HHsearch alignment for GI: 254780595 and conserved domain: TIGR03364

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364. This clade of FAD dependent oxidoreductases (members of the pfam01266 family) is syntenically associated with a family of proposed phosphonatase-like enzymes (TIGR03351) and is also found (less frequently) in association with phosphonate transporter components. A likely role for this enzyme involves the oxidative deamination of an aminophosphonate differring slightly from 2-aminoethylphosphonate, possibly 1-hydroxy-2-aminoethylphosphonate (see the comments for TIGR03351). Many members of the larger FAD dependent oxidoreductase family act as amino acid oxidative deaminases.
Probab=94.28  E-value=0.074  Score=30.11  Aligned_cols=31  Identities=39%  Similarity=0.388  Sum_probs=28.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             9998888889999999998898899996794
Q gi|254780595|r    3 LMIFGAGYTGKFIADAALKVGVYTCGTTRSV   33 (289)
Q Consensus         3 IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~   33 (289)
T Consensus         3 v~VIGaGi~Gls~A~~La~~G~~V~vle~~~   33 (365)
T TIGR03364         3 LIIVGAGILGLAHAYAAARRGLSVTVIERSS   33 (365)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             9999932999999999997899499998999