CEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-88899999999988988999967944634556449---8289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG---ISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~---~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
T Consensus         7 valITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDiLVnN   86 (262)
T TIGR03325         7 VVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGDAVVGVEGDVRSLDDHKEAVARCVAAFGKIDCLIPN   86 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89990678789999999999879999999899899999998679967999845799999999999999984998889972


Q ss_pred             ECCCCCCCE--------EECCCC----CHHH-------HH----HHCCCCCCCC-CCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             124443310--------001221----0134-------43----2012334333-3201025762123453211234311
Q gi|254780595|r   72 IKPSSEGDP--------CIISMS----KDFY-------KF----MPHVKWIGYL-SSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        72 ~~~~~~~~~--------~~~~~~----~~~~-------~~----~~~~~~~i~~-SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
T Consensus        87 AG~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~g~iI~~~S~~~~~~~~------------~~~~  154 (262)
T TIGR03325        87 AGIWDYSTALVDIPDDRIDEAFDEVFHINVKGYLLAVKAALPALVASRGSVIFTISNAGFYPNG------------GGPL  154 (262)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC------------CCHH
T ss_conf             6516877643458624149999999999749999999999999997098189998710324889------------9668


Q ss_pred             HHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHH-HHHCCCCCCC-----CCCCCEEC-CHHHHHHHHHHHH
Q ss_conf             34554455554320012345--67642034777789850344-4311345432-----22110001-0247777999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFI-KIRQKNSLRL-----VKKNQVFN-RIRVEDVARCVIF  198 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~-~~~~g~~~~~-----~~~~~~~~-~ihv~Dva~~i~~  198 (289)
T Consensus       155 Y~asKaal~~ltr~lA~e~~~~IRVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeia~av~f  234 (262)
T TIGR03325       155 YTAAKHAVVGLVKELAFELAPYVRVNGVAPGGMSSDLRGPKSLGMADKSISTVPLGDMLKSVLPIGRMPDAEEYTGAYVF  234 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCHHHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999999975997899995378887986754431355542110589999707998998399999999999


Q ss_pred             HHCCC-----CCCCEECCCCCHHHHHH
Q ss_conf             95135-----57861626843333899
Q gi|254780595|r  199 LMTHH-----LGGIFNLSDDEPAPPQN  220 (289)
Q Consensus       199 l~~~~-----~~~iyni~~~~~~s~~e  220 (289)
T Consensus       235 L~s~~~s~~iTG~~l~VDGG--~~~~~  259 (262)
T TIGR03325       235 FATRGDTVPATGAVLNYDGG--MGVRG  259 (262)
T ss_pred             HCCCCHHCCEECCEEEECCC--CCCCE
T ss_conf             81980226945868897947--10673