>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids

Probab=92.90 E-value=0.67 Score=24.64 Aligned_cols=72 Identities=17% Similarity=0.097 Sum_probs=0.0 Q ss_pred CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-----------CHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEE Q ss_conf 9399988888899999999988988999967-----------94463455644982898067864023465411563278 Q gi|254780595|r 1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTR-----------SVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIV 69 (289) Q Consensus 1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r-----------~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~ 69 (289) T Consensus 32 ~~v~IqG~GnVG~~~a~~L~~~Gakvv~vsD~~G~i~~~~Gld~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DI~i 111 (227) T cd01076 32 ARVAIQGFGNVGSHAARFLHEAGAKVVAVSDSDGTIYNPDGLDVPALLAYKKEHGSVLGFPGAERITNEELLELDCDILI 111 (227) T ss_pred CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHCCCCCEEE T ss_conf 99999898899999999999879959999847873888888999999999996598026788753896231047887898 Q ss_pred EEE Q ss_conf 761 Q gi|254780595|r 70 QCI 72 (289) Q Consensus 70 ~~~ 72 (289) T Consensus 112 P~A 114 (227) T cd01076 112 PAA 114 (227) T ss_pred ECC T ss_conf 777

HHsearch alignment for GI: 254780595 and conserved domain: cd01076