HHsearch alignment for GI: 254780595 and conserved domain: cd05294

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=96.13  E-value=0.014  Score=34.25  Aligned_cols=73  Identities=16%  Similarity=0.020  Sum_probs=40.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCC--CEEEEEECCH--HHHH----HHHHCCCEEEECCCCCC-CHHHHHHHCCCCEEEE
Q ss_conf             93999888-888999999999889--8899996794--4634----55644982898067864-0234654115632787
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVG--VYTCGTTRSV--SNLL----TLKHKGISPFLFADQKI-NNLLREKLYFTTHIVQ   70 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~--~~~~----~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~~v~~   70 (289)
T Consensus         1 mKV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~--~~~~~~~~~i~~~~d~~~~~daDivVi   78 (309)
T cd05294           1 MKVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDA--LAAAGIDAEIKISSDLSDVAGSDIVII   78 (309)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCC--CCCCCCCCEEEECCCHHHHCCCCEEEE
T ss_conf             989999999769999999998379987599960556434231123554503--433688767982798899689999998


Q ss_pred             EECCC
Q ss_conf             61244
Q gi|254780595|r   71 CIKPS   75 (289)
Q Consensus        71 ~~~~~   75 (289)
T Consensus        79 tAG~~   83 (309)
T cd05294          79 TAGVP   83 (309)
T ss_pred             CCCCC
T ss_conf             78988