Query         gi|254780595|ref|YP_003065008.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 289
No_of_seqs    123 out of 7298
Neff          9.2 
Searched_HMMs 39220
Date          Sun May 29 21:50:35 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780595.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01181 dTDP_gluc_dehyt dTDP 100.0       0       0  315.6  18.1  284    2-286     1-330 (340)
  2 PRK11908 NAD-dependent epimera 100.0       0       0  306.9  17.4  287    1-288     1-337 (347)
  3 TIGR03466 HpnA hopanoid-associ 100.0       0       0  298.7  19.4  282    1-288     1-324 (328)
  4 TIGR01179 galE UDP-glucose 4-e 100.0       0       0  299.4  16.0  278    2-288     1-336 (341)
  5 PRK10084 dTDP-glucose 4,6 dehy 100.0       0       0  294.5  18.6  280    1-286     1-334 (352)
  6 PRK10675 UDP-galactose-4-epime 100.0       0       0  291.6  18.1  278    1-288     1-331 (338)
  7 PRK10217 dTDP-glucose 4,6-dehy 100.0       0       0  288.5  19.6  279    1-287     1-332 (355)
  8 PRK11150 rfaD ADP-L-glycero-D- 100.0       0       0  288.9  15.5  275    3-287     2-307 (308)
  9 pfam04321 RmlD_sub_bind RmlD s 100.0       0       0  283.1  16.5  259    3-286     1-283 (284)
 10 KOG0747 consensus              100.0 8.4E-45       0  275.2  13.8  281    2-288     8-324 (331)
 11 COG1088 RfbB dTDP-D-glucose 4, 100.0 1.1E-42       0  263.0  19.4  279    1-286     1-316 (340)
 12 TIGR01777 yfcH conserved hypot 100.0   3E-43       0  266.2  12.3  273    3-279     1-307 (307)
 13 COG1087 GalE UDP-glucose 4-epi 100.0 2.8E-41 1.4E-45  255.0  19.1  278    1-287     1-322 (329)
 14 COG0451 WcaG Nucleoside-diphos 100.0 3.4E-41 1.4E-45  254.5  18.8  280    1-288     1-310 (314)
 15 TIGR02197 heptose_epim ADP-L-g 100.0 3.6E-40 9.8E-45  248.7  14.9  285    3-288     1-352 (353)
 16 COG1090 Predicted nucleoside-d 100.0 4.5E-40 1.1E-44  248.2  14.3  272    3-285     1-296 (297)
 17 pfam01073 3Beta_HSD 3-beta hyd 100.0 4.4E-39 1.1E-43  242.5  16.1  236    4-239     1-278 (280)
 18 pfam01370 Epimerase NAD depend 100.0 3.6E-39 9.2E-44  243.0  12.2  207    3-210     1-235 (235)
 19 KOG1429 consensus              100.0   6E-38 1.5E-42  236.0  14.7  275    1-287    28-331 (350)
 20 TIGR01214 rmlD dTDP-4-dehydror 100.0 2.2E-36 5.6E-41  227.1  13.9  275    2-286     1-317 (317)
 21 PRK09987 dTDP-4-dehydrorhamnos 100.0 9.7E-36 2.5E-40  223.4  16.3  265    1-288     1-295 (299)
 22 PRK08125 bifunctional UDP-gluc 100.0 4.4E-35 1.1E-39  219.7  17.8  280    2-285   317-648 (660)
 23 KOG1502 consensus              100.0 2.9E-34 7.4E-39  215.0  18.0  275    1-288     7-322 (327)
 24 COG1091 RfbD dTDP-4-dehydrorha 100.0 2.1E-34 5.3E-39  215.8  16.0  261    1-286     1-280 (281)
 25 pfam02719 Polysacc_synt_2 Poly 100.0 8.3E-34 2.1E-38  212.4  12.8  209    3-226     1-240 (280)
 26 KOG1371 consensus              100.0 1.2E-32 3.1E-37  205.7  16.2  277    1-287     3-333 (343)
 27 KOG1430 consensus              100.0 2.5E-30 6.3E-35  192.6  17.9  285    2-288     6-347 (361)
 28 CHL00194 ycf39 Ycf39; Provisio 100.0 2.7E-30 6.9E-35  192.4  14.1  213    1-234     1-226 (319)
 29 PRK07201 short chain dehydroge 100.0   2E-28 5.1E-33  181.7  19.3  229    1-233     1-272 (663)
 30 TIGR03589 PseB UDP-N-acetylglu  99.9 4.3E-26 1.1E-30  168.4  13.4  213    2-230     6-245 (324)
 31 COG1089 Gmd GDP-D-mannose dehy  99.9 1.2E-24   3E-29  160.2  16.5  277    3-285     5-337 (345)
 32 KOG1431 consensus               99.9 9.8E-25 2.5E-29  160.6  14.6  265    1-286     2-306 (315)
 33 TIGR03443 alpha_am_amid L-amin  99.9 2.9E-24 7.5E-29  157.9  14.4  231    2-234   973-1267(1389)
 34 pfam05368 NmrA NmrA-like famil  99.9 4.2E-24 1.1E-28  157.0  14.1  215    3-233     1-228 (232)
 35 pfam07993 NAD_binding_4 Male s  99.9   9E-24 2.3E-28  155.1  10.5  190    5-196     1-245 (245)
 36 TIGR01472 gmd GDP-mannose 4,6-  99.9 5.7E-22 1.4E-26  144.9  16.4  285    3-288     3-364 (365)
 37 TIGR01746 Thioester-redct thio  99.9 2.6E-22 6.5E-27  146.8  13.0  240    2-241     1-320 (405)
 38 TIGR02622 CDP_4_6_dhtase CDP-g  99.9 1.8E-21 4.7E-26  142.0  15.4  281    2-288     6-340 (361)
 39 KOG3019 consensus               99.9 3.4E-23 8.6E-28  151.9   5.8  266    7-283    19-314 (315)
 40 COG3320 Putative dehydrogenase  99.9 9.2E-22 2.4E-26  143.7   6.7  231    1-232     1-296 (382)
 41 TIGR03649 ergot_EASG ergot alk  99.8 3.6E-19 9.2E-24  128.9  11.5  256    2-284     1-283 (285)
 42 COG0702 Predicted nucleoside-d  99.8 1.7E-17 4.3E-22  119.4  14.9  215    1-235     1-224 (275)
 43 COG1086 Predicted nucleoside-d  99.8 2.2E-17 5.6E-22  118.7  14.4  222    2-238   252-504 (588)
 44 KOG1372 consensus               99.7 1.1E-16 2.9E-21  114.6  15.1  278    3-285    31-365 (376)
 45 PRK12320 hypothetical protein;  99.7 4.7E-16 1.2E-20  111.1  13.3  240    1-282     1-245 (699)
 46 PRK05865 hypothetical protein;  99.7 8.2E-15 2.1E-19  104.0  15.9  197    1-233     1-202 (854)
 47 KOG2865 consensus               99.6 4.4E-15 1.1E-19  105.6  12.3  211    3-230    64-294 (391)
 48 KOG1221 consensus               99.5 2.6E-13 6.8E-18   95.4  12.5  227    2-230    14-332 (467)
 49 COG2910 Putative NADH-flavin r  99.5 4.1E-13   1E-17   94.4  10.2  195    1-203     1-200 (211)
 50 KOG2774 consensus               99.4 2.9E-11 7.3E-16   83.8  13.7  225    2-229    46-299 (366)
 51 PRK05693 short chain dehydroge  99.2 1.9E-09   5E-14   73.4  15.6  147    1-158     1-176 (274)
 52 PRK10538 3-hydroxy acid dehydr  99.2 8.1E-10 2.1E-14   75.5  12.4  191    1-205     1-225 (248)
 53 PRK08017 short chain dehydroge  99.1 9.1E-10 2.3E-14   75.2  11.5  191    3-208     5-228 (256)
 54 PRK06101 short chain dehydroge  99.1 9.7E-10 2.5E-14   75.1  10.9  185    1-209     1-212 (241)
 55 PRK08340 glucose-1-dehydrogena  99.1 2.5E-09 6.3E-14   72.8  12.8  202    1-213     1-252 (259)
 56 KOG1203 consensus               99.1 9.6E-10 2.4E-14   75.1  10.3  190    1-203    80-290 (411)
 57 PRK07102 short chain dehydroge  99.0 2.1E-09 5.3E-14   73.2   9.4  185    1-209     1-219 (243)
 58 PRK05993 short chain dehydroge  99.0 2.6E-09 6.6E-14   72.6   8.6  146    3-159     7-182 (277)
 59 PRK09009 C factor cell-cell si  99.0 9.5E-09 2.4E-13   69.4  11.0  198    1-218     1-235 (235)
 60 PRK05653 fabG 3-ketoacyl-(acyl  99.0 1.1E-08 2.7E-13   69.1  10.8  193    2-213     7-243 (246)
 61 PRK05872 short chain dehydroge  99.0   3E-08 7.7E-13   66.6  12.8  192    2-210    11-240 (296)
 62 PRK05599 hypothetical protein;  98.9 2.9E-08 7.4E-13   66.7  12.2  183    1-209     1-220 (246)
 63 PRK07454 short chain dehydroge  98.9   2E-08 5.2E-13   67.5  10.9  185    1-205     6-226 (241)
 64 PRK06483 short chain dehydroge  98.9 7.2E-08 1.8E-12   64.4  13.3  194    2-214     4-233 (236)
 65 PRK08219 short chain dehydroge  98.9 1.9E-08 4.7E-13   67.8  10.3  187    1-207     3-215 (226)
 66 PRK07024 short chain dehydroge  98.9 7.6E-08 1.9E-12   64.3  13.1  183    2-208     4-220 (256)
 67 PRK08267 short chain dehydroge  98.9 2.9E-08 7.4E-13   66.7  10.9  191    1-211     1-229 (258)
 68 PRK09072 short chain dehydroge  98.9 3.5E-08   9E-13   66.2  10.9  187    2-208     7-226 (262)
 69 PRK06482 short chain dehydroge  98.9 1.3E-08 3.4E-13   68.6   8.3  146    3-159     5-182 (276)
 70 PRK12826 3-ketoacyl-(acyl-carr  98.9 4.7E-08 1.2E-12   65.5  11.0  197    2-216     8-251 (253)
 71 PRK08251 short chain dehydroge  98.9 4.3E-08 1.1E-12   65.7  10.8  184    2-209     4-224 (248)
 72 PRK12825 fabG 3-ketoacyl-(acyl  98.9 7.1E-08 1.8E-12   64.4  11.8  193    2-213     9-246 (250)
 73 PRK05650 short chain dehydroge  98.9 2.6E-08 6.7E-13   66.9   9.6  189    2-205     2-228 (270)
 74 PRK06182 short chain dehydroge  98.8   2E-08 5.1E-13   67.6   8.3  146    3-159     6-180 (273)
 75 PRK08217 fabG 3-ketoacyl-(acyl  98.8 9.1E-08 2.3E-12   63.8  11.6  191    2-212     7-249 (253)
 76 PRK07231 fabG 3-ketoacyl-(acyl  98.8 7.6E-08 1.9E-12   64.3  11.2  193    2-213     8-247 (250)
 77 PRK06180 short chain dehydroge  98.8 2.4E-08 6.1E-13   67.1   8.5  148    1-159     4-184 (277)
 78 PRK07326 short chain dehydroge  98.8 6.4E-08 1.6E-12   64.7  10.6  183    2-207     7-222 (235)
 79 PRK06924 short chain dehydroge  98.8 9.8E-08 2.5E-12   63.6  11.4  196    1-210     1-247 (251)
 80 PRK07578 short chain dehydroge  98.8 5.6E-08 1.4E-12   65.0  10.2  178    1-211     1-199 (199)
 81 PRK08703 short chain dehydroge  98.8 1.8E-07 4.6E-12   62.1  12.4  187    2-210     8-239 (239)
 82 PRK06914 short chain dehydroge  98.8 8.9E-08 2.3E-12   63.9  10.8  145    3-158     6-186 (280)
 83 PRK05565 fabG 3-ketoacyl-(acyl  98.8 4.8E-08 1.2E-12   65.4   9.4  193    2-213     7-244 (247)
 84 PRK05875 short chain dehydroge  98.8 2.8E-07   7E-12   61.1  12.8  195    2-215     9-253 (277)
 85 PRK08220 2,3-dihydroxybenzoate  98.8 6.4E-08 1.6E-12   64.7   9.6  199    2-213    10-248 (253)
 86 PRK05557 fabG 3-ketoacyl-(acyl  98.8 1.1E-07 2.7E-12   63.5  10.6  193    2-213     7-244 (248)
 87 COG0300 DltE Short-chain dehyd  98.8 1.8E-07 4.7E-12   62.1  11.8  187    1-206     7-230 (265)
 88 PRK07890 short chain dehydroge  98.8 3.9E-07   1E-11   60.2  13.2  202    2-214     7-255 (258)
 89 PRK07832 short chain dehydroge  98.8 8.6E-08 2.2E-12   64.0   9.8  193    2-209     2-238 (272)
 90 PRK07666 fabG 3-ketoacyl-(acyl  98.8 1.3E-07 3.2E-12   63.0  10.5  185    2-207     8-227 (238)
 91 PRK07479 consensus              98.8   3E-07 7.6E-12   60.9  12.2  198    2-214     7-250 (252)
 92 PRK07023 short chain dehydroge  98.7 2.4E-07   6E-12   61.5  11.5  147    1-158     2-182 (243)
 93 PRK07060 short chain dehydroge  98.7 3.6E-07 9.1E-12   60.5  12.4  193    2-213    11-241 (245)
 94 PRK08945 short chain dehydroge  98.7 2.5E-07 6.5E-12   61.3  11.5  185    2-209    15-243 (245)
 95 PRK09186 flagellin modificatio  98.7 3.2E-07 8.2E-12   60.7  11.8  201    2-213     6-252 (255)
 96 PRK07825 short chain dehydroge  98.7 2.2E-07 5.6E-12   61.7  10.8  184    2-208     7-221 (273)
 97 PRK06953 short chain dehydroge  98.7 2.3E-07 5.9E-12   61.5  10.9  191    1-218     1-222 (222)
 98 PRK09291 short chain dehydroge  98.7 7.4E-08 1.9E-12   64.4   8.3  147    2-159     4-179 (257)
 99 PRK06181 short chain dehydroge  98.7 5.2E-07 1.3E-11   59.5  12.4  191    2-207     3-230 (263)
100 PRK07775 short chain dehydroge  98.7 1.5E-07 3.8E-12   62.6   9.5  192    2-205    12-242 (275)
101 PRK05786 fabG 3-ketoacyl-(acyl  98.7 8.7E-07 2.2E-11   58.2  13.4  189    2-214     7-235 (238)
102 PRK06139 short chain dehydroge  98.7 3.9E-07 9.9E-12   60.2  11.6  190    2-209     8-234 (324)
103 PRK08177 short chain dehydroge  98.7 7.3E-07 1.9E-11   58.7  12.8  190    2-218     3-225 (225)
104 PRK07577 short chain dehydroge  98.7 2.9E-08 7.4E-13   66.7   5.5  186    2-213     5-231 (234)
105 PRK08263 short chain dehydroge  98.7 1.1E-07 2.8E-12   63.4   8.4  146    3-159     6-183 (275)
106 PRK07201 short chain dehydroge  98.7 3.6E-07 9.2E-12   60.4  11.0  179    2-203   378-594 (663)
107 PRK12824 acetoacetyl-CoA reduc  98.7 3.2E-07 8.1E-12   60.7  10.7  192    3-213     5-241 (245)
108 PRK07035 short chain dehydroge  98.7 5.3E-07 1.3E-11   59.5  11.5  192    2-212    10-248 (252)
109 PRK05884 short chain dehydroge  98.7 3.7E-07 9.3E-12   60.4  10.6  183    1-213     1-217 (223)
110 PRK07856 short chain dehydroge  98.7 4.9E-08 1.2E-12   65.4   6.0  190    2-214    10-240 (254)
111 PRK12939 short chain dehydroge  98.6 5.4E-07 1.4E-11   59.4  10.7  193    2-213     9-246 (250)
112 PRK07041 short chain dehydroge  98.6   3E-07 7.8E-12   60.8   9.3  193    2-213     9-236 (240)
113 PRK07677 short chain dehydroge  98.6 1.1E-06 2.7E-11   57.7  11.9  196    2-216     5-249 (254)
114 COG4221 Short-chain alcohol de  98.6   1E-06 2.6E-11   57.8  11.8  189    2-205     8-231 (246)
115 PRK05717 oxidoreductase; Valid  98.6 1.5E-06 3.8E-11   56.9  12.6  198    2-213    12-246 (255)
116 PRK07774 short chain dehydroge  98.6 1.8E-06 4.6E-11   56.5  12.9  190    2-214     8-246 (250)
117 PRK06550 fabG 3-ketoacyl-(acyl  98.6 6.1E-07 1.6E-11   59.1  10.5  190    2-213     7-233 (237)
118 KOG4288 consensus               98.6 4.1E-08   1E-12   65.8   4.4  104   92-210   150-271 (283)
119 PRK08063 enoyl-(acyl carrier p  98.6 8.4E-07 2.1E-11   58.3  11.2  193    2-213     6-245 (250)
120 PRK07776 consensus              98.6 1.7E-06 4.3E-11   56.6  12.7  193    2-213    10-244 (252)
121 PRK12384 sorbitol-6-phosphate   98.6 1.1E-06 2.8E-11   57.7  11.5  201    3-214     5-256 (259)
122 PRK12429 3-hydroxybutyrate deh  98.6 6.4E-07 1.6E-11   59.0  10.2  201    2-213     6-254 (258)
123 PRK06124 gluconate 5-dehydroge  98.6 8.5E-07 2.2E-11   58.3  10.8  193    2-213    16-254 (259)
124 PRK06179 short chain dehydroge  98.6   2E-07 5.2E-12   61.8   7.6  144    3-159     7-179 (270)
125 PRK12828 short chain dehydroge  98.6 6.1E-07 1.5E-11   59.1  10.0  191    2-214     9-236 (239)
126 TIGR01830 3oxo_ACP_reduc 3-oxo  98.6 8.4E-07 2.1E-11   58.3  10.7  187    3-213     1-236 (238)
127 PRK06346 consensus              98.6 1.3E-06 3.2E-11   57.3  11.6  194    2-213     7-248 (251)
128 PRK12823 benD 1,6-dihydroxycyc  98.6   2E-06 5.1E-11   56.2  12.5  199    2-213    10-257 (260)
129 PRK07109 short chain dehydroge  98.6 1.3E-06 3.4E-11   57.2  11.3  191    3-211    11-239 (338)
130 COG1748 LYS9 Saccharopine dehy  98.6 3.9E-07 9.8E-12   60.3   8.5   74    1-75      2-79  (389)
131 PRK08265 short chain dehydroge  98.6 1.6E-06   4E-11   56.8  11.1  198    2-213     8-243 (261)
132 PRK06125 short chain dehydroge  98.6 1.1E-06 2.7E-11   57.7  10.2  199    2-213     9-252 (259)
133 PRK09496 trkA potassium transp  98.5 2.8E-07 7.2E-12   61.0   7.2   71    1-71      1-72  (455)
134 PRK09134 short chain dehydroge  98.5 3.1E-06 7.9E-11   55.1  12.5  198    2-218    11-248 (256)
135 PRK09242 tropinone reductase;   98.5 1.3E-06 3.2E-11   57.3  10.5  193    2-213    12-252 (258)
136 PRK08264 short chain dehydroge  98.5 9.2E-07 2.4E-11   58.1   9.7  144    2-159     7-177 (235)
137 PRK07067 sorbitol dehydrogenas  98.5   2E-06 5.1E-11   56.2  11.4  204    2-216     7-255 (256)
138 PRK06500 short chain dehydroge  98.5 3.2E-06 8.2E-11   55.0  12.3  197    2-213     8-245 (249)
139 PRK08277 D-mannonate oxidoredu  98.5 9.3E-07 2.4E-11   58.1   9.6  201    2-213    12-271 (278)
140 PRK07707 consensus              98.5 2.5E-07 6.5E-12   61.3   6.6  192    3-213     5-236 (239)
141 PRK09135 pteridine reductase;   98.5 1.9E-06 4.9E-11   56.3  10.9  195    3-217     9-248 (249)
142 PRK06057 short chain dehydroge  98.5 2.4E-06   6E-11   55.8  11.3  195    2-213     9-246 (255)
143 PRK07097 gluconate 5-dehydroge  98.5 1.9E-06 4.9E-11   56.3  10.7  200    2-213    12-256 (265)
144 PRK05867 short chain dehydroge  98.5 2.1E-06 5.4E-11   56.0  11.0  200    2-214    11-250 (253)
145 PRK12742 oxidoreductase; Provi  98.5 3.6E-06 9.2E-11   54.7  12.1  194    2-212     8-233 (237)
146 PRK12936 3-ketoacyl-(acyl-carr  98.5 1.4E-06 3.6E-11   57.1   9.5  196    2-213     8-241 (245)
147 PRK06523 short chain dehydroge  98.5 6.9E-07 1.8E-11   58.8   7.9  200    1-213    10-255 (260)
148 PRK08085 gluconate 5-dehydroge  98.5 2.2E-06 5.7E-11   55.9  10.4  194    2-215    11-251 (254)
149 PRK06196 oxidoreductase; Provi  98.5 2.3E-06 5.9E-11   55.8  10.4  157    2-159    28-215 (316)
150 pfam08659 KR KR domain. This e  98.5 5.5E-07 1.4E-11   59.4   6.8  144    2-158     2-178 (181)
151 PRK07806 short chain dehydroge  98.5 1.2E-05 3.1E-10   51.7  13.7  201    2-214     8-243 (248)
152 PRK07831 short chain dehydroge  98.5 1.9E-06 4.8E-11   56.3   9.5  193    2-214    18-260 (261)
153 PRK06841 short chain dehydroge  98.5 4.5E-06 1.2E-10   54.2  11.5  193    2-213    17-251 (255)
154 PRK08993 2-deoxy-D-gluconate 3  98.5 4.6E-06 1.2E-10   54.1  11.3  193    2-213    12-249 (253)
155 PRK07904 short chain dehydroge  98.5 4.7E-06 1.2E-10   54.1  11.3  183    2-209    10-229 (253)
156 PRK08339 short chain dehydroge  98.4 2.2E-06 5.7E-11   55.9   9.6  201    2-214    10-258 (263)
157 PRK06172 short chain dehydroge  98.4 5.7E-06 1.4E-10   53.6  11.5  192    2-213     9-249 (253)
158 PRK07576 short chain dehydroge  98.4 4.3E-06 1.1E-10   54.3  10.8  193    2-213    10-248 (260)
159 PRK07074 short chain dehydroge  98.4   2E-06 5.1E-11   56.2   9.0  191    2-212     4-238 (256)
160 PRK09730 hypothetical protein;  98.4   1E-05 2.7E-10   52.1  12.3  193    1-211     1-244 (247)
161 PRK08213 gluconate 5-dehydroge  98.4 5.4E-06 1.4E-10   53.7  10.8  199    2-213    14-255 (259)
162 pfam03721 UDPG_MGDP_dh_N UDP-g  98.4 8.9E-07 2.3E-11   58.2   6.7   72    1-75      1-86  (185)
163 PRK07523 gluconate 5-dehydroge  98.4   3E-06 7.5E-11   55.2   9.2  193    2-213    11-246 (251)
164 TIGR03026 NDP-sugDHase nucleot  98.4 9.9E-07 2.5E-11   57.9   6.4   73    1-76      1-88  (411)
165 PRK07478 short chain dehydroge  98.4   1E-05 2.6E-10   52.2  11.4  195    2-215     8-250 (254)
166 PRK06701 short chain dehydroge  98.4 2.6E-05 6.6E-10   49.8  13.3  193    2-213    47-284 (289)
167 TIGR03206 benzo_BadH 2-hydroxy  98.4 5.2E-06 1.3E-10   53.8   9.6  198    2-213     5-247 (250)
168 PRK06079 enoyl-(acyl carrier p  98.3 2.1E-05 5.3E-10   50.4  12.5  193    2-213     9-248 (252)
169 PRK06171 sorbitol-6-phosphate   98.3 1.5E-06 3.9E-11   56.8   6.6  198    2-213    11-262 (266)
170 PRK06138 short chain dehydroge  98.3 4.8E-06 1.2E-10   54.0   9.1  200    2-213     7-248 (252)
171 PRK12827 short chain dehydroge  98.3 3.7E-06 9.5E-11   54.6   8.5  192    2-212     8-248 (251)
172 TIGR03325 BphB_TodD cis-2,3-di  98.3 1.4E-05 3.6E-10   51.3  11.4  205    2-220     7-259 (262)
173 PRK08324 short chain dehydroge  98.3 1.3E-05 3.4E-10   51.5  11.2  200    3-214   424-670 (676)
174 PRK08642 fabG 3-ketoacyl-(acyl  98.3 2.9E-05 7.5E-10   49.5  12.9  193    2-213     8-250 (254)
175 PRK07062 short chain dehydroge  98.3   1E-05 2.7E-10   52.1  10.5  201    2-213    10-260 (265)
176 PRK05866 short chain dehydroge  98.3 3.7E-06 9.4E-11   54.7   7.8  181    2-204    42-259 (290)
177 PRK12743 acetoin dehydrogenase  98.3 9.2E-06 2.4E-10   52.4   9.8  192    3-213     5-242 (253)
178 PRK08643 acetoin reductase; Va  98.3 1.4E-05 3.6E-10   51.3  10.7  200    3-213     5-252 (256)
179 PRK11559 garR tartronate semia  98.3 3.4E-06 8.6E-11   54.9   7.5   97    1-106     2-98  (295)
180 PRK07417 arogenate dehydrogena  98.3 3.4E-06 8.6E-11   54.9   7.5   68    1-75      2-69  (280)
181 PRK06113 7-alpha-hydroxysteroi  98.3 7.6E-06 1.9E-10   52.9   9.4  194    2-214    13-250 (255)
182 pfam03446 NAD_binding_2 NAD bi  98.3 4.9E-06 1.2E-10   54.0   8.3   76    1-84      2-77  (163)
183 PRK06484 short chain dehydroge  98.3 3.1E-05 7.8E-10   49.4  12.3  190    2-210     7-240 (530)
184 PRK07814 short chain dehydroge  98.3 3.9E-05 9.9E-10   48.8  12.9  192    2-213    12-250 (263)
185 PRK08594 enoyl-(acyl carrier p  98.3 3.5E-05   9E-10   49.1  12.6  193    2-213     8-251 (256)
186 PRK06200 2,3-dihydroxy-2,3-dih  98.3 1.9E-05 4.9E-10   50.6  11.2  200    2-213     8-256 (263)
187 PRK06949 short chain dehydroge  98.3 8.3E-06 2.1E-10   52.7   9.3  189    2-210    11-253 (258)
188 COG0569 TrkA K+ transport syst  98.3 5.9E-06 1.5E-10   53.5   8.5   72    1-72      1-74  (225)
189 PRK13394 3-hydroxybutyrate deh  98.3   8E-06   2E-10   52.7   9.2  200    2-213     9-258 (262)
190 PRK12747 short chain dehydroge  98.3   2E-05 5.1E-10   50.5  11.2  195    2-214     6-250 (252)
191 PRK08628 short chain dehydroge  98.3 2.2E-05 5.7E-10   50.2  11.3  201    2-213     9-249 (258)
192 PRK06194 hypothetical protein;  98.3 3.9E-05   1E-09   48.8  12.6  214    2-230     8-276 (301)
193 PRK06463 fabG 3-ketoacyl-(acyl  98.3 1.8E-05 4.6E-10   50.7  10.8  195    2-214     9-246 (254)
194 PRK06227 consensus              98.3   1E-05 2.6E-10   52.1   9.6  197    2-213     7-247 (256)
195 PRK07985 oxidoreductase; Provi  98.3 2.9E-05 7.4E-10   49.6  11.8  193    2-214    51-291 (294)
196 PRK12829 short chain dehydroge  98.3 2.8E-05 7.1E-10   49.6  11.7  201    2-213    13-260 (264)
197 PRK06484 short chain dehydroge  98.3 2.8E-05   7E-10   49.7  11.6  191    3-212   277-511 (530)
198 PRK12745 3-ketoacyl-(acyl-carr  98.3 3.3E-05 8.5E-10   49.2  12.0  194    3-214     8-254 (259)
199 PRK06198 short chain dehydroge  98.3 1.2E-05   3E-10   51.8   9.6  190    2-203     8-239 (268)
200 PRK06398 aldose dehydrogenase;  98.2 4.6E-06 1.2E-10   54.1   7.3  197    2-213     8-244 (256)
201 PRK12859 3-ketoacyl-(acyl-carr  98.2 4.8E-05 1.2E-09   48.3  12.3  193    2-213     8-254 (257)
202 PRK12746 short chain dehydroge  98.2 2.4E-05 6.2E-10   50.0  10.7  196    2-213     8-251 (254)
203 PRK12428 3-alpha-hydroxysteroi  98.2 6.9E-06 1.8E-10   53.1   7.9  204    2-213     7-249 (261)
204 PRK12938 acetyacetyl-CoA reduc  98.2 8.7E-06 2.2E-10   52.5   8.3  192    3-213     6-242 (246)
205 PRK05876 short chain dehydroge  98.2 2.8E-05 7.1E-10   49.7  10.7  196    2-212     8-247 (275)
206 PRK08278 short chain dehydroge  98.2 2.2E-05 5.5E-10   50.3   9.9  185    2-204     8-234 (273)
207 PRK06128 oxidoreductase; Provi  98.2 8.2E-05 2.1E-09   47.0  12.9  193    2-214    57-297 (300)
208 PRK06077 fabG 3-ketoacyl-(acyl  98.2 8.2E-05 2.1E-09   47.0  12.8  201    2-213     5-241 (249)
209 PRK12744 short chain dehydroge  98.2 6.3E-05 1.6E-09   47.6  11.9  198    2-211    10-251 (257)
210 PRK12937 short chain dehydroge  98.2 3.8E-05 9.8E-10   48.9  10.7  191    2-211     7-241 (245)
211 PRK05854 short chain dehydroge  98.2 3.5E-05 8.9E-10   49.1  10.5  158    2-159    16-211 (314)
212 PRK06123 short chain dehydroge  98.2 9.4E-05 2.4E-09   46.6  12.6  193    3-213     6-248 (249)
213 PRK07453 protochlorophyllide o  98.2 3.7E-05 9.3E-10   49.0  10.3  158    2-159     8-228 (322)
214 PRK07063 short chain dehydroge  98.1 1.5E-05 3.8E-10   51.2   8.3  200    2-214     9-253 (259)
215 PRK06947 glucose-1-dehydrogena  98.1 8.7E-05 2.2E-09   46.8  11.6  193    3-213     9-251 (252)
216 PRK07069 short chain dehydroge  98.1 1.9E-05 4.8E-10   50.6   8.1  201    2-213     1-247 (251)
217 PRK08226 short chain dehydroge  98.1 4.1E-05   1E-09   48.7   9.8  200    2-215     8-254 (263)
218 PRK08589 short chain dehydroge  98.1   8E-05   2E-09   47.1  11.2  197    2-213     8-251 (272)
219 PRK12935 acetoacetyl-CoA reduc  98.1 4.9E-05 1.2E-09   48.3   9.9  191    2-211     8-242 (247)
220 PRK06522 2-dehydropantoate 2-r  98.1 1.9E-05 4.9E-10   50.6   7.8   73    1-73      1-77  (307)
221 PRK06935 2-deoxy-D-gluconate 3  98.1 3.1E-05   8E-10   49.4   8.8  193    2-213    17-254 (258)
222 PRK12367 short chain dehydroge  98.1 1.5E-05 3.8E-10   51.2   7.0   72    2-73     19-91  (250)
223 PRK08936 glucose-1-dehydrogena  98.1 8.6E-05 2.2E-09   46.9  10.8  197    2-213     9-249 (261)
224 PRK11064 wecC UDP-N-acetyl-D-m  98.1 2.7E-05 6.8E-10   49.8   8.2  101    1-104     4-120 (415)
225 pfam03435 Saccharop_dh Sacchar  98.1 2.2E-05 5.5E-10   50.3   7.7   72    3-75      1-78  (384)
226 PRK12748 3-ketoacyl-(acyl-carr  98.1 0.00012 2.9E-09   46.1  11.4  193    2-213     7-253 (257)
227 PRK12481 2-deoxy-D-gluconate 3  98.1 5.3E-05 1.3E-09   48.1   9.5  193    2-213    10-247 (251)
228 PRK06505 enoyl-(acyl carrier p  98.0 0.00024 6.1E-09   44.3  12.7  193    2-213     9-250 (271)
229 smart00822 PKS_KR This enzymat  98.0 5.7E-05 1.4E-09   47.9   9.4  144    2-158     2-178 (180)
230 PRK06197 short chain dehydroge  98.0 6.3E-05 1.6E-09   47.6   9.6  156    2-157    18-212 (306)
231 KOG1610 consensus               98.0 7.5E-05 1.9E-09   47.2   9.9  143    3-159    32-211 (322)
232 PRK06114 short chain dehydroge  98.0 0.00012 2.9E-09   46.1  10.4  193    2-213    18-258 (262)
233 PRK07533 enoyl-(acyl carrier p  98.0 0.00028   7E-09   44.0  12.4  192    2-213     8-249 (254)
234 TIGR01829 AcAcCoA_reduct aceto  98.0 4.7E-05 1.2E-09   48.3   8.4  181    4-204     4-228 (244)
235 PRK07370 enoyl-(acyl carrier p  98.0 0.00036 9.1E-09   43.3  12.8  193    2-213     9-253 (259)
236 pfam08643 DUF1776 Fungal famil  98.0  0.0005 1.3E-08   42.5  13.4   53    3-55      6-63  (296)
237 PRK05855 short chain dehydroge  98.0 4.8E-05 1.2E-09   48.3   8.1  193    2-207   317-552 (582)
238 PRK08655 prephenate dehydrogen  98.0 3.1E-05 7.9E-10   49.4   7.0   66    1-74      1-68  (441)
239 COG1028 FabG Dehydrogenases wi  98.0 8.8E-05 2.2E-09   46.8   9.3  145    1-157     6-188 (251)
240 PRK08229 2-dehydropantoate 2-r  98.0 5.3E-05 1.3E-09   48.1   8.1   72    1-73      3-82  (341)
241 PRK08416 7-alpha-hydroxysteroi  98.0 0.00018 4.5E-09   45.1  10.7  193    2-213    10-256 (260)
242 KOG1208 consensus               97.9 0.00014 3.5E-09   45.7   9.7  159    2-161    37-232 (314)
243 pfam01210 NAD_Gly3P_dh_N NAD-d  97.9 5.1E-05 1.3E-09   48.2   7.5   75    1-75      1-81  (159)
244 PRK08415 enoyl-(acyl carrier p  97.9 0.00069 1.8E-08   41.7  13.2  197    2-213     7-248 (274)
245 PRK07984 enoyl-(acyl carrier p  97.9 0.00051 1.3E-08   42.5  12.4  197    2-213     8-250 (262)
246 KOG1205 consensus               97.9 0.00017 4.4E-09   45.1   9.9  184    2-204    14-238 (282)
247 PRK08306 dipicolinate synthase  97.9 8.7E-05 2.2E-09   46.8   8.3   67    1-78      3-69  (296)
248 PRK07791 short chain dehydroge  97.9 0.00027   7E-09   44.0  10.6  194    2-214     8-256 (285)
249 PRK08507 prephenate dehydrogen  97.9 6.5E-05 1.7E-09   47.5   7.4   67    1-75      1-69  (275)
250 PRK05708 2-dehydropantoate 2-r  97.9 8.9E-05 2.3E-09   46.8   8.0   44    1-44      3-46  (305)
251 COG2084 MmsB 3-hydroxyisobutyr  97.9 5.4E-05 1.4E-09   48.0   6.8   97    1-106     1-98  (286)
252 pfam00106 adh_short short chai  97.8 7.3E-05 1.9E-09   47.2   7.0  133    2-145     2-165 (167)
253 PRK06603 enoyl-(acyl carrier p  97.8 0.00075 1.9E-08   41.5  11.9  197    2-213    10-251 (260)
254 PRK00094 gpsA NAD(P)H-dependen  97.8 0.00014 3.6E-09   45.6   8.2   75    1-75      2-82  (325)
255 PRK08159 enoyl-(acyl carrier p  97.8  0.0011 2.7E-08   40.6  12.6  193    2-211    12-251 (272)
256 COG1004 Ugd Predicted UDP-gluc  97.8 9.9E-05 2.5E-09   46.5   7.1   77    1-77      1-89  (414)
257 PRK08862 short chain dehydroge  97.8 0.00033 8.5E-09   43.5   9.8  143    2-158     7-187 (227)
258 PRK07889 enoyl-(acyl carrier p  97.8   0.001 2.6E-08   40.7  12.1  196    2-213     9-250 (256)
259 PRK12921 2-dehydropantoate 2-r  97.8 0.00015 3.8E-09   45.5   7.7   45    1-46      1-45  (306)
260 pfam02254 TrkA_N TrkA-N domain  97.8 0.00015 3.8E-09   45.5   7.6   69    3-72      1-69  (115)
261 PRK09599 6-phosphogluconate de  97.7 0.00015 3.8E-09   45.5   7.3   77    1-82      1-77  (301)
262 PRK06997 enoyl-(acyl carrier p  97.7  0.0016 4.2E-08   39.6  12.7  192    2-213     8-250 (260)
263 TIGR01963 PHB_DH 3-hydroxybuty  97.7  0.0015 3.9E-08   39.7  12.4  195    3-213     4-254 (258)
264 KOG4039 consensus               97.7 0.00011 2.8E-09   46.3   5.7  143    1-161    19-172 (238)
265 COG1893 ApbA Ketopantoate redu  97.7 0.00025 6.4E-09   44.2   7.5   71    1-72      1-75  (307)
266 PRK12490 6-phosphogluconate de  97.7 0.00022 5.7E-09   44.5   7.3   77    1-82      1-77  (298)
267 PRK06940 short chain dehydroge  97.6 0.00064 1.6E-08   41.9   9.4  202    2-213     6-265 (277)
268 PRK08261 fabG 3-ketoacyl-(acyl  97.6  0.0019 4.9E-08   39.2  11.6  195    2-213   209-442 (447)
269 PRK07502 cyclohexadienyl dehyd  97.6  0.0003 7.6E-09   43.8   7.2   68    2-75      8-77  (307)
270 PRK07531 bifunctional 3-hydrox  97.6 0.00024 6.1E-09   44.3   6.5  102    1-109     3-118 (489)
271 KOG1209 consensus               97.6 0.00022 5.5E-09   44.6   6.1   72    2-73      9-90  (289)
272 PRK07792 fabG 3-ketoacyl-(acyl  97.5  0.0018 4.6E-08   39.3  10.2  193    2-214    11-251 (303)
273 PRK03562 glutathione-regulated  97.5 0.00026 6.5E-09   44.2   5.8   76    1-76    400-475 (615)
274 COG0677 WecC UDP-N-acetyl-D-ma  97.5 0.00025 6.3E-09   44.2   5.7  109    1-111    10-134 (436)
275 PRK08690 enoyl-(acyl carrier p  97.5  0.0026 6.5E-08   38.5  10.8  193    2-213     8-251 (261)
276 PRK00045 hemA glutamyl-tRNA re  97.5 0.00083 2.1E-08   41.2   8.0   66    2-73    184-251 (429)
277 COG2085 Predicted dinucleotide  97.4 0.00045 1.2E-08   42.7   6.5   69    1-75      2-71  (211)
278 PRK00711 D-amino acid dehydrog  97.4 0.00022 5.6E-09   44.5   4.8   32    1-32      1-32  (416)
279 PRK07424 bifunctional sterol d  97.4 0.00045 1.1E-08   42.8   6.4   71    2-73    182-256 (410)
280 PRK08303 short chain dehydroge  97.4  0.0051 1.3E-07   36.7  11.7  183    2-202    10-253 (305)
281 PRK03659 glutathione-regulated  97.4 0.00043 1.1E-08   42.8   6.2   75    2-76    402-476 (602)
282 pfam01488 Shikimate_DH Shikima  97.4 0.00093 2.4E-08   41.0   7.9   67    1-73     13-84  (134)
283 PRK09496 trkA potassium transp  97.4   0.001 2.7E-08   40.7   8.0   37    2-39    234-270 (455)
284 PRK00048 dihydrodipicolinate r  97.4  0.0013 3.4E-08   40.1   8.0   32    1-32      3-37  (265)
285 TIGR02853 spore_dpaA dipicolin  97.4 0.00053 1.4E-08   42.3   5.9   48  148-201   146-197 (288)
286 PRK10669 putative cation:proto  97.4  0.0013 3.4E-08   40.1   7.9   27  261-287   522-548 (558)
287 PRK11880 pyrroline-5-carboxyla  97.3  0.0014 3.5E-08   40.0   7.9   67    1-75      3-73  (267)
288 PRK07680 late competence prote  97.3  0.0018 4.7E-08   39.3   8.3   67    1-75      1-73  (273)
289 PRK06249 2-dehydropantoate 2-r  97.3  0.0017 4.4E-08   39.4   8.0   70    1-72      6-80  (313)
290 pfam01262 AlaDh_PNT_C Alanine   97.3   0.002 5.2E-08   39.0   8.0   78    1-78     21-98  (150)
291 TIGR01035 hemA glutamyl-tRNA r  97.3  0.0013 3.4E-08   40.0   7.1   71    2-73    187-260 (436)
292 KOG1210 consensus               97.3  0.0063 1.6E-07   36.2  10.5  187    2-203    35-260 (331)
293 pfam02826 2-Hacid_dh_C D-isome  97.2  0.0012 3.1E-08   40.3   6.6   99    1-121    37-135 (176)
294 pfam00056 Ldh_1_N lactate/mala  97.2 0.00083 2.1E-08   41.3   5.5   73    1-75      1-80  (142)
295 PRK09260 3-hydroxybutyryl-CoA   97.2 0.00045 1.2E-08   42.7   4.1   36    2-37      4-39  (289)
296 KOG0725 consensus               97.2  0.0046 1.2E-07   37.0   9.2  191    1-205     9-248 (270)
297 PRK07066 3-hydroxybutyryl-CoA   97.2  0.0011 2.9E-08   40.4   5.9  100    2-108     9-122 (321)
298 pfam03807 F420_oxidored NADP o  97.2  0.0017 4.3E-08   39.5   6.8   69    2-76      1-70  (93)
299 COG0240 GpsA Glycerol-3-phosph  97.1   0.004   1E-07   37.4   8.1   74    1-74      2-81  (329)
300 TIGR02632 RhaD_aldol-ADH rhamn  97.1  0.0062 1.6E-07   36.3   9.0  197    3-213   427-702 (709)
301 PRK13302 putative L-aspartate   97.1  0.0031 7.9E-08   38.0   7.2   68    1-75      7-78  (271)
302 PRK10754 quinone oxidoreductas  97.0  0.0041   1E-07   37.3   7.8   72    2-73    143-218 (327)
303 COG0287 TyrA Prephenate dehydr  97.0   0.003 7.7E-08   38.0   7.0   71    1-74      4-74  (279)
304 COG1064 AdhP Zn-dependent alco  97.0  0.0058 1.5E-07   36.4   8.4   70    2-73    169-238 (339)
305 PRK06129 3-hydroxyacyl-CoA deh  97.0 0.00067 1.7E-08   41.8   3.4  101    2-109     4-122 (308)
306 pfam08338 DUF1731 Domain of un  97.0 0.00053 1.3E-08   42.4   2.8   38  245-283    11-48  (48)
307 PRK06223 malate dehydrogenase;  97.0   0.002 5.1E-08   39.1   5.7   71    1-74      1-79  (312)
308 PRK06476 pyrroline-5-carboxyla  97.0  0.0053 1.3E-07   36.7   7.8   69    1-75      1-72  (255)
309 pfam02558 ApbA Ketopantoate re  97.0   0.005 1.3E-07   36.8   7.7   43    3-46      1-43  (150)
310 smart00829 PKS_ER Enoylreducta  97.0  0.0053 1.4E-07   36.6   7.8   73    1-73    106-184 (288)
311 TIGR00872 gnd_rel 6-phosphoglu  97.0   0.002   5E-08   39.1   5.5   40    1-40      1-41  (341)
312 COG0373 HemA Glutamyl-tRNA red  97.0  0.0047 1.2E-07   37.0   7.4   66    2-73    180-247 (414)
313 PRK06732 phosphopantothenate--  96.9  0.0024 6.2E-08   38.6   5.9   74    1-75      1-92  (228)
314 TIGR01369 CPSaseII_lrg carbamo  96.9  0.0031   8E-08   38.0   6.2  222    2-241   575-847 (1089)
315 PRK06300 enoyl-(acyl carrier p  96.9   0.026 6.6E-07   32.7  10.8  192    2-211    10-282 (298)
316 PRK07588 hypothetical protein;  96.9  0.0016 4.1E-08   39.6   4.6   34    1-34      1-34  (391)
317 pfam10727 Rossmann-like Rossma  96.9  0.0021 5.4E-08   38.9   5.2   88    5-105     2-90  (111)
318 TIGR02817 adh_fam_1 zinc-bindi  96.9  0.0066 1.7E-07   36.1   7.6   70    2-71    153-225 (338)
319 cd01337 MDH_glyoxysomal_mitoch  96.9  0.0031   8E-08   37.9   5.9   73    1-74      1-78  (310)
320 cd05292 LDH_2 A subgroup of L-  96.8   0.003 7.6E-08   38.1   5.6   72    1-75      1-78  (308)
321 PRK06753 hypothetical protein;  96.8  0.0018 4.7E-08   39.3   4.5   34    1-34      1-34  (373)
322 KOG0409 consensus               96.8  0.0033 8.3E-08   37.9   5.8   76    2-85     37-112 (327)
323 PRK13940 glutamyl-tRNA reducta  96.8  0.0055 1.4E-07   36.5   6.9   68    2-73    183-251 (414)
324 PRK06545 prephenate dehydrogen  96.8  0.0056 1.4E-07   36.5   6.9   69    1-75      1-71  (357)
325 PRK06019 phosphoribosylaminoim  96.8  0.0067 1.7E-07   36.1   7.3   66    1-69      8-73  (377)
326 PRK12409 D-amino acid dehydrog  96.8  0.0024 6.1E-08   38.6   4.8   33    1-33      1-34  (410)
327 TIGR02114 coaB_strep phosphopa  96.8  0.0033 8.4E-08   37.8   5.4   85    1-87      1-105 (253)
328 PRK13304 L-aspartate dehydroge  96.7  0.0062 1.6E-07   36.3   6.5   68    1-75      2-72  (265)
329 cd01078 NAD_bind_H4MPT_DH NADP  96.7   0.011 2.8E-07   34.9   7.6   73    2-74     30-107 (194)
330 PRK12491 pyrroline-5-carboxyla  96.6   0.016 4.1E-07   33.9   8.0   67    1-75      3-74  (272)
331 PRK08309 short chain dehydroge  96.6  0.0074 1.9E-07   35.8   6.3   41    1-42      1-42  (182)
332 KOG0023 consensus               96.6   0.009 2.3E-07   35.3   6.7   71    1-73    183-255 (360)
333 PRK13243 glyoxylate reductase;  96.6   0.015 3.9E-07   34.0   7.7   21  207-227   236-256 (333)
334 COG3268 Uncharacterized conser  96.6  0.0052 1.3E-07   36.7   5.3   72    3-75      9-82  (382)
335 KOG1201 consensus               96.6   0.025 6.5E-07   32.8   8.7  186    2-210    40-263 (300)
336 pfam02737 3HCDH_N 3-hydroxyacy  96.5  0.0072 1.8E-07   35.9   5.9   36    2-37      1-36  (180)
337 TIGR00745 apbA_panE 2-dehydrop  96.5  0.0094 2.4E-07   35.2   6.2   48    2-49      1-52  (332)
338 cd00704 MDH Malate dehydrogena  96.5  0.0061 1.6E-07   36.3   5.3   72    1-74      1-86  (323)
339 PRK05086 malate dehydrogenase;  96.5  0.0073 1.9E-07   35.9   5.5   72    1-75      1-80  (312)
340 PRK06720 hypothetical protein;  96.4   0.024 6.2E-07   32.9   8.1   71    2-73     18-102 (169)
341 TIGR02823 oxido_YhdH putative   96.4  0.0067 1.7E-07   36.1   5.1  165    2-206   151-324 (330)
342 PRK13771 putative alcohol dehy  96.4   0.036 9.2E-07   31.9   8.8   70    1-73    164-234 (332)
343 COG1023 Gnd Predicted 6-phosph  96.4  0.0074 1.9E-07   35.8   5.1   46    1-46      1-46  (300)
344 PRK12439 NAD(P)H-dependent gly  96.4    0.02 5.1E-07   33.4   7.3   73    2-75      8-87  (340)
345 COG1712 Predicted dinucleotide  96.3   0.012 3.2E-07   34.5   6.1   68    1-75      1-71  (255)
346 PRK03369 murD UDP-N-acetylmura  96.3   0.023 5.9E-07   33.0   7.4   64    2-71     14-77  (487)
347 COG0111 SerA Phosphoglycerate   96.3   0.016   4E-07   34.0   6.4   18  208-225   230-247 (324)
348 PRK09288 purT phosphoribosylgl  96.3   0.022 5.6E-07   33.1   7.1   33    2-34     14-46  (395)
349 PRK07538 hypothetical protein;  96.3  0.0073 1.9E-07   35.9   4.5   33    1-33      1-33  (413)
350 PRK00436 argC N-acetyl-gamma-g  96.3   0.016 4.1E-07   33.9   6.3   30    1-30      2-33  (345)
351 PRK06436 glycerate dehydrogena  96.2   0.016   4E-07   34.0   6.2   31    2-32    124-154 (303)
352 PTZ00325 malate dehydrogenase;  96.2   0.016   4E-07   33.9   6.2   71    2-74      3-78  (313)
353 PRK07679 pyrroline-5-carboxyla  96.2   0.027 6.9E-07   32.6   7.3   67    1-75      4-76  (279)
354 cd05293 LDH_1 A subgroup of L-  96.2   0.014 3.6E-07   34.2   5.7   71    1-74      4-81  (312)
355 PRK10309 galactitol-1-phosphat  96.2   0.045 1.1E-06   31.3   8.3   41    3-43    164-205 (347)
356 TIGR02964 xanthine_xdhC xanthi  96.2   0.019 4.9E-07   33.5   6.3   71    1-71    116-193 (270)
357 COG3967 DltE Short-chain dehyd  96.1   0.029 7.4E-07   32.4   7.2   78    2-79      7-93  (245)
358 cd05294 LDH-like_MDH_nadp A la  96.1   0.014 3.6E-07   34.3   5.5   73    1-75      1-83  (309)
359 COG0039 Mdh Malate/lactate deh  96.1   0.011 2.8E-07   34.8   4.9   72    1-74      1-79  (313)
360 PRK09754 phenylpropionate diox  96.1   0.011 2.8E-07   34.8   4.8   31    2-32      5-37  (400)
361 TIGR01317 GOGAT_sm_gam glutama  96.1   0.043 1.1E-06   31.5   7.8   80    2-81    153-267 (517)
362 PRK11199 tyrA bifunctional cho  96.1   0.019 4.9E-07   33.5   6.0   51    2-73    100-151 (374)
363 PRK05671 aspartate-semialdehyd  96.1   0.024 6.2E-07   32.9   6.5   27    1-27      5-32  (336)
364 PRK05396 tdh L-threonine 3-deh  96.1   0.038 9.6E-07   31.8   7.4   36  190-226   218-254 (341)
365 pfam00070 Pyr_redox Pyridine n  96.1  0.0094 2.4E-07   35.2   4.3   33    2-34      1-33  (82)
366 PRK13303 L-aspartate dehydroge  96.1   0.024 6.1E-07   32.9   6.4   67    1-75      2-72  (265)
367 COG0345 ProC Pyrroline-5-carbo  96.0   0.042 1.1E-06   31.5   7.6   67    1-75      2-73  (266)
368 cd01338 MDH_choloroplast_like   96.0  0.0079   2E-07   35.7   3.9   71    1-73      3-87  (322)
369 PRK13984 putative oxidoreducta  96.0   0.068 1.7E-06   30.3   8.6   73    2-74    285-378 (604)
370 PRK05808 3-hydroxybutyryl-CoA   96.0    0.02   5E-07   33.4   5.9   36    2-37      5-40  (282)
371 PRK07530 3-hydroxybutyryl-CoA   96.0   0.019 4.8E-07   33.5   5.8   37    2-38      6-42  (292)
372 PRK01438 murD UDP-N-acetylmura  96.0   0.054 1.4E-06   30.9   8.1   65    1-71     15-84  (481)
373 TIGR03451 mycoS_dep_FDH mycoth  96.0    0.08   2E-06   29.9   8.9   17  207-224   249-265 (358)
374 PRK08410 2-hydroxyacid dehydro  96.0   0.029 7.5E-07   32.4   6.6   21  207-227   228-248 (311)
375 cd01336 MDH_cytoplasmic_cytoso  96.0  0.0061 1.6E-07   36.3   3.1   71    1-74      3-88  (325)
376 PRK08293 3-hydroxybutyryl-CoA   96.0   0.019 4.9E-07   33.5   5.6   36    2-37      5-40  (288)
377 PRK07660 consensus              96.0   0.019 4.9E-07   33.4   5.6   36    2-37      5-40  (283)
378 PRK07574 formate dehydrogenase  96.0   0.031 7.8E-07   32.3   6.6   20  207-226   280-299 (385)
379 PRK09422 alcohol dehydrogenase  95.9   0.095 2.4E-06   29.5   8.9   47    2-48    165-212 (338)
380 KOG2733 consensus               95.9   0.016   4E-07   34.0   4.8   83    3-85      8-105 (423)
381 TIGR03366 HpnZ_proposed putati  95.9   0.067 1.7E-06   30.3   8.0   19  207-226   191-209 (280)
382 PRK04965 nitric oxide reductas  95.8   0.017 4.3E-07   33.8   4.8   31    2-32      4-36  (378)
383 COG1052 LdhA Lactate dehydroge  95.8   0.042 1.1E-06   31.5   6.8   21  207-227   232-252 (324)
384 PRK12815 carB carbamoyl phosph  95.8   0.018 4.5E-07   33.7   4.8  152    2-161     9-176 (1068)
385 PRK12809 putative oxidoreducta  95.8   0.094 2.4E-06   29.5   8.5   73    2-74    312-405 (639)
386 COG0604 Qor NADPH:quinone redu  95.8    0.08   2E-06   29.9   8.1   72    2-73    145-220 (326)
387 KOG1198 consensus               95.8   0.047 1.2E-06   31.3   6.9   75    1-75    159-236 (347)
388 PRK06928 pyrroline-5-carboxyla  95.8   0.077   2E-06   30.0   8.0   68    1-75      2-74  (275)
389 PRK01747 mnmC 5-methylaminomet  95.8   0.016 4.2E-07   33.8   4.6   32    2-33    258-289 (660)
390 PRK07045 putative monooxygenas  95.8   0.016 4.2E-07   33.8   4.5   33    1-33      6-38  (388)
391 PRK07819 3-hydroxybutyryl-CoA   95.8   0.031   8E-07   32.2   6.0   36    2-37      4-39  (284)
392 cd01065 NAD_bind_Shikimate_DH   95.8   0.044 1.1E-06   31.4   6.7   71    2-75     21-92  (155)
393 TIGR03219 salicylate_mono sali  95.7   0.018 4.6E-07   33.6   4.6   33    1-33      1-34  (414)
394 PRK09117 consensus              95.7   0.027 6.8E-07   32.7   5.5   36    2-37      4-39  (282)
395 PRK00257 erythronate-4-phospha  95.7   0.073 1.9E-06   30.1   7.7   92    2-106   118-210 (379)
396 TIGR01850 argC N-acetyl-gamma-  95.7   0.029 7.4E-07   32.4   5.6   96    1-106     1-108 (361)
397 PRK12814 putative NADPH-depend  95.7    0.12 2.9E-06   29.0   8.7   74    2-75    195-289 (652)
398 PRK13512 coenzyme A disulfide   95.7    0.02 5.2E-07   33.3   4.8   31    2-32      3-35  (438)
399 PRK11259 solA N-methyltryptoph  95.7    0.02 5.2E-07   33.3   4.8   32    1-32      2-35  (377)
400 TIGR02356 adenyl_thiF thiazole  95.7   0.055 1.4E-06   30.8   7.0   31    2-32     23-54  (210)
401 KOG0172 consensus               95.7   0.029 7.4E-07   32.4   5.5   73    2-74      4-78  (445)
402 TIGR01505 tartro_sem_red 2-hyd  95.7   0.031 7.9E-07   32.3   5.6   96    2-106     1-96  (291)
403 PRK06035 3-hydroxyacyl-CoA deh  95.7   0.029 7.3E-07   32.5   5.4   35    2-36      5-39  (291)
404 pfam01118 Semialdhyde_dh Semia  95.6   0.027 6.9E-07   32.6   5.2   71    2-74      1-76  (121)
405 PRK13301 putative L-aspartate   95.6   0.048 1.2E-06   31.2   6.5   68    1-75      3-73  (267)
406 PRK09424 pntA NAD(P) transhydr  95.6    0.13 3.2E-06   28.8   8.6   74    2-75    167-259 (510)
407 TIGR03385 CoA_CoA_reduc CoA-di  95.6   0.025 6.3E-07   32.8   5.0   47    2-48    139-198 (427)
408 TIGR02352 thiamin_ThiO glycine  95.6   0.016   4E-07   34.0   3.9   31    3-33      1-31  (357)
409 TIGR00507 aroE shikimate 5-deh  95.6   0.027 6.9E-07   32.6   5.2   76    2-77    123-203 (286)
410 PRK12771 putative glutamate sy  95.6    0.13 3.4E-06   28.7   8.7   73    2-74    139-232 (560)
411 cd05291 HicDH_like L-2-hydroxy  95.6    0.03 7.7E-07   32.3   5.3   72    2-75      2-79  (306)
412 PRK06130 3-hydroxybutyryl-CoA   95.6   0.036 9.3E-07   31.9   5.7   36    2-37      7-42  (310)
413 PRK12480 D-lactate dehydrogena  95.5   0.047 1.2E-06   31.3   6.1   21  207-227   230-250 (330)
414 PRK08664 aspartate-semialdehyd  95.5   0.038 9.7E-07   31.8   5.7   30    1-30      4-35  (350)
415 PRK12769 putative oxidoreducta  95.5    0.15 3.9E-06   28.3   8.7   73    2-74    329-422 (654)
416 PRK08644 thiamine biosynthesis  95.5   0.083 2.1E-06   29.8   7.3   27    2-28     29-55  (209)
417 PRK05868 hypothetical protein;  95.5   0.027 6.9E-07   32.6   4.7   33    2-34      3-35  (372)
418 TIGR01318 gltD_gamma_fam gluta  95.4    0.06 1.5E-06   30.6   6.4   33    2-34    145-177 (480)
419 pfam01408 GFO_IDH_MocA Oxidore  95.4   0.067 1.7E-06   30.4   6.7   69    1-75      1-73  (120)
420 PRK06487 glycerate dehydrogena  95.4   0.064 1.6E-06   30.5   6.4   21  207-227   229-249 (317)
421 PRK07634 pyrroline-5-carboxyla  95.3    0.12   3E-06   28.9   7.7   67    1-75      5-77  (245)
422 PRK07208 hypothetical protein;  95.3   0.032 8.1E-07   32.2   4.7   32    2-33      5-36  (474)
423 pfam01113 DapB_N Dihydrodipico  95.3    0.06 1.5E-06   30.6   6.0   31    1-31      1-33  (122)
424 PTZ00142 6-phosphogluconate de  95.2    0.06 1.5E-06   30.6   5.7   74    2-75      7-81  (474)
425 PRK10537 voltage-gated potassi  95.2   0.065 1.7E-06   30.4   5.9   10  100-110   142-151 (356)
426 PRK01710 murD UDP-N-acetylmura  95.1    0.15 3.9E-06   28.3   7.7   64    2-71     16-84  (458)
427 PRK12767 carbamoyl phosphate s  95.1   0.089 2.3E-06   29.7   6.4   68    1-71      2-76  (325)
428 PRK12549 shikimate 5-dehydroge  95.1   0.053 1.4E-06   30.9   5.2   17  268-285   264-280 (284)
429 smart00859 Semialdhyde_dh Semi  95.1   0.047 1.2E-06   31.2   4.9   28    2-29      1-30  (122)
430 cd01487 E1_ThiF_like E1_ThiF_l  95.1    0.16 4.2E-06   28.1   7.7   28    2-29      1-28  (174)
431 PRK05442 malate dehydrogenase;  95.0   0.029 7.4E-07   32.4   3.8   72    1-74      5-90  (325)
432 pfam01266 DAO FAD dependent ox  95.0   0.041 1.1E-06   31.6   4.5   31    2-32      1-31  (309)
433 PRK06847 hypothetical protein;  95.0   0.045 1.1E-06   31.4   4.6   34    1-34      4-38  (375)
434 PRK08268 3-hydroxybutyryl-CoA   94.9   0.074 1.9E-06   30.1   5.6   36    2-37      5-40  (503)
435 PRK00421 murC UDP-N-acetylmura  94.9    0.15 3.9E-06   28.3   7.1   64    2-72     10-75  (459)
436 PRK12475 thiamine/molybdopteri  94.8    0.21 5.2E-06   27.6   7.7   31    2-32     26-57  (337)
437 KOG1207 consensus               94.8   0.096 2.4E-06   29.5   5.9   70    2-72      9-85  (245)
438 PRK00066 ldh L-lactate dehydro  94.8   0.088 2.3E-06   29.7   5.7   71    2-75      8-84  (315)
439 KOG1014 consensus               94.8    0.06 1.5E-06   30.7   4.8   71    3-73     52-135 (312)
440 PRK13581 D-3-phosphoglycerate   94.7    0.23   6E-06   27.3   7.8   65    2-76    140-204 (524)
441 COG0026 PurK Phosphoribosylami  94.7    0.14 3.5E-06   28.6   6.6   66    1-69      2-67  (375)
442 PRK02006 murD UDP-N-acetylmura  94.7    0.22 5.5E-06   27.5   7.5   45    2-46      9-55  (501)
443 PRK07688 thiamine/molybdopteri  94.7    0.22 5.5E-06   27.5   7.4   32    1-32     25-57  (339)
444 COG0654 UbiH 2-polyprenyl-6-me  94.7   0.068 1.7E-06   30.3   4.8   32    1-32      3-34  (387)
445 COG1063 Tdh Threonine dehydrog  94.6    0.31 7.9E-06   26.6   8.1   11  274-284   328-338 (350)
446 PRK07236 hypothetical protein;  94.6   0.054 1.4E-06   30.9   4.2   33    2-34      8-40  (386)
447 PRK12810 gltD glutamate syntha  94.5    0.34 8.6E-06   26.4   9.0   73    2-74    145-238 (472)
448 PRK09564 coenzyme A disulfide   94.5   0.076 1.9E-06   30.0   4.9   32    1-32      1-34  (443)
449 TIGR02415 23BDH acetoin reduct  94.5    0.22 5.7E-06   27.4   7.1  182    4-203     4-240 (258)
450 COG0169 AroE Shikimate 5-dehyd  94.5    0.15 3.9E-06   28.3   6.3   18  268-285   263-280 (283)
451 PRK06598 aspartate-semialdehyd  94.4    0.18 4.5E-06   28.0   6.6   29    1-29      3-35  (348)
452 PRK00141 murD UDP-N-acetylmura  94.4    0.26 6.5E-06   27.0   7.4   64    2-71     19-83  (476)
453 PRK11749 putative oxidoreducta  94.4    0.36 9.2E-06   26.2   8.4   32    2-33    142-173 (460)
454 PRK01390 murD UDP-N-acetylmura  94.4    0.14 3.6E-06   28.5   6.0   44    2-45     11-54  (457)
455 PRK02318 mannitol-1-phosphate   94.4    0.32 8.2E-06   26.5   7.8   43    1-43      1-44  (381)
456 PRK02472 murD UDP-N-acetylmura  94.4     0.2 5.2E-06   27.6   6.8   48    2-49     11-62  (450)
457 cd05290 LDH_3 A subgroup of L-  94.4    0.15 3.7E-06   28.4   6.0   71    2-74      1-78  (307)
458 PRK06932 glycerate dehydrogena  94.3    0.17 4.3E-06   28.1   6.2   21  207-227   229-249 (314)
459 TIGR03364 HpnW_proposed FAD de  94.3   0.074 1.9E-06   30.1   4.4   31    3-33      3-33  (365)
460 pfam00899 ThiF ThiF family. Th  94.3    0.38 9.8E-06   26.0   8.1   29    2-30      3-32  (134)
461 PRK07608 hypothetical protein;  94.2   0.084 2.1E-06   29.8   4.5   32    1-32      4-37  (389)
462 PRK06617 2-octaprenyl-6-methox  94.2   0.092 2.3E-06   29.6   4.7   32    1-32      1-33  (374)
463 COG3349 Uncharacterized conser  94.2   0.088 2.3E-06   29.7   4.6   32    1-32      1-32  (485)
464 PRK08163 salicylate hydroxylas  94.2   0.088 2.2E-06   29.7   4.5   33    2-34      6-38  (396)
465 PRK05714 2-octaprenyl-3-methyl  94.2   0.071 1.8E-06   30.2   4.1   33    1-33      1-35  (405)
466 cd00300 LDH_like L-lactate deh  94.1    0.11 2.8E-06   29.2   5.0   71    3-75      1-77  (300)
467 COG0665 DadA Glycine/D-amino a  94.1    0.12   3E-06   29.0   5.1   33    1-33      5-37  (387)
468 PRK07233 hypothetical protein;  94.1    0.08   2E-06   29.9   4.2   31    2-32      1-31  (430)
469 KOG1611 consensus               94.1    0.43 1.1E-05   25.8   9.0  131    2-141     5-184 (249)
470 PRK05562 precorrin-2 dehydroge  94.0    0.44 1.1E-05   25.7   8.3   65    1-70     25-90  (222)
471 COG0289 DapB Dihydrodipicolina  94.0    0.44 1.1E-05   25.7   8.5   34    1-34      3-39  (266)
472 COG2130 Putative NADP-dependen  94.0    0.31 7.9E-06   26.6   7.0   39    3-41    154-193 (340)
473 KOG0069 consensus               94.0    0.19 4.8E-06   27.8   5.9   19  207-225   249-267 (336)
474 PRK06728 aspartate-semialdehyd  93.9    0.22 5.7E-06   27.4   6.1   65    1-73      6-77  (347)
475 TIGR03376 glycerol3P_DH glycer  93.9    0.39 9.9E-06   26.0   7.3   74    2-75      1-93  (342)
476 PRK06475 salicylate hydroxylas  93.8    0.11 2.7E-06   29.2   4.4   32    2-33      4-35  (400)
477 TIGR01763 MalateDH_bact malate  93.7   0.045 1.2E-06   31.3   2.4   87    1-89      2-101 (308)
478 PTZ00117 malate dehydrogenase;  93.7    0.12 3.1E-06   28.9   4.5   72    2-75      3-80  (313)
479 PRK03815 murD UDP-N-acetylmura  93.6    0.12   3E-06   29.0   4.3   31    1-31      1-31  (401)
480 PRK05690 molybdopterin biosynt  93.6    0.44 1.1E-05   25.7   7.3   28    2-29     34-61  (245)
481 TIGR03452 mycothione_red mycot  93.6    0.13 3.2E-06   28.8   4.4   33    2-34    171-203 (452)
482 PRK00683 murD UDP-N-acetylmura  93.5    0.15 3.9E-06   28.3   4.8   35    2-36      5-39  (418)
483 PRK08243 4-hydroxybenzoate 3-m  93.5    0.15 3.9E-06   28.3   4.7   33    1-33      1-35  (392)
484 PRK08849 2-octaprenyl-3-methyl  93.5    0.14 3.7E-06   28.5   4.6   29    3-31      6-34  (384)
485 PRK07846 mycothione/glutathion  93.4    0.13 3.3E-06   28.7   4.2   33    2-34    170-202 (453)
486 PTZ00318 NADH dehydrogenase; P  93.3     0.1 2.6E-06   29.3   3.7   33    2-34     12-44  (514)
487 TIGR02815 agaS_fam putative su  93.3    0.15 3.8E-06   28.4   4.5   31    1-31     45-79  (374)
488 PRK06912 acoL dihydrolipoamide  93.3    0.17 4.4E-06   28.0   4.8   30    2-31      2-31  (458)
489 COG0562 Glf UDP-galactopyranos  93.3    0.16 4.2E-06   28.1   4.6   32    2-33      3-34  (374)
490 PRK12831 putative oxidoreducta  93.2    0.61 1.5E-05   24.9   9.0   31    2-32    142-172 (464)
491 TIGR01316 gltA glutamate synth  93.2    0.58 1.5E-05   25.0   7.3   74    1-74    143-239 (462)
492 PRK13748 putative mercuric red  93.2    0.21 5.3E-06   27.6   5.0   31    2-32    272-302 (561)
493 PRK09126 hypothetical protein;  93.1    0.16   4E-06   28.2   4.4   31    3-33      6-36  (392)
494 cd00650 LDH_MDH_like NAD-depen  93.1    0.33 8.3E-06   26.4   5.9   71    3-75      1-81  (263)
495 pfam01494 FAD_binding_3 FAD bi  93.0    0.17 4.4E-06   28.0   4.4   34    1-34      2-35  (349)
496 COG0686 Ald Alanine dehydrogen  93.0    0.38 9.6E-06   26.1   6.2   80    2-82    170-249 (371)
497 COG0002 ArgC Acetylglutamate s  93.0    0.34 8.8E-06   26.3   5.9   74    1-75      3-81  (349)
498 cd01485 E1-1_like Ubiquitin ac  93.0    0.51 1.3E-05   25.4   6.8  102    2-110    21-152 (198)
499 COG0771 MurD UDP-N-acetylmuram  93.0    0.37 9.4E-06   26.1   6.0   65    1-71      8-76  (448)
500 cd01076 NAD_bind_1_Glu_DH NAD(  92.9    0.67 1.7E-05   24.6   7.6   72    1-72     32-114 (227)

No 1  
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888    The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group. The 4,6-dehydratase makes use of tightly bound NAD^+ as the coenzyme for transiently oxidizing the substrate, activating it for the dehydration step . This and other 4,6-dehydratases catalyze the first committed step in all 6-deoxysugar biosynthetic pathways described to date. Numerous 6-deoxysugars are used in bacterial lipopolysaccharide production as well as in the biosynthesis of a diverse array of secondary metabolites.; GO: 0008460 dTDP-glucose 46-dehydratase activity, 0009225 nucleotide-sugar metabolic process.
Probab=100.00  E-value=0  Score=315.58  Aligned_cols=284  Identities=18%  Similarity=0.233  Sum_probs=210.5

Q ss_pred             EEEEEC-CCHHHHHHHHHHHH-C-CCEEEEEE-----CCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEEE
Q ss_conf             399988-88889999999998-8-98899996-----794463455644982898067864023465411--56327876
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALK-V-GVYTCGTT-----RSVSNLLTLKHKGISPFLFADQKINNLLREKLY--FTTHIVQC   71 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~-~-g~~V~~~~-----r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~~   71 (289)
                      +||||| |||||+.++++.++ . .++|+.+.     -+++++..+.+..-..|+..|..+.+.+...+.  .+|.|+|.
T Consensus         1 ~~LVTGGaGFIGsnFvry~~~~~~D~~v~vlDkLTYAgn~e~L~~l~~~pr~~Fv~GDI~D~~lv~~~~~e~~~D~VvhF   80 (340)
T TIGR01181         1 RILVTGGAGFIGSNFVRYILNEHPDAEVIVLDKLTYAGNLENLADLEDNPRYRFVKGDIGDRELVDRLLKEHDPDAVVHF   80 (340)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             92363278525689999999747995799863544557865552332396615674230228899888400176778862


Q ss_pred             ECCC----------CCCCEEECCCCCHHHHHH-----------HCCCCCCCCCCEEECCCCC-C-CC-CCCCCCCCCCCH
Q ss_conf             1244----------433100012210134432-----------0123343333201025762-1-23-453211234311
Q gi|254780595|r   72 IKPS----------SEGDPCIISMSKDFYKFM-----------PHVKWIGYLSSTSIYGNRE-G-QW-VDEHSFVHPISC  127 (289)
Q Consensus        72 ~~~~----------~~~~~~~~~~~~~~~~~~-----------~~~~~~i~~SS~~VYg~~~-g-~~-i~E~~~~~P~~~  127 (289)
                      ||-+          ..-...+..+...+-+.+           ..++||+|+||..|||+=. + .. ++|++|++|.||
T Consensus        81 AAESHVDRSI~~P~~F~~TNv~GT~tLLEA~R~~w~aL~e~~~a~~r~l~HiSTDEVYGdl~~~~~~~ftE~tpl~PsSP  160 (340)
T TIGR01181        81 AAESHVDRSISGPEAFIETNVVGTYTLLEAVRKYWHALREAKKAGVRKLHHISTDEVYGDLEKGDPASFTETTPLAPSSP  160 (340)
T ss_pred             CCCCHHHHCCCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCEEECCCCCCCCEEEEECCCCCCCCC
T ss_conf             22052333014541144403378899999997404456644513102635760301440467896734423278877872


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCH-------HHHHHCCCCCC-CCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             34554455554320012345676420347777898503-------44431134543-22211000102477779999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP-------FIKIRQKNSLR-LVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~-------~~~~~~g~~~~-~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      |+.||+++..++++|.+.||||+.|-|.++=|||=.++       ..+...|+++. .++|.|++.|+||+|-++|+..+
T Consensus       161 YSASKAasD~LVrAy~rTYGLp~~ITrCsNNYGPYQfpEKLIPl~I~nal~G~plPvYGdG~~vRDWlyV~DHcrA~~~V  240 (340)
T TIGR01181       161 YSASKAASDLLVRAYHRTYGLPVLITRCSNNYGPYQFPEKLIPLMITNALAGKPLPVYGDGQQVRDWLYVEDHCRAIELV  240 (340)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEHHHHHHHHHHH
T ss_conf             45889888789888887548860576885577875674201368999987389983301788320324523478999999


Q ss_pred             HCCC-CCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCE--ECHHHHH-HCCCCCCCCCH
Q ss_conf             5135-578616268433338999999999955799863431012568244655306945--1689999-73984489999
Q gi|254780595|r  200 MTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKR--ISNAKIK-SLGFQLLYPNY  275 (289)
Q Consensus       200 ~~~~-~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~--is~~kl~-~lG~~p~~p~~  275 (289)
                      +++. .|++||||++.+.+..|+++.||+.||.-.|.........+-.....+....+|  |+.+||+ ||||+|+| ||
T Consensus       241 L~~G~~GE~YNIgg~~Er~NlE~V~~Il~~lgklaP~~p~~~~~~li~~V~DRPGHDrRYAiD~sKi~~ELGW~P~~-tf  319 (340)
T TIGR01181       241 LEKGRVGEVYNIGGGNERTNLEVVEIILELLGKLAPDKPVKSDEDLIEHVEDRPGHDRRYAIDASKIRRELGWAPKY-TF  319 (340)
T ss_pred             HHCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEECCCCCCCCCCCCCCHHHHHHHCCCCCCC-CH
T ss_conf             82695212564378762212889999998743207677678884350036769886411044736767616898742-38


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999975
Q gi|254780595|r  276 RISLKQLWKEI  286 (289)
Q Consensus       276 ~~gl~~~~~~~  286 (289)
                      ||||+.++++.
T Consensus       320 EeGlr~Tv~WY  330 (340)
T TIGR01181       320 EEGLRETVQWY  330 (340)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999987


No 2  
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=100.00  E-value=0  Score=306.94  Aligned_cols=287  Identities=13%  Similarity=0.174  Sum_probs=201.1

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHH-CCCEEEEEECCHHHHHHH-HHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             93-999888-8889999999998-898899996794463455-6449828980678640234654115632787612444
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALK-VGVYTCGTTRSVSNLLTL-KHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~-~g~~V~~~~r~~~~~~~l-~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
                      || |||||+ ||||++|+++|++ .+|+|+++.+...+...+ ....+..+..|.......+......+|.|+|+|+-..
T Consensus         1 MKkILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~gDi~~~~~~~~~~~~~~D~V~HlAa~~~   80 (347)
T PRK11908          1 MKKVLILGVNGFIGHHLTKRILETTDWEVYGMDMQTDRLGDLVNHPRMHFFEGDITINKEWIEYHVKKCDVVLPLVAIAT   80 (347)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEECCCCCCHHHHHHHHCCCCEEEEEHHCCC
T ss_conf             98899975743899999999998289789999799763677557998599977544699999976605988975200036


Q ss_pred             C----CCEE------ECCCCCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCC-------CCCCHHHHHHHHHHHHH
Q ss_conf             3----3100------01221013443201233433332010257621234532112-------34311345544555543
Q gi|254780595|r   77 E----GDPC------IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV-------HPISCVATQRFNAEKEW  139 (289)
Q Consensus        77 ~----~~~~------~~~~~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~-------~P~~~y~~~k~~~E~~~  139 (289)
                      .    .++.      +....+.+.++....+||||+||.+|||.......+|+.++       .|.+.|+.+|.++|..+
T Consensus        81 ~~~~~~~p~~~~~~nv~~t~~ll~~~~~~~~r~if~SS~~VYG~~~~~~~~~~~~~~~~~p~~~p~~~Y~~sK~~~E~l~  160 (347)
T PRK11908         81 PATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCSDEEFDPEASALTYGPINKPRWIYACSKQLMDRVI  160 (347)
T ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             48888688999999999999999999973983896266126547899998977787657887786547789999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCC---------------HHHHHHCCCCCCC-CCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             2001234567642034777789850---------------3444311345432-22110001024777799999995135
Q gi|254780595|r  140 LAITKKLNIKLAVLRLSGIYGPKRN---------------PFIKIRQKNSLRL-VKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       140 ~~~~~~~~~~~~ilR~~~iyGp~r~---------------~~~~~~~g~~~~~-~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      ..|+++++++++++||+++|||+..               .+.++.+|++..+ ++|.|.++|+||+|+++++++++++.
T Consensus       161 ~~y~~~~~l~~~ilR~~nvyGP~~~~~~~~~~~~~~vi~~~i~~~~~g~~i~i~g~G~~~Rdf~yV~D~v~a~~~~l~~~  240 (347)
T PRK11908        161 WAYGMEEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPISLVDGGSQKRAFTDIDDGISALMKIIENK  240 (347)
T ss_pred             HHHHHHHCCCEEEEEECCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCEEHHHHHHHHHHHHHCC
T ss_conf             99999858987999766676699665568544632027999999983898403599971036786679999999999677


Q ss_pred             ----CCCCEECCC-CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH-HH----H--CCCCEECHHHHH-HCCCCC
Q ss_conf             ----578616268-4333389999999999557998634310125682446-55----3--069451689999-739844
Q gi|254780595|r  204 ----LGGIFNLSD-DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTR-FF----Y--ADNKRISNAKIK-SLGFQL  270 (289)
Q Consensus       204 ----~~~iyni~~-~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~-~~----~--~~~~~is~~kl~-~lG~~p  270 (289)
                          .+++||+++ ++.+|.+|+++.+.+..+..+............+... .+    +  ..++..+.+|++ +|||+|
T Consensus       241 ~~~~~~~i~NIGs~~~~~si~el~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~di~ka~~~LGw~P  320 (347)
T PRK11908        241 DGVASGKIYNIGNPKNNFSVRELAEKMLELAAEYPEYADSAKKVKLVETTSGAYYGKGYQDVQNRVPKIDNTMQELGWAP  320 (347)
T ss_pred             CCCCCCCEEEECCCCCCEEHHHHHHHHHHHHCCCCCCCCCHHCCEEEECCCCCCCCCCCCCHHHCCCCHHHHHHHHCCCC
T ss_conf             88888997995889986369999999999860252003521015034248864456554435442027699999849965


Q ss_pred             CCCCHHHHHHHHHHHHHC
Q ss_conf             899999999999997513
Q gi|254780595|r  271 LYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       271 ~~p~~~~gl~~~~~~~~~  288 (289)
                      ++ ++++||++++++..+
T Consensus       321 ~~-sleeGl~~ti~wyk~  337 (347)
T PRK11908        321 QT-TFDDALRRIFEAYRG  337 (347)
T ss_pred             CC-CHHHHHHHHHHHHHH
T ss_conf             89-699999999999987


No 3  
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=100.00  E-value=0  Score=298.70  Aligned_cols=282  Identities=17%  Similarity=0.166  Sum_probs=207.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC--
Q ss_conf             93999888-888999999999889889999679446345564498289806786402346541156327876124443--
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE--   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~--   77 (289)
                      |||||||+ ||||++|+++|+++||+|++++|+......+...+++.+..|.. +...+...+.++|.|+|+++....  
T Consensus         1 MriLVTGgtGfiG~~l~~~L~~~G~~V~~l~r~~~~~~~~~~~~~~~~~gDl~-d~~~~~~~~~~~d~ViH~Aa~~~~~~   79 (328)
T TIGR03466         1 MKVLVTGATGFVGSAVVRLLLERGEEVRVLVRPTSDRRNLEGLDVEIVEGDLR-DPASLRKALAGCRALFHVAADYRLWA   79 (328)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEEECC-CHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             94999867779999999999978498999989998655652179779982079-99999999717858976134234467


Q ss_pred             CCE-----EECCCCCHHH--HHHHCCCCCCCCCCEEECCCCC-CCCCCCCCCCCCC---CHHHHHHHHHHHHHHHCCCCC
Q ss_conf             310-----0012210134--4320123343333201025762-1234532112343---113455445555432001234
Q gi|254780595|r   78 GDP-----CIISMSKDFY--KFMPHVKWIGYLSSTSIYGNRE-GQWVDEHSFVHPI---SCVATQRFNAEKEWLAITKKL  146 (289)
Q Consensus        78 ~~~-----~~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~-g~~i~E~~~~~P~---~~y~~~k~~~E~~~~~~~~~~  146 (289)
                      .++     .....+.+++  +...+++|+||+||.+|||... +.+.+|++|..|.   ++|+.+|+++|+.++++.+++
T Consensus        80 ~~~~~~~~~Nv~gt~nll~aa~~~~v~r~V~~SS~~v~g~~~~~~~~~E~~p~~~~~~~~~Y~~sK~~aE~~~~~~~~~~  159 (328)
T TIGR03466        80 PDPEEMYRANVEGTRNLLRAALEAGVERVVYTSSVATLGVPGDGTPADETTPSSLEKMIGHYKRSKFLAEEAALRMIAEK  159 (328)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             99899999999999999999997298743156335785578888740256765456665778899999999999999972


Q ss_pred             CCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEECCCCCHHHH
Q ss_conf             567642034777789850-------344431134543222110001024777799999995135-578616268433338
Q gi|254780595|r  147 NIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPP  218 (289)
Q Consensus       147 ~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni~~~~~~s~  218 (289)
                      +++++|+||+++|||+..       .+.++.++..+...+  .-.+++|++|+|++++.++++. .++.||++ ++++|+
T Consensus       160 gl~~~ilRp~~v~Gp~d~~~~~~~~~i~~~~~~~~p~~~~--~g~~~v~V~Dva~a~~~a~~~~~~g~~y~~~-~~~~t~  236 (328)
T TIGR03466       160 GLPVVIVNPSTPIGPRDIKPTPTGRIIVDFLRGKMPAYVD--TGLNLVHVDDVAEGHLLALERGRIGERYILG-GENLTL  236 (328)
T ss_pred             CCCEEEECCCCEECCCCCCCCCHHHHHHHHHCCCCCEEEC--CCCEEEEEHHHHHHHHHHHHCCCCCCEEEEC-CCCCCH
T ss_conf             9975997778568899888876699999997599976755--8718998389999999997579989879979-997109


Q ss_pred             HHHHHHHHHHHCCCCCCC-CCCCC--------------CCCCHHH----HHHHCCCCEECHHHHH-HCCCCCCCCCHHHH
Q ss_conf             999999999955799863-43101--------------2568244----6553069451689999-73984489999999
Q gi|254780595|r  219 QNVIMEAASLMKITPPLE-QCFDT--------------ANISPFT----RFFYADNKRISNAKIK-SLGFQLLYPNYRIS  278 (289)
Q Consensus       219 ~e~~~~i~~~~g~~~~~~-~~~~~--------------~~~~~~~----~~~~~~~~~is~~kl~-~lG~~p~~p~~~~g  278 (289)
                      +|+++.+++.+|.+.|.. ++...              ....|..    .........+|++|++ +|||+|+  +++||
T Consensus       237 ~e~~~~i~~~~g~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~p~~~~~~~~~~~~~~~~d~~kA~~~LG~~p~--~~eeg  314 (328)
T TIGR03466       237 AQILAKLAEITGRKAPRVKLPRWLLLPVAWGAEALARLTGKEPRVTLDGVRMAKKKMYFSSDKAVRELGYRQR--PAREA  314 (328)
T ss_pred             HHHHHHHHHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCHHHHHHHHCCCCC--CHHHH
T ss_conf             9999999998589987110573788888999999887419998764677764156631177999998299978--89999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999997513
Q gi|254780595|r  279 LKQLWKEIEN  288 (289)
Q Consensus       279 l~~~~~~~~~  288 (289)
                      |+++++++..
T Consensus       315 l~~tv~W~~~  324 (328)
T TIGR03466       315 LRDAVEWFRA  324 (328)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999998


No 4  
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=100.00  E-value=0  Score=299.35  Aligned_cols=278  Identities=19%  Similarity=0.209  Sum_probs=203.8

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCEEEEEE---C-CHHHHHHHH---HCCCEEEECCCCCCCHHHHH--H----HCCCCE
Q ss_conf             399988-88889999999998898899996---7-944634556---44982898067864023465--4----115632
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALKVGVYTCGTT---R-SVSNLLTLK---HKGISPFLFADQKINNLLRE--K----LYFTTH   67 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~~g~~V~~~~---r-~~~~~~~l~---~~~~~~~~~~~~~~~~~~~~--~----~~~~~~   67 (289)
                      |||||| |||||||++++|+++||+|+.+.   + +++-+..++   ...+.++.+|..+. ..+..  .    ...+|.
T Consensus         1 ~iLVTGGAGYIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~-~~l~~~f~kqql~~~idA   79 (341)
T TIGR01179         1 KILVTGGAGYIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDR-ELLRRVFEKQQLEHKIDA   79 (341)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHH-HHHHHHHHHHHHCCCCCE
T ss_conf             9268614664435887887635972899815788848875002341485320587175157-999999877431167546


Q ss_pred             EEEEECC----------CCCCCEEECCCCCHHHHHH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCC-CCCHHHHHHHHH
Q ss_conf             7876124----------4433100012210134432-012334333320102576212345321123-431134554455
Q gi|254780595|r   68 IVQCIKP----------SSEGDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVH-PISCVATQRFNA  135 (289)
Q Consensus        68 v~~~~~~----------~~~~~~~~~~~~~~~~~~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~-P~~~y~~~k~~~  135 (289)
                      |+|.|+.          ...+++.+.++...+..+. .++++|||-||+.|||+...-|++|+.|++ |.||||+||++.
T Consensus        80 ViHFAg~~~VgESv~~Pl~YY~NNv~nTl~L~~~m~~~GV~~~iFSSsAaVYG~p~~~Pi~E~~pl~~PinPYG~sKlM~  159 (341)
T TIGR01179        80 VIHFAGLIAVGESVQKPLKYYRNNVVNTLNLLEAMQETGVKKFIFSSSAAVYGEPESIPISEDSPLGDPINPYGRSKLMV  159 (341)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             75201121252557524544000468999999999981897415304214507788555022256778748665566889


Q ss_pred             HHHHHHCCCC-CCCCCCCCCCCCCCC--C-C-C----------CHHHHH---H--CCCCCCCCCC-------CCEECCHH
Q ss_conf             5543200123-456764203477778--9-8-5----------034443---1--1345432221-------10001024
Q gi|254780595|r  136 EKEWLAITKK-LNIKLAVLRLSGIYG--P-K-R----------NPFIKI---R--QKNSLRLVKK-------NQVFNRIR  188 (289)
Q Consensus       136 E~~~~~~~~~-~~~~~~ilR~~~iyG--p-~-r----------~~~~~~---~--~g~~~~~~~~-------~~~~~~ih  188 (289)
                      |+.+.++.+. .++++++||++++.|  | | +          |.+..+   +  +.....++++       .-++.+||
T Consensus       160 E~iL~D~~~a~~~~~~v~LRYFNv~GA~p~GY~iGe~~~~~tNhLip~~~~~A~G~~~~l~IFGtDYPT~DGTcvRDYIH  239 (341)
T TIGR01179       160 ERILRDLSKADPDLSYVILRYFNVAGADPEGYEIGEDPPGITNHLIPYACQVAVGKRDKLTIFGTDYPTPDGTCVRDYIH  239 (341)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCEECCCCCCCCCCCEEEEEEE
T ss_conf             99999998738767799850578514488877236685202941899999984489973136248787679876530020


Q ss_pred             HHHHHHH-HHH---HHCCCCCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHH
Q ss_conf             7777999-999---951355786162684333389999999999557998634310125682446553069451689999
Q gi|254780595|r  189 VEDVARC-VIF---LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK  264 (289)
Q Consensus       189 v~Dva~~-i~~---l~~~~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~  264 (289)
                      |.|+|+| +.+   |.+....++|||+.|+..|.+|+++.+.+..|++.+..   ...+....+..++.     |++|++
T Consensus       240 V~DLA~AH~~Al~~L~~g~~s~~~NlG~G~G~SV~EVi~a~~~vsG~~~~~~---~~~RR~GDpa~l~A-----da~ki~  311 (341)
T TIGR01179       240 VMDLAEAHLAALEYLENGGESHVYNLGYGQGFSVLEVIEAFKKVSGKDIPVE---LAPRRPGDPASLVA-----DASKIR  311 (341)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEE---ECCCCCCCCCEEEC-----CHHHHH
T ss_conf             0207778999999986079636986246754109999999866109813788---76877988454873-----869999


Q ss_pred             -HCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             -739844899999999999997513
Q gi|254780595|r  265 -SLGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       265 -~lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
                       +|||+|+|.+|++=+++-|+|.++
T Consensus       312 ~~LgW~p~y~~Le~i~~~AW~W~~~  336 (341)
T TIGR01179       312 RELGWQPKYDDLEIIIKTAWRWESR  336 (341)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             7538534568889999999999986


No 5  
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional
Probab=100.00  E-value=0  Score=294.46  Aligned_cols=280  Identities=15%  Similarity=0.166  Sum_probs=191.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCE-EEEEEC-----CHHHHHHHHH-CCCEEEECCCCCCCHHHHHH--HCCCCEEEE
Q ss_conf             93999888-88899999999988988-999967-----9446345564-49828980678640234654--115632787
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVY-TCGTTR-----SVSNLLTLKH-KGISPFLFADQKINNLLREK--LYFTTHIVQ   70 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~-V~~~~r-----~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~--~~~~~~v~~   70 (289)
                      |||||||+ ||||++|+++|+++|++ |+++.+     +.+....+.. ..+.....|.. +...+...  ....|.|+|
T Consensus         1 MkILVTGg~GFIGs~l~~~Ll~~~~~~v~~vd~~~~~~~~~~~~~~~~~~~~~~~~~Di~-d~~~l~~~~~~~~~D~ViH   79 (352)
T PRK10084          1 MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC-DRAELDRIFAQHQPDAVMH   79 (352)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCC-CHHHHHHHHHHHCCCEEEE
T ss_conf             979997510089999999999779988999847987677888887630897179985678-9999999999739999999


Q ss_pred             EECCCCCC----CE-----EECCCCCHHHHHH-----------HCCCCCCCCCCEEECCCCC---------CCC-CCCCC
Q ss_conf             61244433----10-----0012210134432-----------0123343333201025762---------123-45321
Q gi|254780595|r   71 CIKPSSEG----DP-----CIISMSKDFYKFM-----------PHVKWIGYLSSTSIYGNRE---------GQW-VDEHS  120 (289)
Q Consensus        71 ~~~~~~~~----~~-----~~~~~~~~~~~~~-----------~~~~~~i~~SS~~VYg~~~---------g~~-i~E~~  120 (289)
                      +|+.....    ++     .......+++..+           ..+.+|+|+||..|||+..         ..+ .+|++
T Consensus        80 lAA~~~~~~s~~~p~~~~~~Nv~gt~nllea~~~~~~~l~~~~~~~~rfv~~SS~~vYG~~~~p~~~~~~~~~p~~~e~~  159 (352)
T PRK10084         80 LAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDEDKKNAFRFHHISTDEVYGDLPHPDEVENSVELPLFTETT  159 (352)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             77346656133096786522378699999999998643200135405888710140346888863335665577655789


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC---H----HHHHHCCCCCC-CCCCCCEECCHHHHHH
Q ss_conf             12343113455445555432001234567642034777789850---3----44431134543-2221100010247777
Q gi|254780595|r  121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN---P----FIKIRQKNSLR-LVKKNQVFNRIRVEDV  192 (289)
Q Consensus       121 ~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~---~----~~~~~~g~~~~-~~~~~~~~~~ihv~Dv  192 (289)
                      |+.|.++|+.+|+++|.++..+.+++|++++++|++++|||+..   .    +.+..+|++.. +++|+|.++|+|++|+
T Consensus       160 ~~~p~~~Y~~sK~~~E~l~~~~~~~~gl~~~i~R~~nvyGP~~~~~~~i~~~i~~~l~g~~i~i~G~G~~~Rdf~yV~D~  239 (352)
T PRK10084        160 AYAPSSPYSASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDH  239 (352)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCEEEEEEEHHHH
T ss_conf             99999989999999999999877651587699852753086999603699999999809736881799856712975999


Q ss_pred             HHHHHHHHCC-CCCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC----CCCHHHHHHHCCCCEECHHHHH-HC
Q ss_conf             9999999513-5578616268433338999999999955799863431012----5682446553069451689999-73
Q gi|254780595|r  193 ARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIK-SL  266 (289)
Q Consensus       193 a~~i~~l~~~-~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~----~~~~~~~~~~~~~~~is~~kl~-~l  266 (289)
                      |+++..+++. ..+++||++++++.+..|+++.+++.++...|....+...    ...|.    ......+|++|++ +|
T Consensus       240 v~a~~~~~~~~~~g~~yNig~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~i~~~~~rp~----~~~~~~~d~sk~~~~L  315 (352)
T PRK10084        240 ARALYKVVTEGKAGETYNIGGHNEKKNLDVVLTICDLLDEIVPKATSYREQITYVADRPG----HDRRYAIDASKISREL  315 (352)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCC----CCCEEEECHHHHHHHH
T ss_conf             999999986699999599899997638999999999999874121685323224699999----9754313899999984


Q ss_pred             CCCCCCCCHHHHHHHHHHHH
Q ss_conf             98448999999999999975
Q gi|254780595|r  267 GFQLLYPNYRISLKQLWKEI  286 (289)
Q Consensus       267 G~~p~~p~~~~gl~~~~~~~  286 (289)
                      ||+|++ ++++||++++++.
T Consensus       316 Gw~P~~-sl~eGl~~ti~Wy  334 (352)
T PRK10084        316 GWKPQE-TFESGIRKTVEWY  334 (352)
T ss_pred             CCCCCC-CHHHHHHHHHHHH
T ss_conf             998699-9999999999999


No 6  
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=100.00  E-value=0  Score=291.62  Aligned_cols=278  Identities=17%  Similarity=0.140  Sum_probs=194.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC----HHHH---HHHHHCCCEEEECCCCCCCHHHHHHH--CCCCEEEE
Q ss_conf             93999888-888999999999889889999679----4463---45564498289806786402346541--15632787
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRS----VSNL---LTLKHKGISPFLFADQKINNLLREKL--YFTTHIVQ   70 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~----~~~~---~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~v~~   70 (289)
                      |||||||+ ||||++|+++|+++||+|+++.+-    ....   ..+....+..+..|.. +...+...+  .++|.|+|
T Consensus         1 MkvLVTGg~GFIGs~l~~~Ll~~g~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~Di~-d~~~~~~~~~~~~~d~V~H   79 (338)
T PRK10675          1 MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIR-NEALMTEILHDHAIDTVIH   79 (338)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCCCEEEECCCC-CHHHHHHHHHHCCCCEEEE
T ss_conf             919998987679999999999784989999889887376788888614788759983279-9899999998659999998


Q ss_pred             EECCCCC----CCEE-----ECCCCCHHHH--HHHCCCCCCCCCCEEECCCCCCCCCCCCCCC-CCCCHHHHHHHHHHHH
Q ss_conf             6124443----3100-----0122101344--3201233433332010257621234532112-3431134554455554
Q gi|254780595|r   71 CIKPSSE----GDPC-----IISMSKDFYK--FMPHVKWIGYLSSTSIYGNREGQWVDEHSFV-HPISCVATQRFNAEKE  138 (289)
Q Consensus        71 ~~~~~~~----~~~~-----~~~~~~~~~~--~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~-~P~~~y~~~k~~~E~~  138 (289)
                      +|+....    .++.     ....+.+++.  ...++++|||+||..|||+....+.+|+.|. .|.++||.+|+++|+.
T Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nllea~~~~~vkr~v~~SS~~vYG~~~~~p~~E~~~~~~P~s~Yg~sK~~~E~~  159 (338)
T PRK10675         80 FAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQI  159 (338)
T ss_pred             CCCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             98654546211098999886898899999999973988799963720337898898002478999999413557899999


Q ss_pred             HHHCCC-CCCCCCCCCCCCCCCCCC---------CC----H---HHHHHCC--CCCCC-C------CCCCEECCHHHHHH
Q ss_conf             320012-345676420347777898---------50----3---4443113--45432-2------21100010247777
Q gi|254780595|r  139 WLAITK-KLNIKLAVLRLSGIYGPK---------RN----P---FIKIRQK--NSLRL-V------KKNQVFNRIRVEDV  192 (289)
Q Consensus       139 ~~~~~~-~~~~~~~ilR~~~iyGp~---------r~----~---~~~~~~g--~~~~~-~------~~~~~~~~ihv~Dv  192 (289)
                      +..+.. ..+++++++|++++|||.         +.    .   +.+...+  ....+ +      +|.|.++|+|++|+
T Consensus       160 l~~~~~~~~~~~~~i~R~fn~~G~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~l~i~G~~~~~~dG~~~Rdfi~V~D~  239 (338)
T PRK10675        160 LTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDL  239 (338)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCEEHHHH
T ss_conf             99999876898689996635425477776687973216799999999984478707752797546799866563318779


Q ss_pred             HHHHHHHHCC---C-CCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHH-HCC
Q ss_conf             9999999513---5-5786162684333389999999999557998634310125682446553069451689999-739
Q gi|254780595|r  193 ARCVIFLMTH---H-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLG  267 (289)
Q Consensus       193 a~~i~~l~~~---~-~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~lG  267 (289)
                      +++++++++.   . ..++||++++++.++.|+++.+++..|.+.+.  .+.+.......      ...+|++|++ +||
T Consensus       240 ~~a~~~a~~~~~~~~~~~i~Nigsg~~~si~el~~~i~~~~g~~~~~--~~~~~r~~d~~------~~~~d~~ka~~~LG  311 (338)
T PRK10675        240 ADGHVVAMEKLANKPGVHIYNLGAGVGSSVLDVVNAFSKACGKPVNY--HFAPRREGDLP------AYWADASKADRELN  311 (338)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCEEHHHHHHHHHHHHCCCCCE--EECCCCCCCCC------EEEECHHHHHHHHC
T ss_conf             99999999974168984589967997578999999999997899773--66899999878------74387999999829


Q ss_pred             CCCCCCCHHHHHHHHHHHHHC
Q ss_conf             844899999999999997513
Q gi|254780595|r  268 FQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       268 ~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      |+|++ +|+|||++++++.+.
T Consensus       312 w~p~~-sl~egl~~t~~W~~~  331 (338)
T PRK10675        312 WRVTR-TLDEMAQDTWHWQSR  331 (338)
T ss_pred             CCCCC-CHHHHHHHHHHHHHH
T ss_conf             98588-999999999999995


No 7  
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=100.00  E-value=0  Score=288.49  Aligned_cols=279  Identities=15%  Similarity=0.164  Sum_probs=192.4

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCH------HHHHHH-HHCCCEEEECCCCCCCHHHHHHHCC--CCEEE
Q ss_conf             93-999888-8889999999998898899996794------463455-6449828980678640234654115--63278
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSV------SNLLTL-KHKGISPFLFADQKINNLLREKLYF--TTHIV   69 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~------~~~~~l-~~~~~~~~~~~~~~~~~~~~~~~~~--~~~v~   69 (289)
                      || |||||+ ||||++|+++|++++++++...++.      .+...+ ....+..+..|.. +...+...+..  .|.|+
T Consensus         1 MKkILVTGg~GFIGs~Lv~~Ll~~~~~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~Di~-d~~~l~~~~~~~~pD~Vi   79 (355)
T PRK10217          1 MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDIC-DRAELARVFTEYQPDCVM   79 (355)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCC-CHHHHHHHHHHCCCCEEE
T ss_conf             9969993787579999999999769988999828987652544445412787169980058-899999999861998899


Q ss_pred             EEECCCCCC----CE-----EECCCCCHHHHH-----------HHCCCCCCCCCCEEECCCC--CCCCCCCCCCCCCCCH
Q ss_conf             761244433----10-----001221013443-----------2012334333320102576--2123453211234311
Q gi|254780595|r   70 QCIKPSSEG----DP-----CIISMSKDFYKF-----------MPHVKWIGYLSSTSIYGNR--EGQWVDEHSFVHPISC  127 (289)
Q Consensus        70 ~~~~~~~~~----~~-----~~~~~~~~~~~~-----------~~~~~~~i~~SS~~VYg~~--~g~~i~E~~~~~P~~~  127 (289)
                      |+|+.....    ++     .....+.++...           .....+|+|+||..|||+.  ...+++|++|+.|.++
T Consensus        80 HlAa~~~~~~s~~~p~~~~~~N~~gt~~lleaar~~~~~l~~~~~~~~~~~~~SS~~vYG~~~~~~~~~~E~~~~~P~s~  159 (355)
T PRK10217         80 HLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSP  159 (355)
T ss_pred             EECCCCCHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             94242211012119677543030757899999999775443303661488865542003677788887677888899988


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCC-CCCCCEECCHHHHHHHHHHHHH
Q ss_conf             3455445555432001234567642034777789850-------3444311345432-2211000102477779999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRL-VKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~-~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      ||.+|.++|.++..+.++++++++++|++++|||+..       .+.+...|++..+ ++|.|.++|+||+|+|+|++.+
T Consensus       160 Yg~sK~~~E~l~~~~~~~~gl~~~i~R~~nvYGP~~~~~~~i~~~i~~~~~g~~i~i~G~G~q~Rdf~yV~D~v~a~~~~  239 (355)
T PRK10217        160 YSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCV  239 (355)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHH
T ss_conf             89998766554355554158876972357557919998404999999997499886279998289758589999999999


Q ss_pred             HCC-CCCCCEECCCCCHHHHHHHHHHHHHHHCCCC---CCC-------CCCCCCCCCHHHHHHHCCCCEECHHHHH-HCC
Q ss_conf             513-5578616268433338999999999955799---863-------4310125682446553069451689999-739
Q gi|254780595|r  200 MTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITP---PLE-------QCFDTANISPFTRFFYADNKRISNAKIK-SLG  267 (289)
Q Consensus       200 ~~~-~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~---~~~-------~~~~~~~~~~~~~~~~~~~~~is~~kl~-~lG  267 (289)
                      +++ ..+++||++++++.+..++++.+++.++...   +..       +.+...  .|.    ......+|++|++ +||
T Consensus       240 ~~~~~~ge~yNiG~g~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~~~~i~~~~~--rp~----~~~~~~~D~ska~~~LG  313 (355)
T PRK10217        240 ATTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVAD--RPG----HDLRYAIDASKIARELG  313 (355)
T ss_pred             HHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCC--CCC----CCCEEEECHHHHHHHHC
T ss_conf             966999997997999962079999999999997623566554443455156799--999----98563228899999849


Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             84489999999999999751
Q gi|254780595|r  268 FQLLYPNYRISLKQLWKEIE  287 (289)
Q Consensus       268 ~~p~~p~~~~gl~~~~~~~~  287 (289)
                      |+|++ |++|||++++++..
T Consensus       314 w~P~~-sleeGl~~ti~Wy~  332 (355)
T PRK10217        314 WLPQE-TFESGMRKTVQWYL  332 (355)
T ss_pred             CCCCC-CHHHHHHHHHHHHH
T ss_conf             98899-99999999999999


No 8  
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional
Probab=100.00  E-value=0  Score=288.90  Aligned_cols=275  Identities=17%  Similarity=0.217  Sum_probs=191.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCE-EEEEECCH--HHHHHHHHCCCEEEECCCCCCCHHHHH-----HHCCCCEEEEEEC
Q ss_conf             999888-88899999999988988-99996794--463455644982898067864023465-----4115632787612
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVY-TCGTTRSV--SNLLTLKHKGISPFLFADQKINNLLRE-----KLYFTTHIVQCIK   73 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~-V~~~~r~~--~~~~~l~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~v~~~~~   73 (289)
                      |||||+ ||||++|+++|+++||+ |+++..-.  .+...+..    ....+..+....+..     ....+|.|+|+++
T Consensus         2 ILVTGgaGFIGS~l~~~L~~~G~~~V~~~Dnl~~~~~~~~l~~----~~~~d~~~~~~~~~~~~~~~~~~~id~V~Hlaa   77 (308)
T PRK11150          2 IIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVD----LDIADYMDKEDFLAQIMAGDDFGDIEAIFHEGA   77 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC----CCCCHHCCHHHHHHHHHHCCCCCCCCEEEECCC
T ss_conf             9994059799999999999779980999978999731301235----631012038999999861134578768999986


Q ss_pred             CCCCC--CEE-----ECCCCCHHH-HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             44433--100-----012210134-4320123343333201025762123453211234311345544555543200123
Q gi|254780595|r   74 PSSEG--DPC-----IISMSKDFY-KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKK  145 (289)
Q Consensus        74 ~~~~~--~~~-----~~~~~~~~~-~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~  145 (289)
                      .....  ++.     ......+++ .++.+..+|||+||.+|||+....++.|++++.|.++||.+|+.+|..+..++++
T Consensus        78 ~~~~~~~~~~~~~~~n~~~t~nll~~~~~~~~~~i~aSSs~vYG~~~~~~~~E~~~~~P~s~Yg~sK~~~E~~~~~~~~~  157 (308)
T PRK11150         78 CSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIEEREYEKPLNVYGYSKFLFDEYVRQILPE  157 (308)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             66664556511321499999999999997499889954756408988898656888998687676099999999999998


Q ss_pred             CCCCCCCCCCCCCCCCCCC-----------HHHHHHCCCCCCCCCC--CCEECCHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             4567642034777789850-----------3444311345432221--10001024777799999995135578616268
Q gi|254780595|r  146 LNIKLAVLRLSGIYGPKRN-----------PFIKIRQKNSLRLVKK--NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSD  212 (289)
Q Consensus       146 ~~~~~~ilR~~~iyGp~r~-----------~~~~~~~g~~~~~~~~--~~~~~~ihv~Dva~~i~~l~~~~~~~iyni~~  212 (289)
                      ++++++++|++++|||...           ...++.+|..+.+..|  .+.++||||+|+|+++++++++...++||+++
T Consensus       158 ~~~~~~~lR~fnvYGP~~~~~~~~~~v~~~~~~~~~~g~~~~~~~G~g~~~RDfiyV~Dv~~a~~~~~~~~~~gv~NiGs  237 (308)
T PRK11150        158 ANSQICGFRYFNVYGPREGHKGSMASVAFHLNNQLNNGENPKLFEGSENFKRDFVYVGDVAAVNLWFLENGVSGIFNLGT  237 (308)
T ss_pred             CCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCCEEEEEEEHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             39982898762378959788887320799999999779997475399987884577899999999998569987499879


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHHCCC-CCCCCCHHHHHHHHHHHHH
Q ss_conf             43333899999999995579986343101256824465530694516899997398-4489999999999999751
Q gi|254780595|r  213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF-QLLYPNYRISLKQLWKEIE  287 (289)
Q Consensus       213 ~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~lG~-~p~~p~~~~gl~~~~~~~~  287 (289)
                      +++.|+.|+++.+.+..|......+++.. ...+    ......+.|.+|++++|| +|++ +|+|||+++++|+.
T Consensus       238 g~~~si~el~~~i~~~~g~~~i~~i~~p~-~~~~----~~~~~~~aDisK~~~lg~~~p~~-sleeGl~~tv~W~~  307 (308)
T PRK11150        238 GRAESFQAVADAVLAYHKKGEIEYIPFPD-KLKG----RYQAFTQADLTKLRAAGYDKPFK-TVAEGVTEYMAWLN  307 (308)
T ss_pred             CCCEEHHHHHHHHHHHHCCCCCEECCCCC-CCCC----CCCEEEECCHHHHHHHHCCCCCC-CHHHHHHHHHHHHC
T ss_conf             99697999999999984988712426854-4577----77511125699999825899987-99999999999965


No 9  
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=100.00  E-value=0  Score=283.14  Aligned_cols=259  Identities=16%  Similarity=0.194  Sum_probs=184.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEEEECCCC---
Q ss_conf             999888-8889999999998898899996794463455644982898067864023465411--5632787612444---
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY--FTTHIVQCIKPSS---   76 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~~~~~~~---   76 (289)
                      |||||+ ||||++|++.|.++||+|++++|...               |.. +...+...+.  ..|.|+|+++...   
T Consensus         1 ILVtG~~GfiGs~l~~~L~~~g~~v~~~~r~~~---------------D~~-d~~~l~~~~~~~~pd~VihlAa~~~~~~   64 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAERGVEVVALDRPEL---------------DLT-DPEAVAALVREARPDVVVNAAAYTAVDK   64 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCC---------------CCC-CHHHHHHHHHHCCCCEEEECCCCCCCHH
T ss_conf             699648998999999999868998999548625---------------788-9999999998649979997241355567


Q ss_pred             -CCCEE-----ECCCCCHHHHH-HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             -33100-----01221013443-201233433332010257621234532112343113455445555432001234567
Q gi|254780595|r   77 -EGDPC-----IISMSKDFYKF-MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIK  149 (289)
Q Consensus        77 -~~~~~-----~~~~~~~~~~~-~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~  149 (289)
                       ..++.     ......++... ...-.++||+||..|||...+.+++|+++++|.+.||.+|+++|+.+.++..    +
T Consensus        65 ~~~~~~~~~~~Nv~~t~~l~~~~~~~~~~~i~~Ss~~Vy~g~~~~p~~E~~~~~P~~~Yg~sK~~~E~~~~~~~~----~  140 (284)
T pfam04321        65 AESEPELAYAVNALGPGNLAEACAARGAPLIHISTDYVFDGAKGGPYREDDPTGPLNVYGRTKLAGEQAVLAANP----R  140 (284)
T ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC----C
T ss_conf             774888899875999999999987449857984175300068998854577778988016575899999997253----4


Q ss_pred             CCCCCCCCCCCCCC-CH----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-----CCCCEECCCCCHHHHH
Q ss_conf             64203477778985-03----44431134543222110001024777799999995135-----5786162684333389
Q gi|254780595|r  150 LAVLRLSGIYGPKR-NP----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-----LGGIFNLSDDEPAPPQ  219 (289)
Q Consensus       150 ~~ilR~~~iyGp~r-~~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-----~~~iyni~~~~~~s~~  219 (289)
                      ++|+|++++|||+. +.    +.++..+....+. ++|..+++|++|+|+++.+++++.     .+|+||+++++++|..
T Consensus       141 ~~IlR~~~vyG~~~~~~~~~~~~~~~~~~~i~i~-~d~~~~~~~v~D~a~~~~~~~e~~~~~~~~~giyNi~~~~~~s~~  219 (284)
T pfam04321       141 HLILRTAWVYGEYGNNFVKTMLRLAAERDELRVV-DDQLGSPTSARDLADALLALIRKRLRGPALAGTYHLAGSGETSWY  219 (284)
T ss_pred             CEEEEEEEECCCCCCCHHHHHHHHHHCCCCCEEE-CCCCCCCEEHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCEEHH
T ss_conf             6078773442888878899999998628982685-375689698999999999999820337777761374189844099


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHH-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999995579986343101256824465530694516899997-398448999999999999975
Q gi|254780595|r  220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEI  286 (289)
Q Consensus       220 e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~-lG~~p~~p~~~~gl~~~~~~~  286 (289)
                      |+++.+++.+|...+...+.........+ .. ..+..+|++|+++ +||+|+  +|+|||++++++|
T Consensus       220 ela~~i~~~~g~~~~~i~~v~~~~~~~~~-~r-P~~~~lD~sK~~~~lg~~p~--~~~egl~~~l~~~  283 (284)
T pfam04321       220 DFARAIFDEAGADGGRVRPIPTAEYPTPA-RR-PANSVLDTSKLEATFGIPLP--DWREALAEVLDEL  283 (284)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEHHHCCCCC-CC-CCCCCCCHHHHHHHHCCCCC--CHHHHHHHHHHHH
T ss_conf             99999999968887742661188888789-99-76001559999997687999--8999999999996


No 10 
>KOG0747 consensus
Probab=100.00  E-value=8.4e-45  Score=275.18  Aligned_cols=281  Identities=18%  Similarity=0.236  Sum_probs=196.7

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHC--CCEEEEE-----ECCHHHHHHHHH-CCCEEEECCCCCCCHHHH-HHHCCCCEEEEE
Q ss_conf             399988-888899999999988--9889999-----679446345564-498289806786402346-541156327876
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALKV--GVYTCGT-----TRSVSNLLTLKH-KGISPFLFADQKINNLLR-EKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~~--g~~V~~~-----~r~~~~~~~l~~-~~~~~~~~~~~~~~~~~~-~~~~~~~~v~~~   71 (289)
                      +++||| |||||++.+..+...  .+..+.+     .-+...+..... .+..++..|..+...... .....+|+|+|.
T Consensus         8 ~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~~~n~p~ykfv~~di~~~~~~~~~~~~~~id~vihf   87 (331)
T KOG0747           8 NVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEPVRNSPNYKFVEGDIADADLVLYLFETEEIDTVIHF   87 (331)
T ss_pred             EEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCEEEECHHCCCHHHHHHHCCCCHHHHHHH
T ss_conf             08985476753113455334679987778762000024313544312588716860301050998765336715777767


Q ss_pred             ECCCCC---C-C------EEECCCCCHHHHH--HHCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             124443---3-1------0001221013443--2012334333320102576212345-321123431134554455554
Q gi|254780595|r   72 IKPSSE---G-D------PCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQWVD-EHSFVHPISCVATQRFNAEKE  138 (289)
Q Consensus        72 ~~~~~~---~-~------~~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~g~~i~-E~~~~~P~~~y~~~k~~~E~~  138 (289)
                      ++....   . +      ..+......+.+.  ..+++||||+||+.|||+..+.+.. |.++++|.++|+.+|+++|..
T Consensus        88 aa~t~vd~s~~~~~~~~~nnil~t~~Lle~~~~sg~i~~fvhvSTdeVYGds~~~~~~~E~s~~nPtnpyAasKaAaE~~  167 (331)
T KOG0747          88 AAQTHVDRSFGDSFEFTKNNILSTHVLLEAVRVSGNIRRFVHVSTDEVYGDSDEDAVVGEASLLNPTNPYAASKAAAEML  167 (331)
T ss_pred             HHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             76641466507658774576034577999988504734799964640234766445633225689998037889999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCH------HHH--HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEE
Q ss_conf             320012345676420347777898503------444--31134543222110001024777799999995135-578616
Q gi|254780595|r  139 WLAITKKLNIKLAVLRLSGIYGPKRNP------FIK--IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFN  209 (289)
Q Consensus       139 ~~~~~~~~~~~~~ilR~~~iyGp~r~~------~~~--~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyn  209 (289)
                      +++|.+++++|++++|..+||||++.+      |..  .+.+....-+.|-|.+||+|++|+++++.++.++. .|+|||
T Consensus       168 v~Sy~~sy~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~veD~~ea~~~v~~Kg~~geIYN  247 (331)
T KOG0747         168 VRSYGRSYGLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVEDVSEAFKAVLEKGELGEIYN  247 (331)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99987604971799941573388857167768899999718976421574101225769999999999984578562364


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC----CCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             268433338999999999955799863431012----5682446553069451689999739844899999999999997
Q gi|254780595|r  210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE  285 (289)
Q Consensus       210 i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~----~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~~~~~~  285 (289)
                      ++++.+++..|+++++++++.+..+ ....++.    +..|    +...-..+++.|+|+|||+|++| |++||++++++
T Consensus       248 Igtd~e~~~~~l~k~i~eli~~~~~-~~~~~p~~~~v~dRp----~nd~Ry~~~~eKik~LGw~~~~p-~~eGLrktie~  321 (331)
T KOG0747         248 IGTDDEMRVIDLAKDICELFEKRLP-NIDTEPFIFFVEDRP----YNDLRYFLDDEKIKKLGWRPTTP-WEEGLRKTIEW  321 (331)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCCCCEECCCCC----CCCCCCCCCHHHHHHCCCCCCCC-HHHHHHHHHHH
T ss_conf             1683076699999999999997546-888888633158887----64201000588897538721576-78889999999


Q ss_pred             HHC
Q ss_conf             513
Q gi|254780595|r  286 IEN  288 (289)
Q Consensus       286 ~~~  288 (289)
                      +-+
T Consensus       322 y~~  324 (331)
T KOG0747         322 YTK  324 (331)
T ss_pred             HHH
T ss_conf             986


No 11 
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=1.1e-42  Score=263.03  Aligned_cols=279  Identities=17%  Similarity=0.175  Sum_probs=203.4

Q ss_pred             CEEEEEC-CCHHHHHHHHHHHHCC--CEEEEEE-----CCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEE
Q ss_conf             9399988-8888999999999889--8899996-----794463455644982898067864023465411--5632787
Q gi|254780595|r    1 MHLMIFG-AGYTGKFIADAALKVG--VYTCGTT-----RSVSNLLTLKHKGISPFLFADQKINNLLREKLY--FTTHIVQ   70 (289)
Q Consensus         1 MkIlI~G-aG~iG~~l~~~L~~~g--~~V~~~~-----r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~   70 (289)
                      |+||||| |||||+.++++++++.  ++|+.+.     -+.+++..+....-..++..|..+...+...+.  ..|+|+|
T Consensus         1 ~~iLVTGGaGFIGsnfvr~~~~~~~d~~v~~~DkLTYAgn~~~l~~~~~~~~~~fv~~DI~D~~~v~~~~~~~~~D~Vvh   80 (340)
T COG1088           1 MKILVTGGAGFIGSNFVRYILNKHPDDHVVNLDKLTYAGNLENLADVEDSPRYRFVQGDICDRELVDRLFKEYQPDAVVH   80 (340)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             93799657515778999999960997528997523315778788864069971588545547999999997448875998


Q ss_pred             EECCCC----------CCCEEECCCCCHHHHHHHCC--CCCCCCCCEEECCCCCC--CCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             612444----------33100012210134432012--33433332010257621--23453211234311345544555
Q gi|254780595|r   71 CIKPSS----------EGDPCIISMSKDFYKFMPHV--KWIGYLSSTSIYGNREG--QWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        71 ~~~~~~----------~~~~~~~~~~~~~~~~~~~~--~~~i~~SS~~VYg~~~g--~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      .|+-+-          .-...+......+.+.++.-  -||+++||..|||+-..  ..++|++|++|.+||+.+|+++.
T Consensus        81 fAAESHVDRSI~~P~~Fi~TNv~GT~~LLEaar~~~~~frf~HISTDEVYG~l~~~~~~FtE~tp~~PsSPYSASKAasD  160 (340)
T COG1088          81 FAAESHVDRSIDGPAPFIQTNVVGTYTLLEAARKYWGKFRFHHISTDEVYGDLGLDDDAFTETTPYNPSSPYSASKAASD  160 (340)
T ss_pred             ECHHCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             11001332233570553400028799999999984666207994152102566678887544799999997404455678


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCH-------HHHHHCCCC-CCCCCCCCEECCHHHHHHHHHHHHHHCC-CCCCC
Q ss_conf             54320012345676420347777898503-------444311345-4322211000102477779999999513-55786
Q gi|254780595|r  137 KEWLAITKKLNIKLAVLRLSGIYGPKRNP-------FIKIRQKNS-LRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGI  207 (289)
Q Consensus       137 ~~~~~~~~~~~~~~~ilR~~~iyGp~r~~-------~~~~~~g~~-~~~~~~~~~~~~ihv~Dva~~i~~l~~~-~~~~i  207 (289)
                      .++++|.+.+|+|++|.|+++-|||-..+       +.+...|++ +..++|.|.+.|+||+|-++|+..++++ ..|++
T Consensus       161 ~lVray~~TYglp~~ItrcSNNYGPyqfpEKlIP~~I~nal~g~~lpvYGdG~~iRDWl~VeDh~~ai~~Vl~kg~~GE~  240 (340)
T COG1088         161 LLVRAYVRTYGLPATITRCSNNYGPYQFPEKLIPLMIINALLGKPLPVYGDGLQIRDWLYVEDHCRAIDLVLTKGKIGET  240 (340)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEEHHHHHHHHHHHHCCCCCCE
T ss_conf             99999998719966984477776887671556679999997399985436985402058717578899999956867766


Q ss_pred             EECCCCCHHHHHHHHHHHHHHHCCCCCC---CCCCCCCCCCHHHHHHHCCCCEECHHHHH-HCCCCCCCCCHHHHHHHHH
Q ss_conf             1626843333899999999995579986---34310125682446553069451689999-7398448999999999999
Q gi|254780595|r  208 FNLSDDEPAPPQNVIMEAASLMKITPPL---EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLW  283 (289)
Q Consensus       208 yni~~~~~~s~~e~~~~i~~~~g~~~~~---~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~lG~~p~~p~~~~gl~~~~  283 (289)
                      ||++++...+..|+++.+|+.++...+.   .+.+-....+-.  ..+    -++++||+ +|||+|++ +|++||++++
T Consensus       241 YNIgg~~E~~Nlevv~~i~~~l~~~~~~~~~li~~V~DRpGHD--~RY----aid~~Ki~~eLgW~P~~-~fe~GlrkTv  313 (340)
T COG1088         241 YNIGGGNERTNLEVVKTICELLGKDKPDYRDLITFVEDRPGHD--RRY----AIDASKIKRELGWRPQE-TFETGLRKTV  313 (340)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCCCHHHHEEECCCCCCCC--CCE----EECHHHHHHHCCCCCCC-CHHHHHHHHH
T ss_conf             8717875200799999999986766511041247616789975--010----10667776542988678-8888999999


Q ss_pred             HHH
Q ss_conf             975
Q gi|254780595|r  284 KEI  286 (289)
Q Consensus       284 ~~~  286 (289)
                      ++.
T Consensus       314 ~WY  316 (340)
T COG1088         314 DWY  316 (340)
T ss_pred             HHH
T ss_conf             999


No 12 
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099   This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=100.00  E-value=3e-43  Score=266.25  Aligned_cols=273  Identities=19%  Similarity=0.222  Sum_probs=206.3

Q ss_pred             EEEE-C-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEC----CCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9998-8-888899999999988988999967944634556449828980----678640234654115632787612444
Q gi|254780595|r    3 LMIF-G-AGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF----ADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         3 IlI~-G-aG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~----~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
                      |||| | .||||++|+++|.++||+|+.++|++.+.............-    +....+..+ ..+..+|+|||+|+.+-
T Consensus         1 ~litGgnTGfiG~~L~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~W-~~l~~~DaviNLAG~~i   79 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLTKSGHEVTILTRSPQAESNTKKVGYKNWLAEGKLGIVIAESGW-SALEGADAVINLAGEPI   79 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHCCCCCCCCCCCCCCCCCCHHCC-CCCCCCCEEEECCCCCC
T ss_conf             96415330237899999998479989999616864320002554455552212452072205-66788627985568885


Q ss_pred             CC-C------------EEECCCCCHHHH---H----HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC-CCHHHHHHHHH
Q ss_conf             33-1------------000122101344---3----20123343333201025762123453211234-31134554455
Q gi|254780595|r   77 EG-D------------PCIISMSKDFYK---F----MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP-ISCVATQRFNA  135 (289)
Q Consensus        77 ~~-~------------~~~~~~~~~~~~---~----~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P-~~~y~~~k~~~  135 (289)
                      .. .            +++. .++.+++   .    ..+.+-||-.|.++-||......++|+++..+ .++-+..-.+.
T Consensus        80 ~~P~RWt~~~K~~i~~SRi~-~T~~L~~~i~~~~r~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~~~~ddFla~lc~~W  158 (307)
T TIGR01777        80 ADPKRWTEERKQEIRDSRID-TTRALVEAIAAAPRAEQKPKVFISASAVGYYGHSEDRVFTEEDASGPGDDFLAELCRDW  158 (307)
T ss_pred             CCCCCCCHHHHHHHHHCCHH-HHHHHHHHHHHCCCCCCCCCEEEEEEEEEEECCCCCCEEECCCCCCCCCCCHHHHHHHH
T ss_conf             77888787775756523347-89999999984656678871688501666306899821511667888777218999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHH----HCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC-CCCCCEEC
Q ss_conf             5543200123456764203477778985034443----113454322211000102477779999999513-55786162
Q gi|254780595|r  136 EKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI----RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNL  210 (289)
Q Consensus       136 E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~----~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~-~~~~iyni  210 (289)
                      |+..... ++.|++++++|.+.|.|++...|.+|    +-+....+++|.|++||||++|++++|.+++++ ...|+||+
T Consensus       159 E~~A~~a-~~~g~Rvv~~R~G~VLg~~GGaL~~m~~pf~~glGGplG~G~Q~~SWIH~~D~v~~I~~~l~~~~~~Gp~N~  237 (307)
T TIGR01777       159 EEAAQAA-EQLGTRVVLLRTGIVLGPKGGALAKMLPPFRLGLGGPLGSGRQWFSWIHIEDLVQLILFALENASVSGPVNA  237 (307)
T ss_pred             HHHHHHH-HHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             9985105-336873898764134708987034545667651574236884145053588999999999855899632541


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHH
Q ss_conf             68433338999999999955799863431--0125682446553069451689999739844899999999
Q gi|254780595|r  211 SDDEPAPPQNVIMEAASLMKITPPLEQCF--DTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISL  279 (289)
Q Consensus       211 ~~~~~~s~~e~~~~i~~~~g~~~~~~~~~--~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl  279 (289)
                      ++|+|++++||.+.+++.+++|.+..++-  ....+++++.. ..+++|+.++|+.+.||+|+||+++++|
T Consensus       238 tAP~Pv~n~~F~~~la~~l~RP~~~~vP~~~~~~~LGe~a~~-~L~gQrV~P~kl~~~GF~F~Y~~l~~AL  307 (307)
T TIGR01777       238 TAPEPVRNKEFAKALARALHRPAFLPVPAFVLRLLLGEMADL-LLKGQRVLPEKLLEAGFQFQYPDLDEAL  307 (307)
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCCEEECCCCCCCC
T ss_conf             078863578999999998189701011089999884255888-9865789999999749766213320249


No 13 
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=2.8e-41  Score=255.02  Aligned_cols=278  Identities=18%  Similarity=0.193  Sum_probs=197.4

Q ss_pred             CEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHCCCEEEECCCCCCCHHHHHHH--CCCCEEEEEECCCC
Q ss_conf             9399988-88889999999998898899996794-46345564498289806786402346541--15632787612444
Q gi|254780595|r    1 MHLMIFG-AGYTGKFIADAALKVGVYTCGTTRSV-SNLLTLKHKGISPFLFADQKINNLLREKL--YFTTHIVQCIKPSS   76 (289)
Q Consensus         1 MkIlI~G-aG~iG~~l~~~L~~~g~~V~~~~r~~-~~~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~v~~~~~~~~   76 (289)
                      |+||||| |||||+|.+.+|++.||+|+++..-. .....+.......+.+|..+ ...+.+.+  ..++.|+|.++...
T Consensus         1 ~~iLVtGGAGYIGSHtv~~Ll~~G~~vvV~DNL~~g~~~~v~~~~~~f~~gDi~D-~~~L~~vf~~~~idaViHFAa~~~   79 (329)
T COG1087           1 MKVLVTGGAGYIGSHTVRQLLKTGHEVVVLDNLSNGHKIALLKLQFKFYEGDLLD-RALLTAVFEENKIDAVVHFAASIS   79 (329)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHCCCCEEEECCCC-HHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             9299965865468999999997898489995688788888602048568833431-999999998649988998730043


Q ss_pred             C----------CCEEECCCCCHHHHHH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             3----------3100012210134432-0123343333201025762123453211234311345544555543200123
Q gi|254780595|r   77 E----------GDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKK  145 (289)
Q Consensus        77 ~----------~~~~~~~~~~~~~~~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~  145 (289)
                      -          +++.+......+.++. .++++|||-||+.|||+...-|++|+.|+.|.++||.+|++.|+++.++.+.
T Consensus        80 VgESv~~Pl~Yy~NNv~gTl~Ll~am~~~gv~~~vFSStAavYG~p~~~Pi~E~~~~~p~NPYG~sKlm~E~iL~d~~~a  159 (329)
T COG1087          80 VGESVQNPLKYYDNNVVGTLNLIEAMLQTGVKKFIFSSTAAVYGEPTTSPISETSPLAPINPYGRSKLMSEEILRDAAKA  159 (329)
T ss_pred             CCHHHHCHHHHHHHCHHHHHHHHHHHHHHCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             23444187888860308699999999982997699924301038998766478888899885315799999999999871


Q ss_pred             CCCCCCCCCCCCCCCC---CC---------CHHHHH---HCCC--CCCCCC-------CCCEECCHHHHHHHHHHHHHH-
Q ss_conf             4567642034777789---85---------034443---1134--543222-------110001024777799999995-
Q gi|254780595|r  146 LNIKLAVLRLSGIYGP---KR---------NPFIKI---RQKN--SLRLVK-------KNQVFNRIRVEDVARCVIFLM-  200 (289)
Q Consensus       146 ~~~~~~ilR~~~iyGp---~r---------~~~~~~---~~g~--~~~~~~-------~~~~~~~ihv~Dva~~i~~l~-  200 (289)
                      +++++++||++++-|-   |+         +.+..+   ..|+  ...+++       |.-.+.+|||.|+|.+=++++ 
T Consensus       160 ~~~~~v~LRYFN~aGA~~~G~iGe~~~~~thLip~~~q~A~G~r~~l~ifG~DY~T~DGT~iRDYIHV~DLA~aHv~Al~  239 (329)
T COG1087         160 NPFKVVILRYFNVAGACPDGTLGQRYPGATLLIPVAAEAALGKRDKLFIFGDDYDTKDGTCIRDYIHVDDLADAHVLALK  239 (329)
T ss_pred             CCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEEEEEHHHHHHHHHHHHH
T ss_conf             69728999851335679887667799993368899999984688655784898999998702234324667999999999


Q ss_pred             ---CCCCCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHH-HCCCCCCCCCHH
Q ss_conf             ---1355786162684333389999999999557998634310125682446553069451689999-739844899999
Q gi|254780595|r  201 ---THHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR  276 (289)
Q Consensus       201 ---~~~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~lG~~p~~p~~~  276 (289)
                         +.....+||+++++..|.+|+++.+.+..|.+.|..+.-  - ....+..++     -|++|++ +|||+|+|++++
T Consensus       240 ~L~~~g~~~~~NLG~G~G~SV~evi~a~~~vtg~~ip~~~~~--R-R~GDpa~l~-----Ad~~kA~~~LgW~p~~~~L~  311 (329)
T COG1087         240 YLKEGGSNNIFNLGSGNGFSVLEVIEAAKKVTGRDIPVEIAP--R-RAGDPAILV-----ADSSKARQILGWQPTYDDLE  311 (329)
T ss_pred             HHHHCCCEEEEECCCCCCEEHHHHHHHHHHHHCCCCCEEECC--C-CCCCCCEEE-----ECHHHHHHHHCCCCCCCCHH
T ss_conf             998189604897468975249999999999869957626578--8-999961147-----67899998839976337899


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999751
Q gi|254780595|r  277 ISLKQLWKEIE  287 (289)
Q Consensus       277 ~gl~~~~~~~~  287 (289)
                      +=+++.|.+.+
T Consensus       312 ~ii~~aw~W~~  322 (329)
T COG1087         312 DIIKDAWDWHQ  322 (329)
T ss_pred             HHHHHHHHHHH
T ss_conf             99998877766


No 14 
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=100.00  E-value=3.4e-41  Score=254.53  Aligned_cols=280  Identities=18%  Similarity=0.253  Sum_probs=205.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCC-CEEEEEECCCCCC
Q ss_conf             93999888-888999999999889889999679446345564498289806786402346541156-3278761244433
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFT-THIVQCIKPSSEG   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~-~~v~~~~~~~~~~   78 (289)
                      |+|||||+ ||||++|+++|+++||+|++++|......... .++..+..+..+. .......... |.|+|+++.....
T Consensus         1 ~~iLVtG~tGfiG~~l~~~L~~~g~~V~~~~r~~~~~~~~~-~~~~~~~~d~~~~-~~~~~~~~~~~d~vih~aa~~~~~   78 (314)
T COG0451           1 MRILVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLDPLL-SGVEFVVLDLTDR-DLVDELAKGVPDAVIHLAAQSSVP   78 (314)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC-CCCCEEECCCCCH-HHHHHHHCCCCCEEEECCCCCCCC
T ss_conf             96999928877799999999858997999917875431124-6764342253356-789988545887899888646775


Q ss_pred             CE----------EECCCCCHHH-HHHH-CCCCCCCCCCEEECCCC-CCCCCCCC-CCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             10----------0012210134-4320-12334333320102576-21234532-1123431134554455554320012
Q gi|254780595|r   79 DP----------CIISMSKDFY-KFMP-HVKWIGYLSSTSIYGNR-EGQWVDEH-SFVHPISCVATQRFNAEKEWLAITK  144 (289)
Q Consensus        79 ~~----------~~~~~~~~~~-~~~~-~~~~~i~~SS~~VYg~~-~g~~i~E~-~~~~P~~~y~~~k~~~E~~~~~~~~  144 (289)
                      ..          .......++. ++.. .++++||.||.++|+.. .+.+++|+ .|..|.++|+.+|+++|+.++.+.+
T Consensus        79 ~~~~~~~~~~~~~nv~gt~~ll~aa~~~~~~~~v~~ss~~~~~~~~~~~~~~E~~~~~~p~~~Yg~sK~~~E~~~~~~~~  158 (314)
T COG0451          79 DSNASDPAEFLDVNVDGTLNLLEAARAAGVKRFVFASSVSVVYGDPPPLPIDEDLGPPRPLNPYGVSKLAAEQLLRAYAR  158 (314)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             33321478899999999999999998679987999787501278878888786557888876779999999999999766


Q ss_pred             CCCCCCCCCCCCCCCCCCCCH-----HH-----HHHCCCC-CCC-CCCCCEECCHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             345676420347777898503-----44-----4311345-432-22110001024777799999995135578616268
Q gi|254780595|r  145 KLNIKLAVLRLSGIYGPKRNP-----FI-----KIRQKNS-LRL-VKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSD  212 (289)
Q Consensus       145 ~~~~~~~ilR~~~iyGp~r~~-----~~-----~~~~g~~-~~~-~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iyni~~  212 (289)
                      .++++++++||++||||++..     +.     ++..+.+ ... .++++.++++|++|+++++.+++++...++||+++
T Consensus       159 ~~~~~~~ilR~~~vyGp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~~~~~~~~~~~~~~~~~ni~~  238 (314)
T COG0451         159 LYGLPVVILRPFNVYGPGDKPDLSSGVVSAFIRQLLKGEPIIVIGGDGSQTRDFVYVDDVADALLLALENPDGGVFNIGS  238 (314)
T ss_pred             HCCCCEEEEEECEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCEEEEEEHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             33995799984637888987774207899999998707885035078862242577999999999997388871899469


Q ss_pred             CC-HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHH-HCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             43-33389999999999557998634310125682446553069451689999-739844899999999999997513
Q gi|254780595|r  213 DE-PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       213 ~~-~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      ++ +.+++|+++.+++.++.+.+. ....+.    ........+..+++.|.+ +|||+|++ ++++++.++++++..
T Consensus       239 ~~~~~~~~e~~~~~~~~~~~~~~~-~~~~~~----~~~~~~~~~~~~~~~~~~~~lg~~p~~-~~~~~i~~~~~~~~~  310 (314)
T COG0451         239 GTAEITVRELAEAVAEAVGSKAPL-IVYIPL----GRRGDLREGKLLDISKARAALGWEPKV-SLEEGLADTLEWLLK  310 (314)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCC-CEECCC----CCHHHHCCCCCCCHHHHHHHHCCCCCC-CHHHHHHHHHHHHHH
T ss_conf             877768999999999984887542-010343----220010134326879999971997889-989999999999986


No 15 
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912   Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics.   This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below: ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process.
Probab=100.00  E-value=3.6e-40  Score=248.70  Aligned_cols=285  Identities=17%  Similarity=0.246  Sum_probs=194.2

Q ss_pred             EEEEC-CCHHHHHHHHHHHHCC-C-EEEEEE--CC------------HH--HHHHHHHCCCEEEECCCCCCCHHHHH---
Q ss_conf             99988-8888999999999889-8-899996--79------------44--63455644982898067864023465---
Q gi|254780595|r    3 LMIFG-AGYTGKFIADAALKVG-V-YTCGTT--RS------------VS--NLLTLKHKGISPFLFADQKINNLLRE---   60 (289)
Q Consensus         3 IlI~G-aG~iG~~l~~~L~~~g-~-~V~~~~--r~------------~~--~~~~l~~~~~~~~~~~~~~~~~~~~~---   60 (289)
                      |+||| ||||||.|+..|.++| . +|.++.  |+            -+  +...|....+..++ +..++...+..   
T Consensus         1 IiVTGGAGFIGSNlv~~LN~~gP~~dI~vvD~L~~~~~F~ng~~~slg~~kk~~Nl~~~~I~d~i-~k~~~~~~l~~~~~   79 (353)
T TIGR02197         1 IIVTGGAGFIGSNLVKALNERGPETDILVVDNLRDDATFENGNPQSLGHFKKFLNLADLEIADYI-DKDDLLDRLEKGSE   79 (353)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCHHHCCCCCCCCCCHHHCCC-CCHHHHHHHHHCCC
T ss_conf             95506763689999999964389542888740787552467774322342443255541121335-88546999983020


Q ss_pred             HHCCCCEEEEEECCCCCC--CEE-----ECCCCCHHHH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCC-----CCCCH
Q ss_conf             411563278761244433--100-----0122101344-3201233433332010257621234532112-----34311
Q gi|254780595|r   61 KLYFTTHIVQCIKPSSEG--DPC-----IISMSKDFYK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFV-----HPISC  127 (289)
Q Consensus        61 ~~~~~~~v~~~~~~~~~~--~~~-----~~~~~~~~~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~-----~P~~~  127 (289)
                      ....++.|+|-.|-+...  |..     .....+.++. |..+-.+|||+||++|||+....+.++..+.     .|.|.
T Consensus        80 ~~~~~~avfH~GAcS~TTe~D~~~~m~nN~~ys~~Ll~~c~~~~~~~IYASSAatYG~~~~~f~~~~~~e~L~kLrPlN~  159 (353)
T TIGR02197        80 ALGKIEAVFHQGACSDTTETDGEYMMENNYQYSKRLLDWCAEKGVPFIYASSAATYGDGEAGFREDRELEELQKLRPLNV  159 (353)
T ss_pred             CCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCCCCCCCCCCCCCHHHHHHCCCCCC
T ss_conf             13883379973312535886279999889999999999999648986885031210768777776656588975187886


Q ss_pred             HHHHHHHHHHHHHHCC-C--CCCCCCCCCCCCCCCCCC-----C------CHHHHHHCCCCCCCC--------CCCCEEC
Q ss_conf             3455445555432001-2--345676420347777898-----5------034443113454322--------2110001
Q gi|254780595|r  128 VATQRFNAEKEWLAIT-K--KLNIKLAVLRLSGIYGPK-----R------NPFIKIRQKNSLRLV--------KKNQVFN  185 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~-~--~~~~~~~ilR~~~iyGp~-----r------~~~~~~~~g~~~~~~--------~~~~~~~  185 (289)
                      ||-||....+.+++.. +  ...-+++-||+++||||.     +      +.+.+++.++.+.++        +|+|.+.
T Consensus       160 YGySK~lFD~~v~~~~~~~~~~~~q~~GLrYFNVYGP~E~HKG~MASv~f~~~~q~~~~~~v~LF~~~~~~~~dGeQ~RD  239 (353)
T TIGR02197       160 YGYSKFLFDQYVRRRVLPGEALSAQVVGLRYFNVYGPREYHKGKMASVAFHLFNQIKAGGNVKLFKSHKEGFKDGEQLRD  239 (353)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             12216789899999860124798642410211346888675443699999988899737882023566858988781101


Q ss_pred             CHHHHHHHHHHHHHHCCC-CCCCEECCCCCHHHHHHHHHHHHHHHC--CCCCCCC-------CCCCCCCCHHHHHHHCCC
Q ss_conf             024777799999995135-578616268433338999999999955--7998634-------310125682446553069
Q gi|254780595|r  186 RIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMK--ITPPLEQ-------CFDTANISPFTRFFYADN  255 (289)
Q Consensus       186 ~ihv~Dva~~i~~l~~~~-~~~iyni~~~~~~s~~e~~~~i~~~~g--~~~~~~~-------~~~~~~~~~~~~~~~~~~  255 (289)
                      ||||+||+++.+++++++ .+|||||++|.+-|++|++..+-+.++  ...|+..       ..+--..+...+.+|..-
T Consensus       240 FVYV~DV~~~n~~~~~~~~~SGifN~GtG~ArsF~dla~a~~~~~~~~~~~~LSl~~lv~~~~i~Yi~~Pe~lrg~YQ~f  319 (353)
T TIGR02197       240 FVYVKDVVKVNLWLLENPSKSGIFNVGTGKARSFNDLADAVFKALGTNKGEPLSLKELVEDFKIEYIDMPEALRGKYQYF  319 (353)
T ss_pred             CEEHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEECCCHHHHHCCCCC
T ss_conf             15527699999999848898415644778886689999999998731468885779887306720102835740005740


Q ss_pred             CEECHHHHHHCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             451689999739844899999999999997513
Q gi|254780595|r  256 KRISNAKIKSLGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       256 ~~is~~kl~~lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      +.-+-+|+|+.|+...+.+++||++++++++.+
T Consensus       320 TqAd~~~lr~aGy~~~~~~LeeGV~dY~~~~~~  352 (353)
T TIGR02197       320 TQADIDKLREAGYYKPFTTLEEGVKDYVQWLLA  352 (353)
T ss_pred             CHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             166489999732787673488999999999860


No 16 
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]
Probab=100.00  E-value=4.5e-40  Score=248.17  Aligned_cols=272  Identities=19%  Similarity=0.241  Sum_probs=207.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHC-CCCEEEEEECCCCCCC-
Q ss_conf             999888-8889999999998898899996794463455644982898067864023465411-5632787612444331-
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY-FTTHIVQCIKPSSEGD-   79 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~v~~~~~~~~~~~-   79 (289)
                      |+|||+ ||||++|+..|.+.||+|+.++|++.+........++  .+      +.+..... .+|.|+++++.+-... 
T Consensus         1 IliTGgTGlIG~~L~~~L~~~gh~v~iltR~~~~~~~~~~~~v~--~~------~~~~~~~~~~~DavINLAG~~I~~rr   72 (297)
T COG1090           1 ILITGGTGLIGRALTARLRKGGHQVTILTRRPPKASQNLHPNVT--LW------EGLADALTLGIDAVINLAGEPIAERR   72 (297)
T ss_pred             CEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCC--CC------CHHHHCCCCCCCEEEECCCCCCCCCC
T ss_conf             95735665016899999984898699997478502332476533--43------01244036787789988898154465


Q ss_pred             -----------EEEC---CCCCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             -----------0001---22101344320123343333201025762123453211234311345544555543200123
Q gi|254780595|r   80 -----------PCII---SMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKK  145 (289)
Q Consensus        80 -----------~~~~---~~~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~  145 (289)
                                 +++.   ...+.+.+...+.+.+|-.|.++.||+.....++|++|+ +.++-+..-.+.|+..... +.
T Consensus        73 Wt~~~K~~i~~SRi~~T~~L~e~I~~~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~-g~~Fla~lc~~WE~~a~~a-~~  150 (297)
T COG1090          73 WTEKQKEEIRQSRINTTEKLVELIAASETKPKVLISASAVGYYGHSGDRVVTEESPP-GDDFLAQLCQDWEEEALQA-QQ  150 (297)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCCCEEEECCCCC-CCCHHHHHHHHHHHHHHHH-HH
T ss_conf             788999999997768999999999852679808985245777558886464157888-7775999999999998666-40


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHH----HCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC-CCCCCEECCCCCHHHHHH
Q ss_conf             456764203477778985034443----113454322211000102477779999999513-557861626843333899
Q gi|254780595|r  146 LNIKLAVLRLSGIYGPKRNPFIKI----RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQN  220 (289)
Q Consensus       146 ~~~~~~ilR~~~iyGp~r~~~~~~----~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~-~~~~iyni~~~~~~s~~e  220 (289)
                      .|.+++++|.+.|.||....+.++    +-+....+++|.||+||||++|++++|.+++++ ...|+||++++.|+++++
T Consensus       151 ~gtRvvllRtGvVLs~~GGaL~~m~~~fk~glGG~~GsGrQ~~SWIhieD~v~~I~fll~~~~lsGp~N~taP~PV~~~~  230 (297)
T COG1090         151 LGTRVVLLRTGVVLSPDGGALGKMLPLFKLGLGGKLGSGRQWFSWIHIEDLVNAILFLLENEQLSGPFNLTAPNPVRNKE  230 (297)
T ss_pred             CCCEEEEEEEEEEECCCCCCHHHHCCHHHHCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHH
T ss_conf             68469999887786178860343101355225771589873034332999999999998475777751035898672899


Q ss_pred             HHHHHHHHHCCCCCCCCCCC--CCCCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999999557998634310--125682446553069451689999739844899999999999997
Q gi|254780595|r  221 VIMEAASLMKITPPLEQCFD--TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE  285 (289)
Q Consensus       221 ~~~~i~~~~g~~~~~~~~~~--~~~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~~~~~~  285 (289)
                      |.+.+++.++.|.+..++-.  ...+..++.. ..+++|+-+.|+.+.||+|+||+++++|.+++++
T Consensus       231 F~~al~r~l~RP~~~~vP~~~~rl~LGe~a~~-lL~gQrvlP~kl~~aGF~F~y~dl~~AL~~il~~  296 (297)
T COG1090         231 FAHALGRALHRPAILPVPSFALRLLLGEMADL-LLGGQRVLPKKLEAAGFQFQYPDLEEALADILKR  296 (297)
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH-HHCCCHHHHHHHHHCCCEEECCCHHHHHHHHHHC
T ss_conf             99999998679953569389999985225898-8636034479998779816657799999999726


No 17 
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=100.00  E-value=4.4e-39  Score=242.50  Aligned_cols=236  Identities=18%  Similarity=0.167  Sum_probs=168.0

Q ss_pred             EEECC-CHHHHHHHHHHHHCCC--EEEEEECC--HHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             99888-8889999999998898--89999679--4463455644982898067864023465411563278761244433
Q gi|254780595|r    4 MIFGA-GYTGKFIADAALKVGV--YTCGTTRS--VSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG   78 (289)
Q Consensus         4 lI~Ga-G~iG~~l~~~L~~~g~--~V~~~~r~--~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~   78 (289)
                      ||||+ ||||++|+++|+++||  +|+++.+.  +.....+...+...++..|..+...+...+.++|.|+|+++.....
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~gDl~d~~~l~~~~~~~D~V~H~Aa~~~~~   80 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDLRFSPELLEDFSKLQVITYIEGDVTDKQDLRRALQGSDVVIHTAAIIDVF   80 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             90586759999999999977997579998788986788873225887599912899999999984799899721223555


Q ss_pred             ---C-----EEECCCCCHHHHH--HHCCCCCCCCCCEEECCCCC-CCCC---CCCCC--CCCCCHHHHHHHHHHHHHHHC
Q ss_conf             ---1-----0001221013443--20123343333201025762-1234---53211--234311345544555543200
Q gi|254780595|r   79 ---D-----PCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNRE-GQWV---DEHSF--VHPISCVATQRFNAEKEWLAI  142 (289)
Q Consensus        79 ---~-----~~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~-g~~i---~E~~~--~~P~~~y~~~k~~~E~~~~~~  142 (289)
                         +     ......+.++++.  ..++++|||+||.+|||+.. +.++   +|++|  ..|.++|+.+|.++|+.++++
T Consensus        81 ~~~~~~~~~~~Nv~gt~~ll~aa~~~gvkr~V~~SS~~v~g~~~~~~~~~~~~e~~p~~~~~~~~Y~~SK~~aE~~vl~a  160 (280)
T pfam01073        81 GKAYRDTIMKVNVKGTQNVLDACVKAGVRVLVYTSSMEVVGPNSYGQPIVNGDETTPYESTHQDPYPESKALAEKLVLKA  160 (280)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             66799999999999999999999964777079970047876777788756788888788888980288999999999985


Q ss_pred             C-----CCCCCCCCCCCCCCCCCCCCCH-----HHHHHCCCCC-CCCCCCCEECCHHHHHHHHHHHHHHCC---------
Q ss_conf             1-----2345676420347777898503-----4443113454-322211000102477779999999513---------
Q gi|254780595|r  143 T-----KKLNIKLAVLRLSGIYGPKRNP-----FIKIRQKNSL-RLVKKNQVFNRIRVEDVARCVIFLMTH---------  202 (289)
Q Consensus       143 ~-----~~~~~~~~ilR~~~iyGp~r~~-----~~~~~~g~~~-~~~~~~~~~~~ihv~Dva~~i~~l~~~---------  202 (289)
                      .     ....++++++||++||||+...     +..+++|... .++++.+.++++||+|+|++++++++.         
T Consensus       161 ~~~~~~~~~~~~~v~lRp~~vyGp~~~~~~~~~~~~~~~g~~~~~~g~g~~~~~~v~V~Dva~A~vlA~~~l~~~~~~~~  240 (280)
T pfam01073       161 NGSTLKNGGRLYTCALRPAGIFGEGDPFLFPFLVRLLKNGLAKFRTGDKNVLSDRVYVGNVAWAHILAARALQDPKKASS  240 (280)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             03344314553168854666538995159999999997599973679999888972787699999999986014566778


Q ss_pred             CCCCCEECCCCCHH-HHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             55786162684333-38999999999955799863431
Q gi|254780595|r  203 HLGGIFNLSDDEPA-PPQNVIMEAASLMKITPPLEQCF  239 (289)
Q Consensus       203 ~~~~iyni~~~~~~-s~~e~~~~i~~~~g~~~~~~~~~  239 (289)
                      -.|++||+++++|. |+.|+++.+++.+|++.|..++.
T Consensus       241 ~~Ge~y~i~~~~p~~s~~e~~~~~~~alG~~~p~~~~~  278 (280)
T pfam01073       241 IAGQFYFISDDTPHNSYDDFNRTLLKALGLRLPSSIKL  278 (280)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             89748997799916779999999999809999871889


No 18 
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=100.00  E-value=3.6e-39  Score=242.98  Aligned_cols=207  Identities=21%  Similarity=0.290  Sum_probs=154.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH-HHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEEEECCCCCC
Q ss_conf             999888-888999999999889889999679446345-5644982898067864023465411--563278761244433
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT-LKHKGISPFLFADQKINNLLREKLY--FTTHIVQCIKPSSEG   78 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~~~~~~~~~   78 (289)
                      |||||| ||||++|+++|+++||+|++++|+...... ........+..|.. +...+...+.  ..|.|+|+|+.....
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~dl~-~~~~~~~~~~~~~~D~VihlAa~~~~~   79 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLNTGRIRFRFHEGDLT-DPDALERLLAEVQPDAVIHLAAQSGVG   79 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCEEEEEECC-CHHHHHHHHHHCCCCEEEECCCCCCCH
T ss_conf             7997289799999999999787989999899730122211467659996588-999999998538998999897747832


Q ss_pred             ----CE-----EECCCCCHHHHH--HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             ----10-----001221013443--2012334333320102576212345321123431134554455554320012345
Q gi|254780595|r   79 ----DP-----CIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN  147 (289)
Q Consensus        79 ----~~-----~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~  147 (289)
                          ++     .......+++..  ..+++++||+||.+|||...+.+++|++|+.|.++|+.+|..+|+.+..+.++++
T Consensus        80 ~~~~~~~~~~~~N~~~t~~ll~~~~~~~~~~~I~~SS~~vYg~~~~~~~~E~~~~~p~~~Y~~sK~~~E~~~~~~~~~~~  159 (235)
T pfam01370        80 ASFEDPAEFIRANVLGTLNLLEAARRAGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYAAAKLAGERLVLAYARAYG  159 (235)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             65519999999999999999999998399989992563574799999977777889850799999999999999999848


Q ss_pred             CCCCCCCCCCCCCCCCC----------HHHHHHCCCC--CCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEEC
Q ss_conf             67642034777789850----------3444311345--43222110001024777799999995135-5786162
Q gi|254780595|r  148 IKLAVLRLSGIYGPKRN----------PFIKIRQKNS--LRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNL  210 (289)
Q Consensus       148 ~~~~ilR~~~iyGp~r~----------~~~~~~~g~~--~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni  210 (289)
                      ++++++||+++|||++.          .+.++..+..  ..++.|.+.++|+|++|+|+++.++++++ .+++||+
T Consensus       160 ~~~~ilR~~~vyGp~~~~~~~~~~i~~~i~~~~~~~~~~~~~g~g~~~r~~i~v~D~~~ai~~~~~~~~~g~iyNI  235 (235)
T pfam01370       160 LRAVILRLFNVYGPGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVARAILLALEHPDGGEVYNI  235 (235)
T ss_pred             CCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCCEEECCCCHHHHHHHHHHHHCCCCCCCCEEC
T ss_conf             8986500125988998877621489999999982899727708999789179499999999999818999992429


No 19 
>KOG1429 consensus
Probab=100.00  E-value=6e-38  Score=236.04  Aligned_cols=275  Identities=17%  Similarity=0.182  Sum_probs=190.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHH-CCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             93999888-8889999999998898899996794463-45564-498289806786402346541156327876124443
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL-LTLKH-KGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~-~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      |||+|||+ ||||+||+++|..+||+|+++.--.... ..+.. .+.  ..++.... ......+..+|+|+|+|+|.+-
T Consensus        28 lrI~itGgaGFIgSHLvdkLm~egh~Via~Dn~ftg~k~n~~~~~~~--~~fel~~h-dv~~pl~~evD~IyhLAapasp  104 (350)
T KOG1429          28 LRILITGGAGFIGSHLVDKLMTEGHEVIALDNYFTGRKENLEHWIGH--PNFELIRH-DVVEPLLKEVDQIYHLAAPASP  104 (350)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHCCCCCCC--CCEEEEEE-ECHHHHHHHHHHHHHHCCCCCC
T ss_conf             07999657405889999999746877999831345521002100367--76358973-0024788877788642267787


Q ss_pred             C----CEE---ECCC---CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCC-----CCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             3----100---0122---1013443201233433332010257621234532-----11234311345544555543200
Q gi|254780595|r   78 G----DPC---IISM---SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH-----SFVHPISCVATQRFNAEKEWLAI  142 (289)
Q Consensus        78 ~----~~~---~~~~---~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~-----~~~~P~~~y~~~k~~~E~~~~~~  142 (289)
                      -    .+.   ..+.   ...+-.++..-+||+++||+.|||+....+.-|+     -|..|..+|...|..+|.++.+|
T Consensus       105 ~~y~~npvktIktN~igtln~lglakrv~aR~l~aSTseVYgdp~~hpq~e~ywg~vnpigpr~cydegKr~aE~L~~~y  184 (350)
T KOG1429         105 PHYKYNPVKTIKTNVIGTLNMLGLAKRVGARFLLASTSEVYGDPLVHPQVETYWGNVNPIGPRSCYDEGKRVAETLCYAY  184 (350)
T ss_pred             CCCCCCCCCEEEECCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             55235765056652222678889998737668986400004885568885553212687787234557788999999986


Q ss_pred             CCCCCCCCCCCCCCCCCCCC------CC---HHHHHHCCCC-CCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             12345676420347777898------50---3444311345-43222110001024777799999995135578616268
Q gi|254780595|r  143 TKKLNIKLAVLRLSGIYGPK------RN---PFIKIRQKNS-LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSD  212 (289)
Q Consensus       143 ~~~~~~~~~ilR~~~iyGp~------r~---~~~~~~~g~~-~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iyni~~  212 (289)
                      .++.|+.+.|.|++++|||.      |-   ...+..++.+ ..+++|.|.++|.||+|++++++++++.+..+.+|+++
T Consensus       185 ~k~~giE~rIaRifNtyGPrm~~~dgrvvsnf~~q~lr~epltv~g~G~qtRSF~yvsD~Vegll~Lm~s~~~~pvNiGn  264 (350)
T KOG1429         185 HKQEGIEVRIARIFNTYGPRMHMDDGRVVSNFIAQALRGEPLTVYGDGKQTRSFQYVSDLVEGLLRLMESDYRGPVNIGN  264 (350)
T ss_pred             HCCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCEEEEEEHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             30158279998432243776315797156899999852798699769831587786998999999986088767642699


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHH-CCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             43333899999999995579986343101256824465530694516899997-3984489999999999999751
Q gi|254780595|r  213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIE  287 (289)
Q Consensus       213 ~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~-lG~~p~~p~~~~gl~~~~~~~~  287 (289)
                      ++..|+.|+++.+.+..+-.. ..+...+....|  +     .++-|+.|+++ |||.|+- +++|||+.++.+..
T Consensus       265 p~e~Tm~elAemv~e~~~~~s-~i~~~~~~~Ddp--~-----kR~pDi~~ake~LgW~Pkv-~L~egL~~t~~~fr  331 (350)
T KOG1429         265 PGEFTMLELAEMVKELIGPVS-EIEFVENGPDDP--R-----KRKPDITKAKEQLGWEPKV-SLREGLPLTVTYFR  331 (350)
T ss_pred             CCCEEHHHHHHHHHHHCCCCC-CEEECCCCCCCC--C-----CCCCCHHHHHHHHCCCCCC-CHHHHHHHHHHHHH
T ss_conf             312219999999999717764-302247788873--2-----3586278999972888877-27776688999999


No 20 
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=100.00  E-value=2.2e-36  Score=227.10  Aligned_cols=275  Identities=16%  Similarity=0.170  Sum_probs=194.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHCCCEEEECCCCCCCHHHHHHH-CCCCEEEEEECCC---
Q ss_conf             3999888-888999999999889889999679-446345564498289806786402346541-1563278761244---
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRS-VSNLLTLKHKGISPFLFADQKINNLLREKL-YFTTHIVQCIKPS---   75 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~-~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~-~~~~~v~~~~~~~---   75 (289)
                      ||||||| |+||++|++.|.+.|..+.+++|+ +-+..      .+...+|..+.+......- ..-|.|||+++.+   
T Consensus         1 rilitGa~GQlG~~L~~~l~~~g~~~~~~~~~~~~~~~------~~~~~~Dl~dP~~l~~~~r~~~Pd~vvntAAYT~VD   74 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSKPGRVVVALTRSTRLKLA------ARWSQLDLTDPEALEELLRAIRPDAVVNTAAYTDVD   74 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCCCCCEEEEECCCCCCCHH------HHHHHHCCCCHHHHHHHHHHHCCCEEEECCHHCCCC
T ss_conf             97887387567999999707888278643687776113------365440622468899999852875376230110100


Q ss_pred             -CCCCEE-----ECCCCCHHHHHHHC-CCCCCCCCCEEECCC----CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             -433100-----01221013443201-233433332010257----6212345321123431134554455554320012
Q gi|254780595|r   76 -SEGDPC-----IISMSKDFYKFMPH-VKWIGYLSSTSIYGN----REGQWVDEHSFVHPISCVATQRFNAEKEWLAITK  144 (289)
Q Consensus        76 -~~~~~~-----~~~~~~~~~~~~~~-~~~~i~~SS~~VYg~----~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~  144 (289)
                       .+.++.     +.....++++.+.. --++||+||.+||..    .++.|..|++++||.+.||+||..+|.++++...
T Consensus        75 ~AE~~~~~AyavNa~A~~~lA~~A~~~Ga~~vh~STDYVFDGdfGG~~~~PY~e~D~~nPlnvYG~SK~~GE~a~~~~~~  154 (317)
T TIGR01214        75 GAESDPEKAYAVNALAPQNLARAAARVGARLVHISTDYVFDGDFGGEGKRPYREDDETNPLNVYGQSKLAGEQAVRAAGP  154 (317)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             00377778765740789999999986691599986342344755788866887646879843121115689999998379


Q ss_pred             CCCCCCCCCCCCCCCCC--C--CCH---HHHHH-CCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC---------CCCCC
Q ss_conf             34567642034777789--8--503---44431-13454322211000102477779999999513---------55786
Q gi|254780595|r  145 KLNIKLAVLRLSGIYGP--K--RNP---FIKIR-QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH---------HLGGI  207 (289)
Q Consensus       145 ~~~~~~~ilR~~~iyGp--~--r~~---~~~~~-~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~---------~~~~i  207 (289)
                      +.  ...|+|-+.+||-  +  +|.   |.++. ++...+-.-.||+-+.+|.+|+|+++..++++         +..||
T Consensus       155 ~e--~~lIvRTsWlY~~~g~~g~NF~~tMlrLaG~~~~~l~vV~DQ~GsPTy~~dLA~~~~~ll~~~~Wdv~~~a~~~Gv  232 (317)
T TIGR01214       155 DE--NALIVRTSWLYGAGGGSGRNFVKTMLRLAGKEREELRVVDDQIGSPTYAKDLARAIAALLERLNWDVEDAARARGV  232 (317)
T ss_pred             CC--CEEEEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCE
T ss_conf             98--5788985213448998842179999985378998403785576873589999999999997613340010136734


Q ss_pred             EECCCCCHHHHHHHHHHHHHHHCCCC-----C-CCCCCCCCCCCHHHHHHHCCCCEECHHHHHHCCCCC--CCCCHHHHH
Q ss_conf             16268433338999999999955799-----8-634310125682446553069451689999739844--899999999
Q gi|254780595|r  208 FNLSDDEPAPPQNVIMEAASLMKITP-----P-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL--LYPNYRISL  279 (289)
Q Consensus       208 yni~~~~~~s~~e~~~~i~~~~g~~~-----~-~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p--~~p~~~~gl  279 (289)
                      ||+++..-+||.||++.|.+.++...     + ...+....+ -|.+..+...| .+||.|+++.+.+|  +-|+|+++|
T Consensus       233 YH~~~~G~~SWyeFA~~If~~~~~~g~~~~~~~~v~Pis~~~-yp~pA~RPayS-~Ld~~~~~~~~g~P~~~lp~Wr~al  310 (317)
T TIGR01214       233 YHLANSGQVSWYEFAQAIFEVAGECGLLLKVPEEVKPISSKE-YPTPARRPAYS-VLDNTKLVKTLGKPLLVLPDWREAL  310 (317)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEECHHC-CCCCCCCCCCH-HHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             677505431368899999999985471048720001011320-77899886430-4456899996086667998789999


Q ss_pred             HHHHHHH
Q ss_conf             9999975
Q gi|254780595|r  280 KQLWKEI  286 (289)
Q Consensus       280 ~~~~~~~  286 (289)
                      +++++++
T Consensus       311 ~~~l~~~  317 (317)
T TIGR01214       311 RAVLKEA  317 (317)
T ss_pred             HHHHHCC
T ss_conf             9997409


No 21 
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=100.00  E-value=9.7e-36  Score=223.42  Aligned_cols=265  Identities=17%  Similarity=0.225  Sum_probs=177.6

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHH--CCCCEEEEEECCCC-
Q ss_conf             93999888-888999999999889889999679446345564498289806786402346541--15632787612444-
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL--YFTTHIVQCIKPSS-   76 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~v~~~~~~~~-   76 (289)
                      |||||||+ |++|++|.+.|...| ++.++.++....           ..|.. +...+...+  ...|.|+||++.+. 
T Consensus         1 MkILvtGa~GqLG~~l~~~l~~~~-~~~~~~~~~~~~-----------~~Dit-~~~~v~~~~~~~~Pd~IIN~aA~T~V   67 (299)
T PRK09987          1 MNILLFGKTGQVGWELQRALAPLG-NLIALDVHSTDY-----------CGDFS-NPEGVAETVRKIRPDVIVNAAAHTAV   67 (299)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCC-CEEEEECCCCCC-----------CCCCC-CHHHHHHHHHHCCCCEEEECHHHCCH
T ss_conf             979998999978999999866509-889985263001-----------36789-99999999996599999988310163


Q ss_pred             ---CCCE-----EECCCCCHHHHHHH-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             ---3310-----00122101344320-12334333320102576212345321123431134554455554320012345
Q gi|254780595|r   77 ---EGDP-----CIISMSKDFYKFMP-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN  147 (289)
Q Consensus        77 ---~~~~-----~~~~~~~~~~~~~~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~  147 (289)
                         +.++     ........++..+. .-.++||+||..||....+.+..|+++++|.+.||++|+++|+.++..+.++ 
T Consensus        68 D~~E~~~~~a~~vN~~~~~~La~~~~~~~~~lIhiSTD~VFdG~~~~pY~E~d~~~P~n~YG~sKl~GE~~v~~~~~~~-  146 (299)
T PRK09987         68 DKAESEPEFAQLLNATSVEAIAKAANEVGAWVVHYSTDYVFPGTGDIPWQETDATAPLNVYGETKLAGEKALQDNCAKH-  146 (299)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCE-
T ss_conf             6652489999998889999999999973985999632116068999899999988963689899999899999628740-


Q ss_pred             CCCCCCCCCCCCCCCC-CHHHH----HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC----C-CCCCCEECCCCCHHH
Q ss_conf             6764203477778985-03444----311345432221100010247777999999951----3-557861626843333
Q gi|254780595|r  148 IKLAVLRLSGIYGPKR-NPFIK----IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT----H-HLGGIFNLSDDEPAP  217 (289)
Q Consensus       148 ~~~~ilR~~~iyGp~r-~~~~~----~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~----~-~~~~iyni~~~~~~s  217 (289)
                         .|+|.+.+||+.+ +...+    ++.+....+ -.+|+.+.++++|+|+++..+++    + ...|+||+++.+.+|
T Consensus       147 ---~IlRtswl~~~~g~nFv~~il~~~~~~~~l~v-v~Dq~gsPT~~~~la~~~~~~i~~~~~~~~~~GiyH~~~~g~~S  222 (299)
T PRK09987        147 ---LIFRTSWVYAGKGNNFAKTMLRLAKEREELSV-INDQFGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTT  222 (299)
T ss_pred             ---EEEEEEEEECCCCCCHHHHHHHHHHCCCCCEE-ECCEECCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCC
T ss_conf             ---88514788647898799999999873998713-55745897469999999999999973587556715604998848


Q ss_pred             HHHHHHHHHHHH---CCCCCCC--CCCCCCC-CCHHHHHHHCCCCEECHHHHHH-CCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             899999999995---5799863--4310125-6824465530694516899997-39844899999999999997513
Q gi|254780595|r  218 PQNVIMEAASLM---KITPPLE--QCFDTAN-ISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       218 ~~e~~~~i~~~~---g~~~~~~--~~~~~~~-~~~~~~~~~~~~~~is~~kl~~-lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      +.||++.+.+..   |......  .+..... ..+..|+.   +..+++.|+++ +|+++  |+|+++|+++++++-+
T Consensus       223 ~yefA~~I~~~a~~~~~~~~~~~i~~i~s~~~~~~A~RP~---~s~Ld~~Ki~~~~gi~~--p~W~~~L~~~l~el~~  295 (299)
T PRK09987        223 WHDYAALVFEEARKAGITLALTKLNAVPTSAYPTPARRPH---NSRLNTEKFQRNFALVL--PDWQVGVKRMLTELFT  295 (299)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEEEEHHHCCCCCCCCC---CCCCCHHHHHHHHCCCC--CCHHHHHHHHHHHHHH
T ss_conf             9999999999999739975657047866654588899987---34267899998729999--6789999999999853


No 22 
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated
Probab=100.00  E-value=4.4e-35  Score=219.68  Aligned_cols=280  Identities=13%  Similarity=0.192  Sum_probs=206.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHH-CCCEEEEEECCHHHHH-HHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC---CC
Q ss_conf             3999888-8889999999998-8988999967944634-556449828980678640234654115632787612---44
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALK-VGVYTCGTTRSVSNLL-TLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK---PS   75 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~-~g~~V~~~~r~~~~~~-~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~---~~   75 (289)
                      ||||+|. ||||+||+++|++ .+|+|+|+.-...+.. .+.+...+++.+|..-..+.+......+|+|+-+++   |.
T Consensus       317 ~vlilgvngfig~hl~~~~l~~~~~~v~g~d~~~~~i~~~~~~p~~~f~~gdi~~~~~wie~~ikkcdvvlplvaiatp~  396 (660)
T PRK08125        317 RVLILGVNGFIGNHLTERLLRDDNYEVYGLDIGSDAISRFLGHPRFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPI  396 (660)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCEEEEEHHHCCHH
T ss_conf             79998344136789999985038858998865753455753499548881561466899998875457673205534747


Q ss_pred             CCCCEEE-------CCCCCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCC-CC--C----CCCHHHHHHHHHHHHHHH
Q ss_conf             4331000-------12210134432012334333320102576212345321-12--3----431134554455554320
Q gi|254780595|r   76 SEGDPCI-------ISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS-FV--H----PISCVATQRFNAEKEWLA  141 (289)
Q Consensus        76 ~~~~~~~-------~~~~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~-~~--~----P~~~y~~~k~~~E~~~~~  141 (289)
                      ....+.+       +...+.+..+.+.-||+||.||+.|||-..+..+||+. .+  .    +...|+-+|...|+.+.+
T Consensus       397 ~y~~~pl~vfeldfe~nl~ivr~c~ky~kriifpstsevygm~~d~~f~ed~s~li~gpi~~~RWiYs~sKqlldrvi~A  476 (660)
T PRK08125        397 EYTRNPLRVFELDFEENLKIIRYCVKYRKRIIFPSTSEVYGMCTDKYFDEDHSNLIVGPINKQRWIYSVSKQLLDRVIWA  476 (660)
T ss_pred             HHHCCCCEEEEECHHHCCHHHHHHHHHCCEEEECCHHHHCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             76348604787326755289999997487789656055101478867685556615677555435787789998899998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC---------------HHHHHHCCCCCCCCCCC-CEECCHHHHHHHHHHHHHHCCC--
Q ss_conf             01234567642034777789850---------------34443113454322211-0001024777799999995135--
Q gi|254780595|r  142 ITKKLNIKLAVLRLSGIYGPKRN---------------PFIKIRQKNSLRLVKKN-QVFNRIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       142 ~~~~~~~~~~ilR~~~iyGp~r~---------------~~~~~~~g~~~~~~~~~-~~~~~ihv~Dva~~i~~l~~~~--  203 (289)
                      |..+.|++.+++||++.+||+-+               .+..+.+|+++.+.+|+ |.++|++++|.+.|+..++++.  
T Consensus       477 yg~~~gL~ftlfRpFNw~GPrld~~~~~~~gs~r~itq~i~nl~~g~pi~lvdgG~QkR~Ft~I~Dgieal~~ii~n~~~  556 (660)
T PRK08125        477 YGEKEGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGAQKRCFTDIRDGIEALFRIIENRGN  556 (660)
T ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCEEEEEEEHHHHHHHHHHHHHCCCC
T ss_conf             77653994699801455588877555533477541999999997699856854873058887667799999999849455


Q ss_pred             --CCCCEECCCCC-HHHHHHHHHHHHHHHCCCCCCCCCCCC---CCCCHHHHHHHCCC------CE--ECHHHHHHCCCC
Q ss_conf             --57861626843-333899999999995579986343101---25682446553069------45--168999973984
Q gi|254780595|r  204 --LGGIFNLSDDE-PAPPQNVIMEAASLMKITPPLEQCFDT---ANISPFTRFFYADN------KR--ISNAKIKSLGFQ  269 (289)
Q Consensus       204 --~~~iyni~~~~-~~s~~e~~~~i~~~~g~~~~~~~~~~~---~~~~~~~~~~~~~~------~~--is~~kl~~lG~~  269 (289)
                        .+++||+++++ ..|.+++++.+-+.+...+ ....+.+   ..... ...||.++      ++  |+|++ +.|||+
T Consensus       557 ~~~g~I~NiGnp~n~~Si~~la~~l~~~~~~~~-~~~~~~~~~~~~~~~-s~~~YG~gYqDv~~R~P~i~~a~-~~l~w~  633 (660)
T PRK08125        557 RCDGQIINIGNPDNEASIRELAEMLLASFEKHP-LRDHFPPFAGFRVVE-SSSYYGKGYQDVEHRKPSIRNAR-RLLDWE  633 (660)
T ss_pred             CCCCEEEECCCCCCCEEHHHHHHHHHHHHHHCC-CCCCCCCCCCEEEEC-CCCCCCCCHHHHHHCCCCHHHHH-HHCCCC
T ss_conf             556606875899865239999999999997385-300065445536603-30123774255663488777898-754998


Q ss_pred             CCCCCHHHHHHHHHHH
Q ss_conf             4899999999999997
Q gi|254780595|r  270 LLYPNYRISLKQLWKE  285 (289)
Q Consensus       270 p~~p~~~~gl~~~~~~  285 (289)
                      |+. ++++++++++.-
T Consensus       634 P~~-~~~~~i~~tl~~  648 (660)
T PRK08125        634 PKI-AMQETIDETLDF  648 (660)
T ss_pred             CCC-CHHHHHHHHHHH
T ss_conf             777-289999999999


No 23 
>KOG1502 consensus
Probab=100.00  E-value=2.9e-34  Score=215.00  Aligned_cols=275  Identities=21%  Similarity=0.244  Sum_probs=191.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH------HHHHHHCC--CEEEECCCCCCCHHHHHHHCCCCEEEEE
Q ss_conf             93999888-888999999999889889999679446------34556449--8289806786402346541156327876
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN------LLTLKHKG--ISPFLFADQKINNLLREKLYFTTHIVQC   71 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~------~~~l~~~~--~~~~~~~~~~~~~~~~~~~~~~~~v~~~   71 (289)
                      |+|+|||| ||||+++++.|+.+||+|++++|++++      +..++..+  ...+ ..|..+...+...+.+++.|+|+
T Consensus         7 ~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~-~aDL~d~~sf~~ai~gcdgVfH~   85 (327)
T KOG1502           7 KKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLF-KADLLDEGSFDKAIDGCDGVFHT   85 (327)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCEEE-ECCCCCCCHHHHHHHCCCEEEEE
T ss_conf             27999488208999999999868998999970863056589998651575442588-52435513599997078789991


Q ss_pred             ECCCCCC---------CEEECCCCCHHHHHHH--CCCCCCCCCCEEEC-CC----CCCCCCCCCCCCCCC------CHHH
Q ss_conf             1244433---------1000122101344320--12334333320102-57----621234532112343------1134
Q gi|254780595|r   72 IKPSSEG---------DPCIISMSKDFYKFMP--HVKWIGYLSSTSIY-GN----REGQWVDEHSFVHPI------SCVA  129 (289)
Q Consensus        72 ~~~~~~~---------~~~~~~~~~~~~~~~~--~~~~~i~~SS~~VY-g~----~~g~~i~E~~~~~P~------~~y~  129 (289)
                      ++|-...         ++.+....+.+.++++  .+||+||+||++.- ..    .++..+||++=-.+.      .-|.
T Consensus        86 Asp~~~~~~~~e~~li~pav~Gt~nVL~ac~~~~sVkrvV~TSS~aAv~~~~~~~~~~~vvdE~~wsd~~~~~~~~~~Y~  165 (327)
T KOG1502          86 ASPVDFDLEDPEKELIDPAVKGTKNVLEACKKTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKLWYA  165 (327)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             76678777874776631788889999999860587226999614787114776788885456555781888876677889


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCH--------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             554455554320012345676420347777898503--------444311345432221100010247777999999951
Q gi|254780595|r  130 TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~--------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .+|..+|+..++++++.+++.+++-|+.|+||.-.+        +..+.+|.....  .+.++-+|||+|||.|-+.+++
T Consensus       166 ~sK~lAEkaAw~fa~e~~~~lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~~~~~--~n~~~~~VdVrDVA~AHv~a~E  243 (327)
T KOG1502         166 LSKTLAEKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKGLAETY--PNFWLAFVDVRDVALAHVLALE  243 (327)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHHHCCCCCC--CCCCEEEEEHHHHHHHHHHHHC
T ss_conf             99999999999999857961899668713797756665502999999870655457--8774346769998999999971


Q ss_pred             CC-CCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHHCC-CCCCCCCHHHHH
Q ss_conf             35-5786162684333389999999999557998634310125682446553069451689999739-844899999999
Q gi|254780595|r  202 HH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG-FQLLYPNYRISL  279 (289)
Q Consensus       202 ~~-~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~lG-~~p~~p~~~~gl  279 (289)
                      ++ .+|.|.|+++. .++.|++..+.+.+.... ........ ..+    +.. ...+++.|+++|| |+++  +++|.+
T Consensus       244 ~~~a~GRyic~~~~-~~~~ei~~~l~~~~P~~~-ip~~~~~~-~~~----~~~-~~~~~~~k~k~lg~~~~~--~l~e~~  313 (327)
T KOG1502         244 KPSAKGRYICVGEV-VSIKEIADILRELFPDYP-IPKKNAEE-HEG----FLT-SFKVSSEKLKSLGGFKFR--PLEETL  313 (327)
T ss_pred             CCCCCCEEEEECCC-CCHHHHHHHHHHHCCCCC-CCCCCCCC-CCC----CCC-CCCCCCHHHHHCCCCEEC--CHHHHH
T ss_conf             76668349995276-529999999998688877-78777765-665----543-333340888861563105--769999


Q ss_pred             HHHHHHHHC
Q ss_conf             999997513
Q gi|254780595|r  280 KQLWKEIEN  288 (289)
Q Consensus       280 ~~~~~~~~~  288 (289)
                      .+++++++.
T Consensus       314 ~dt~~sl~~  322 (327)
T KOG1502         314 SDTVESLRE  322 (327)
T ss_pred             HHHHHHHHH
T ss_conf             999999998


No 24 
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=2.1e-34  Score=215.81  Aligned_cols=261  Identities=17%  Similarity=0.231  Sum_probs=185.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHH--CCCCEEEEEECCCC-
Q ss_conf             93999888-888999999999889889999679446345564498289806786402346541--15632787612444-
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL--YFTTHIVQCIKPSS-   76 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~v~~~~~~~~-   76 (289)
                      |||||||+ |++|+.|++.|. .+++|++++|..               .|..+.+ .+...+  ...|.|+|+++... 
T Consensus         1 M~iLi~G~~GqLG~~L~~~l~-~~~~v~a~~~~~---------------~Ditd~~-~v~~~i~~~~PDvVIn~AAyt~v   63 (281)
T COG1091           1 MKILITGANGQLGTELRRALP-GEFEVIATDRAE---------------LDITDPD-AVLEVIRETRPDVVINAAAYTAV   63 (281)
T ss_pred             CCEEEECCCCHHHHHHHHHHC-CCCEEEECCCCC---------------CCCCCHH-HHHHHHHHHCCCEEEECCCCCCC
T ss_conf             958997698767999999717-784399515765---------------5556858-99999986199989987320365


Q ss_pred             ---CCCE-----EECCCCCHHHHHHHC-CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             ---3310-----001221013443201-2334333320102576212345321123431134554455554320012345
Q gi|254780595|r   77 ---EGDP-----CIISMSKDFYKFMPH-VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN  147 (289)
Q Consensus        77 ---~~~~-----~~~~~~~~~~~~~~~-~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~  147 (289)
                         +.++     +......++++.+.. --++||+||.+||...++.+..|+++++|.+.||++|+.+|..+.++...+ 
T Consensus        64 D~aE~~~e~A~~vNa~~~~~lA~aa~~~ga~lVhiSTDyVFDG~~~~~Y~E~D~~~P~nvYG~sKl~GE~~v~~~~~~~-  142 (281)
T COG1091          64 DKAESEPELAFAVNATGAENLARAAAEVGARLVHISTDYVFDGEKGGPYKETDTPNPLNVYGRSKLAGEEAVRAAGPRH-  142 (281)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCE-
T ss_conf             4133898997776779999999999971976999634457438989888778999970245477897899999739987-


Q ss_pred             CCCCCCCCCCCCCCCC-CH---HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEECCCCCHHHHHHHH
Q ss_conf             6764203477778985-03---44431134543222110001024777799999995135-5786162684333389999
Q gi|254780595|r  148 IKLAVLRLSGIYGPKR-NP---FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVI  222 (289)
Q Consensus       148 ~~~~ilR~~~iyGp~r-~~---~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni~~~~~~s~~e~~  222 (289)
                         .|+|.+.+||..+ +.   |.++.+....+..-.+|+.|.+|..|+|+++..++... .+++||++++..+|+.||+
T Consensus       143 ---~I~Rtswv~g~~g~nFv~tml~la~~~~~l~vv~Dq~gsPt~~~dlA~~i~~ll~~~~~~~~yH~~~~g~~Swydfa  219 (281)
T COG1091         143 ---LILRTSWVYGEYGNNFVKTMLRLAKEGKELKVVDDQYGSPTYTEDLADAILELLEKEKEGGVYHLVNSGECSWYEFA  219 (281)
T ss_pred             ---EEEEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCEEECCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHH
T ss_conf             ---99985655458887789999998505992699798453874699999999999834555867998079741199999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHH-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999995579986343101256824465530694516899997-398448999999999999975
Q gi|254780595|r  223 MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEI  286 (289)
Q Consensus       223 ~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~-lG~~p~~p~~~~gl~~~~~~~  286 (289)
                      +.+.+..+++.....+.... ..|++...... .++++.|+++ +|+.|  |+|+++++++++.+
T Consensus       220 ~~I~~~~~~~~~v~~~~~~~-~~~~~a~RP~~-S~L~~~k~~~~~~~~~--~~w~~~l~~~~~~~  280 (281)
T COG1091         220 KAIFEEAGVDGEVIEPIASA-EYPTPAKRPAN-SSLDTKKLEKAFGLSL--PEWREALKALLDEL  280 (281)
T ss_pred             HHHHHHHCCCCCCCCCCCCC-CCCCCCCCCCC-CCCCHHHHHHHHCCCC--CCHHHHHHHHHHHC
T ss_conf             99999838886414555622-36766789755-5425288999748898--25999999997331


No 25 
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI).
Probab=100.00  E-value=8.3e-34  Score=212.40  Aligned_cols=209  Identities=14%  Similarity=0.152  Sum_probs=150.9

Q ss_pred             EEEECC-CHHHHHHHHHHHHCC-CEEEEEECCHHHHHH--------HHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEE
Q ss_conf             999888-888999999999889-889999679446345--------5644982898067864023465411--5632787
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVG-VYTCGTTRSVSNLLT--------LKHKGISPFLFADQKINNLLREKLY--FTTHIVQ   70 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~--------l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~   70 (289)
                      |||||+ ||||++|+++|+++| +.|+++.++..+...        .....+..+..|..+ ...+.....  ++|.|+|
T Consensus         1 ILVTGGaGFIGS~Lv~~Ll~~g~~~v~v~d~~~~~~~~~~~~l~~~~~~~~~~~~~~DI~D-~~~l~~~~~~~~~D~V~H   79 (280)
T pfam02719         1 VLVTGGGGSIGSELCRQILKFNPKKIILFSRDEFKLYEIEQELREEYNDPKLRFFIGDVRD-RERLERAMEEYGVDTVFH   79 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCC-HHHHHHHHHHCCCCEEEE
T ss_conf             7997488679999999999689988999908874277899998862678983899811689-899999987549999998


Q ss_pred             EECCCC----CCCEE-----ECCCCCHHHH--HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             612444----33100-----0122101344--320123343333201025762123453211234311345544555543
Q gi|254780595|r   71 CIKPSS----EGDPC-----IISMSKDFYK--FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEW  139 (289)
Q Consensus        71 ~~~~~~----~~~~~-----~~~~~~~~~~--~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~  139 (289)
                      +|+-..    ..++.     ....+.+++.  ...+++++||+||..              .++|.++||.+|+.+|..+
T Consensus        80 lAA~~~V~~s~~~P~~~~~~Nv~gT~nlLe~a~~~~vk~~v~~STd~--------------a~~P~s~Yg~sK~~~E~l~  145 (280)
T pfam02719        80 AAALKHVPLVEYNPMEAIKTNVLGTENVAEAAIENGVEKFVLISTDK--------------AVNPTNVMGATKRLAEKLF  145 (280)
T ss_pred             CHHHCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCC--------------CCCCCCCCCCCHHHHHHHH
T ss_conf             10311653276699999988727779999888853962455147664--------------4569984542377789999


Q ss_pred             HHCCCCCCCC---CCCCCCCCCCCCCCC----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEECC
Q ss_conf             2001234567---642034777789850----344431134543222110001024777799999995135-57861626
Q gi|254780595|r  140 LAITKKLNIK---LAVLRLSGIYGPKRN----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLS  211 (289)
Q Consensus       140 ~~~~~~~~~~---~~ilR~~~iyGp~r~----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni~  211 (289)
                      ..|.+.++++   ++++|+++||||...    ...++.+|.+..+.+++|.+.|+||+|++++++.+++.. .|++||++
T Consensus       146 ~~y~~~~~~~~~~~~~lR~fNVyGprgsVIp~Fi~~~~~~~pi~I~dg~qtRdf~~V~D~v~~~l~a~~~~~~geifnig  225 (280)
T pfam02719       146 QAANRESGSGKTRFSAVRFGNVLGSRGSVIPLFKKQIAEGGPVTVTHPDMTRFFMTIPEAVQLVLQAGAMGKGGEIFVLD  225 (280)
T ss_pred             HHHHHHHCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCEEECCCCCEEEEEEHHHHHHHHHHHHHHCCCCCEEECC
T ss_conf             99999719998548987544502899770999999998599865659984385587999999999999728778678888


Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             843333899999999
Q gi|254780595|r  212 DDEPAPPQNVIMEAA  226 (289)
Q Consensus       212 ~~~~~s~~e~~~~i~  226 (289)
                      .++++++.|+++.+.
T Consensus       226 ~g~~~sI~dLAk~i~  240 (280)
T pfam02719       226 MGEPVKIVDLAKAMI  240 (280)
T ss_pred             CCCCEEHHHHHHHHC
T ss_conf             998669999999754


No 26 
>KOG1371 consensus
Probab=100.00  E-value=1.2e-32  Score=205.73  Aligned_cols=277  Identities=17%  Similarity=0.167  Sum_probs=194.8

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEE---C-CHH---HHHHHHH--CCCEEEECCCCCCCHHHHH--HHCCCCEE
Q ss_conf             93999888-8889999999998898899996---7-944---6345564--4982898067864023465--41156327
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTT---R-SVS---NLLTLKH--KGISPFLFADQKINNLLRE--KLYFTTHI   68 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~---r-~~~---~~~~l~~--~~~~~~~~~~~~~~~~~~~--~~~~~~~v   68 (289)
                      ++|||||+ ||||+|.+-+|+++|+.|+++.   | ...   +...+..  ..+..+..|..+. ..+.+  .....|+|
T Consensus         3 ~~VLVtGgaGyiGsht~l~L~~~gy~v~~vDNl~n~~~~sl~r~~~l~~~~~~v~f~~~Dl~D~-~~L~kvF~~~~fd~V   81 (343)
T KOG1371           3 KHVLVTGGAGYIGSHTVLALLKRGYGVVIVDNLNNSYLESLKRVRQLLGEGKSVFFVEGDLNDA-EALEKLFSEVKFDAV   81 (343)
T ss_pred             CEEEEECCCCCEEHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCH-HHHHHHHHHCCCCEE
T ss_conf             3799966876310599999986798179982433212467788998627877438998156689-999999863388657


Q ss_pred             EEEECCCC----------CCCEEECCCCCHHHHHH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCC-CCCHHHHHHHHHH
Q ss_conf             87612444----------33100012210134432-012334333320102576212345321123-4311345544555
Q gi|254780595|r   69 VQCIKPSS----------EGDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVH-PISCVATQRFNAE  136 (289)
Q Consensus        69 ~~~~~~~~----------~~~~~~~~~~~~~~~~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~-P~~~y~~~k~~~E  136 (289)
                      +|.++-..          ..+..+..+.+.+...+ .+++.++|.||++|||....-+++|++|.. |.++|+.+|...|
T Consensus        82 ~Hfa~~~~vgeS~~~p~~Y~~nNi~gtlnlLe~~~~~~~~~~V~sssatvYG~p~~vp~te~~~t~~p~~pyg~tK~~iE  161 (343)
T KOG1371          82 MHFAALAAVGESMENPLSYYHNNIAGTLNLLEVMKAHNVKALVFSSSATVYGLPTKVPITEEDPTDQPTNPYGKTKKAIE  161 (343)
T ss_pred             EEEHHHHCCCHHHHCCHHHEEHHHHHHHHHHHHHHHCCCCEEEEECCEEEECCCCEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             76244413315662822310021146899999999759864888423046347643203576877888886401367799


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCC--C-CC----------CHHHHHH------------CCCCCCCCCCCCEECCHHHHH
Q ss_conf             543200123456764203477778--9-85----------0344431------------134543222110001024777
Q gi|254780595|r  137 KEWLAITKKLNIKLAVLRLSGIYG--P-KR----------NPFIKIR------------QKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       137 ~~~~~~~~~~~~~~~ilR~~~iyG--p-~r----------~~~~~~~------------~g~~~~~~~~~~~~~~ihv~D  191 (289)
                      +.+..+....++.+++||.++++|  | ||          +.+....            -|......+|++.+..||+-|
T Consensus       162 ~i~~d~~~~~~~~~~~LRyfn~~ga~p~Gr~ge~p~~~~nnl~p~v~~vaigr~~~l~v~g~d~~t~dgt~vrdyi~v~D  241 (343)
T KOG1371         162 EIIHDYNKAYGWKVTGLRYFNVIGAHPSGRIGEAPLGIPNNLLPYVFQVAIGRRPNLQVVGRDYTTIDGTIVRDYIHVLD  241 (343)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEEECCCCCCCCCCEEECCEEEEE
T ss_conf             97676531456047998842556766546778887667565340133000023245254047660217971123220166


Q ss_pred             HHHHHHHHHCCC----CCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHH-HHC
Q ss_conf             799999995135----578616268433338999999999955799863431012568244655306945168999-973
Q gi|254780595|r  192 VARCVIFLMTHH----LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSL  266 (289)
Q Consensus       192 va~~i~~l~~~~----~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl-~~l  266 (289)
                      .|.+-..++.+.    .-++||++++.+.+..+++...+++.|+..|....-  .. .+.....+     -+.++. +||
T Consensus       242 la~~h~~al~k~~~~~~~~i~Nlgtg~g~~V~~lv~a~~k~~g~~~k~~~v~--~R-~gdv~~~y-----a~~~~a~~el  313 (343)
T KOG1371         242 LADGHVAALGKLRGAAEFGVYNLGTGKGSSVLELVTAFEKALGVKIKKKVVP--RR-NGDVAFVY-----ANPSKAQREL  313 (343)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCC--CC-CCCCEEEE-----ECHHHHHHHH
T ss_conf             4778898764200000034576047888229999999998755798720037--78-99841465-----1747899984


Q ss_pred             CCCCCCCCHHHHHHHHHHHHH
Q ss_conf             984489999999999999751
Q gi|254780595|r  267 GFQLLYPNYRISLKQLWKEIE  287 (289)
Q Consensus       267 G~~p~~p~~~~gl~~~~~~~~  287 (289)
                      ||+|.+ +++|+++++|++-.
T Consensus       314 gwk~~~-~iee~c~dlw~W~~  333 (343)
T KOG1371         314 GWKAKY-GLQEMLKDLWRWQK  333 (343)
T ss_pred             CCCCCC-CHHHHHHHHHHHHH
T ss_conf             886423-89999999999875


No 27 
>KOG1430 consensus
Probab=99.97  E-value=2.5e-30  Score=192.56  Aligned_cols=285  Identities=17%  Similarity=0.197  Sum_probs=188.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC--CEEEEEECCHHHH--HHH-H--HCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888-888999999999889--8899996794463--455-6--449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG--VYTCGTTRSVSNL--LTL-K--HKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~~~~--~~l-~--~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      .++|||+ ||+|++|+++|++.+  .+++.+...+...  ... .  ..+...+...|..+...+.....++ .|+||++
T Consensus         6 ~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~~~~~~~e~~~~~~~~v~~~~~D~~~~~~i~~a~~~~-~Vvh~aa   84 (361)
T KOG1430           6 SVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPTQSNLPAELTGFRSGRVTVILGDLLDANSISNAFQGA-VVVHCAA   84 (361)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHHCCCC-EEEEECC
T ss_conf             799989833789999999984566617999536775556514553346774368722300005566521576-0787516


Q ss_pred             CC-CC-----C---CEEECCCCCHHHHHH--HCCCCCCCCCCEEECCCCCC-CCCCCCCC--CCCCCHHHHHHHHHHHHH
Q ss_conf             44-43-----3---100012210134432--01233433332010257621-23453211--234311345544555543
Q gi|254780595|r   74 PS-SE-----G---DPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREG-QWVDEHSF--VHPISCVATQRFNAEKEW  139 (289)
Q Consensus        74 ~~-~~-----~---~~~~~~~~~~~~~~~--~~~~~~i~~SS~~VYg~~~g-~~i~E~~~--~~P~~~y~~~k~~~E~~~  139 (289)
                      .. ..     .   ..+....+.++.+.+  .+++++||+||.+|+..... ...||+.|  .++..+|+.+|..+|+.+
T Consensus        85 ~~~~~~~~~~~~~~~~vNV~gT~nvi~~c~~~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~p~~~~d~Y~~sKa~aE~~V  164 (361)
T KOG1430          85 SPVPDFVENDRDLAMRVNVNGTLNVIEACKELGVKRLIYTSSAYVVFGGEPIINGDESLPYPLKHIDPYGESKALAEKLV  164 (361)
T ss_pred             CCCCCCCCCCHHHHEEECCHHHHHHHHHHHHHCCCEEEEECCCEEEECCEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             56752023561252141405089999999982987899946742886883545577787875545543325899999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCH-----HHHHHCCCCC-CCCCCCCEECCHHHHHHHHHHHH----HHCCC---CCC
Q ss_conf             20012345676420347777898503-----4443113454-32221100010247777999999----95135---578
Q gi|254780595|r  140 LAITKKLNIKLAVLRLSGIYGPKRNP-----FIKIRQKNSL-RLVKKNQVFNRIRVEDVARCVIF----LMTHH---LGG  206 (289)
Q Consensus       140 ~~~~~~~~~~~~ilR~~~iyGp~r~~-----~~~~~~g~~~-~~~~~~~~~~~ihv~Dva~~i~~----l~~~~---~~~  206 (289)
                      ++.+...++.+++|||++|||||...     ...+++|... .++++..+.+++|++.++.+.+.    +..+.   .|+
T Consensus       165 l~an~~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~~aL~~~~~~~~Gq  244 (361)
T KOG1430         165 LEANGSDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAARALLDKSPSVNGQ  244 (361)
T ss_pred             HHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCEEEECHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             98569987158997034111799752047899999806851786056641022880232799998899887148766850


Q ss_pred             CEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC------CC--------C-------CHHHHHHHCCCCEECHHHHH-
Q ss_conf             61626843333899999999995579986343101------25--------6-------82446553069451689999-
Q gi|254780595|r  207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT------AN--------I-------SPFTRFFYADNKRISNAKIK-  264 (289)
Q Consensus       207 iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~------~~--------~-------~~~~~~~~~~~~~is~~kl~-  264 (289)
                      +|+|+|++|+...++...+.+.+|...|....+..      ..        +       .+............+..|++ 
T Consensus       245 ~yfI~d~~p~~~~~~~~~l~~~lg~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p~~p~lt~~~v~~~~~~~~f~~~kA~~  324 (361)
T KOG1430         245 FYFITDDTPVRFFDFLSPLVKALGYCLPSSIKLPLFLSYFLAYLLEIVYFLLRPYQPILTRFRVALLGVTRTFSIEKAKR  324 (361)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEEECCCCCCCHHHHHH
T ss_conf             89986898120368889998843999875564435899999999999998606778775766722311445507899877


Q ss_pred             HCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             739844899999999999997513
Q gi|254780595|r  265 SLGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       265 ~lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      +|||+|.. +++++.+.++.+..+
T Consensus       325 ~lgY~P~~-~~~e~~~~~~~~~~~  347 (361)
T KOG1430         325 ELGYKPLV-SLEEAIQRTIHWVAS  347 (361)
T ss_pred             HHCCCCCC-CHHHHHHHHHHHHHH
T ss_conf             62899867-878989999998734


No 28 
>CHL00194 ycf39 Ycf39; Provisional
Probab=99.97  E-value=2.7e-30  Score=192.36  Aligned_cols=213  Identities=16%  Similarity=0.179  Sum_probs=161.6

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC-C
Q ss_conf             93999888-888999999999889889999679446345564498289806786402346541156327876124443-3
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE-G   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~-~   78 (289)
                      |+|||||| |++|+.++++|+++||+|++++|++++...+...|++.+.+|. .+...+...+.+++.|+++...... .
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v~gDl-~dpesl~~Al~GvdaVi~~~~~~~~~~   79 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELVYGDL-SLPETIPPALEGITAIIDASTSRPSDL   79 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECC-CCHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             9799989985899999999996889089995786763234215967999427-887789999659967999456677886


Q ss_pred             CEE---ECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             100---012210134--432012334333320102576212345321123431134554455554320012345676420
Q gi|254780595|r   79 DPC---IISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL  153 (289)
Q Consensus        79 ~~~---~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~il  153 (289)
                      ...   ......++.  +...+++||||+|+.++         +    ..|..+|..+|.+.|+.+    ++.|++++|+
T Consensus        80 ~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga---------~----~~~~~p~~~~K~~~E~~L----~~Sgl~~TIl  142 (319)
T CHL00194         80 NNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNA---------E----QYPQVPLMKIKSDIEEKL----KQSGINYTIF  142 (319)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC---------C----CCCCCHHHHHHHHHHHHH----HHCCCCEEEE
T ss_conf             2088988988999999999849988999613566---------6----688756778799999999----8679985998


Q ss_pred             CCCCCCCCCCCHHHH----HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHHHHHHH
Q ss_conf             347777898503444----31134543222110001024777799999995135--578616268433338999999999
Q gi|254780595|r  154 RLSGIYGPKRNPFIK----IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAAS  227 (289)
Q Consensus       154 R~~~iyGp~r~~~~~----~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~~~i~~  227 (289)
                      ||+++|.   +.+.+    +..+.+..+..++..+++|+++|+|+++..+++++  .+++|.+++++..|.+|+++.+.+
T Consensus       143 RPs~F~q---~l~~~~a~pi~~~~~v~~~~~~~~ia~I~~~DVA~~~a~aL~~~~~~gk~y~L~GP~a~T~~EIa~l~~~  219 (319)
T CHL00194        143 RLAGFFQ---GLISQYAIPILDSQTIWITGESTPIAYIDTQDAAKFALKSLSLPETKNKTFPLVGPKSWNSSEIISLCEQ  219 (319)
T ss_pred             CCHHHHH---HHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             4739999---8899876776307857766998752887799999999999589775898999549863899999999999


Q ss_pred             HHCCCCC
Q ss_conf             9557998
Q gi|254780595|r  228 LMKITPP  234 (289)
Q Consensus       228 ~~g~~~~  234 (289)
                      ..|++.+
T Consensus       220 ~~Gk~~~  226 (319)
T CHL00194        220 LSGQKAK  226 (319)
T ss_pred             HHCCCCC
T ss_conf             8599987


No 29 
>PRK07201 short chain dehydrogenase; Provisional
Probab=99.97  E-value=2e-28  Score=181.67  Aligned_cols=229  Identities=17%  Similarity=0.139  Sum_probs=161.8

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHC-CCEEEEEECCHH--HHHH----HHHCCCEEEECCCCC-----CCHHHHHHHCCCCE
Q ss_conf             93999888-88899999999988-988999967944--6345----564498289806786-----40234654115632
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKV-GVYTCGTTRSVS--NLLT----LKHKGISPFLFADQK-----INNLLREKLYFTTH   67 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~-g~~V~~~~r~~~--~~~~----l~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~   67 (289)
                      |++|+||| ||||++|.++|+++ +.+|++++|...  +...    .....+.++.+|...     ....+......+|+
T Consensus         1 mnyflTGaTGFLG~~LL~~LL~~~~a~V~cLVR~~s~~r~~~~~~~~~~~Rv~~v~GDL~~p~LGLs~~~~~~La~~vd~   80 (663)
T PRK07201          1 MRYFVTGGTGFIGRRLVSRLLDRPGARVHVLVRRQSLGRFERLAEYWGVDRVVPVVGDLTAPELGLSAETIAELKGKIDH   80 (663)
T ss_pred             CCEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCCE
T ss_conf             93654068428899999999848999899997877499999999974898879946777876789599999999674899


Q ss_pred             EEEEECCC------CCCCEEECCCCCHHHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCC---CCHHHHHHHHHH
Q ss_conf             78761244------433100012210134432--0123343333201025762123453211234---311345544555
Q gi|254780595|r   68 IVQCIKPS------SEGDPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHP---ISCVATQRFNAE  136 (289)
Q Consensus        68 v~~~~~~~------~~~~~~~~~~~~~~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P---~~~y~~~k~~~E  136 (289)
                      |+|+++--      ..........++++++..  .+.++|.|+||.+|.|...|. +.|+..-.+   .++|.++|+.+|
T Consensus        81 I~H~aA~v~~~~~y~~~~~~NV~GTr~vL~LA~~~~~~~~h~vST~~VaG~~~g~-~~Ed~~d~~~~l~~~Y~qSK~~AE  159 (663)
T PRK07201         81 FFHLAAVYDLTADEESQRAANVEGTRAAIELAERLDAGTFHHVSSIAVAGLFEGV-FREDMFDEAQDLPTPYHRTKFEAE  159 (663)
T ss_pred             EEECCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECEECCCCCCC-CCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             9989823578899899765212999999999984799747999637453688987-544445444668996165899999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCC----C----------HHHHHHCCCC---CCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             543200123456764203477778985----0----------3444311345---4322211000102477779999999
Q gi|254780595|r  137 KEWLAITKKLNIKLAVLRLSGIYGPKR----N----------PFIKIRQKNS---LRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       137 ~~~~~~~~~~~~~~~ilR~~~iyGp~r----~----------~~~~~~~g~~---~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      +++++   ..|+|++|.||+.|.|..+    +          .+.+++...+   +.++..+-.+|.+.||-|++++.++
T Consensus       160 ~lVr~---a~glP~~IyRPg~V~GdS~TG~~~k~Dgpy~~~~ll~~l~~~~p~~~P~~~~~~~~~n~vPVDfV~~Ai~~L  236 (663)
T PRK07201        160 KLVRE---ECGLPWRIYRPAVVVGDSRTGEMDKIDGPYYFFKVIQKLRAVLPSWTPMLGPEGGRTNIVPVDYVVDALDHL  236 (663)
T ss_pred             HHHHH---CCCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECHHHHHHHHHHH
T ss_conf             99997---489987998085762366567644664078999999999863655456667777732251166799999999


Q ss_pred             HCCC--CCCCEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             5135--578616268433338999999999955799
Q gi|254780595|r  200 MTHH--LGGIFNLSDDEPAPPQNVIMEAASLMKITP  233 (289)
Q Consensus       200 ~~~~--~~~iyni~~~~~~s~~e~~~~i~~~~g~~~  233 (289)
                      ..++  .+.+||++|++|++..++++..++..+.+.
T Consensus       237 s~~~~~~g~~fHL~dP~p~~~~~v~~~~a~~~~~p~  272 (663)
T PRK07201        237 AHADGRDGQTFHLTDPKPYRVGDIYNIFAEAAGAPR  272 (663)
T ss_pred             HCCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             559887886787059998638999999887338975


No 30 
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=99.94  E-value=4.3e-26  Score=168.40  Aligned_cols=213  Identities=15%  Similarity=0.138  Sum_probs=151.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHC--CCEEEEEECCHHHHHHHH----HCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             3999888-88899999999988--988999967944634556----4498289806786402346541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKV--GVYTCGTTRSVSNLLTLK----HKGISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~--g~~V~~~~r~~~~~~~l~----~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      +|||||+ ||||++|+++|+++  ...++.++|+..+...+.    ...+..+.+|.. +...+.....++|.|+|+|+.
T Consensus         6 ~ILVTGGaGfIGS~lv~~Ll~~~~~~~iii~~~de~~~~~l~~~~~~~~i~f~~gDIr-D~~~l~~~~~~vD~VfHaAA~   84 (324)
T TIGR03589         6 SILITGGTGSFGKAFISRLLENYNPKKIIIYSRDELKQWEMQQKFPAPCLRFFIGDVR-DKERLTRALRGVDYVVHAAAL   84 (324)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCEEEEECCCC-CHHHHHHHHCCCCEEEECCCC
T ss_conf             9999079779999999999972998289996686403288985168987599967777-889999763488899994627


Q ss_pred             ----CCCCCEE-----ECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH---
Q ss_conf             ----4433100-----012210134--43201233433332010257621234532112343113455445555432---
Q gi|254780595|r   75 ----SSEGDPC-----IISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWL---  140 (289)
Q Consensus        75 ----~~~~~~~-----~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~---  140 (289)
                          ....++.     ....+.+++  +...+++++||+||.-+              .+|.++||.+|+.+|+.+.   
T Consensus        85 khVp~se~nP~e~i~tNV~Gt~nlleaa~~~~Vkk~V~iSTDka--------------~~P~n~yGasK~~~E~l~~~~~  150 (324)
T TIGR03589        85 KQVPAAEYNPFECIRTNINGAQNVIDAAIDNGVKRVVALSTDKA--------------ANPINLYGATKLASDKLFVAAN  150 (324)
T ss_pred             CCCCHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC--------------CCCCCCCCCCHHHHHHHHHHHH
T ss_conf             76726776989999999799999999988555431786226888--------------8996743123676799999999


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCH----HHHHHCC-CCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEECCCCC
Q ss_conf             0012345676420347777898503----4443113-4543222110001024777799999995135-57861626843
Q gi|254780595|r  141 AITKKLNIKLAVLRLSGIYGPKRNP----FIKIRQK-NSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDE  214 (289)
Q Consensus       141 ~~~~~~~~~~~ilR~~~iyGp~r~~----~~~~~~g-~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni~~~~  214 (289)
                      .+....+++.+++|+++||||....    ..++.+| .+..+.++.+.+-|++++|++++++.+++.. .|++|-. .-.
T Consensus       151 ~~~~~~~~~~~~vRygNV~gsrgSViP~F~~qi~~g~~~~~itd~~mtRf~mtv~dav~lV~~a~~~~~~GEifv~-k~~  229 (324)
T TIGR03589       151 NISGSKGTRFSVVRYGNVVGSRGSVVPFFKSLKEEGVTELPITDPRMTRFWITLEQGVNFVLKSLERMLGGEIFVP-KIP  229 (324)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCEEEEC-CCC
T ss_conf             8507888637886332751888663999999998399974449998079988899999999999982889849983-697


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             3338999999999955
Q gi|254780595|r  215 PAPPQNVIMEAASLMK  230 (289)
Q Consensus       215 ~~s~~e~~~~i~~~~g  230 (289)
                      ++++.|+++.++.-..
T Consensus       230 s~~i~dla~~~~~~~~  245 (324)
T TIGR03589       230 SMKITDLAEAMAPECP  245 (324)
T ss_pred             CCHHHHHHHHHHCCCC
T ss_conf             0259999998604698


No 31 
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]
Probab=99.93  E-value=1.2e-24  Score=160.19  Aligned_cols=277  Identities=15%  Similarity=0.092  Sum_probs=193.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH--HHH--HHHHCC------CEEEECCCCCCCHHHHHHH--CCCCEEE
Q ss_conf             999888-88899999999988988999967944--634--556449------8289806786402346541--1563278
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS--NLL--TLKHKG------ISPFLFADQKINNLLREKL--YFTTHIV   69 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~--~~~--~l~~~~------~~~~~~~~~~~~~~~~~~~--~~~~~v~   69 (289)
                      -||||- |+-|++|++.|+++|++|+|+.|...  +..  .|...+      +..+.+ |..+...+...+  ...|-|.
T Consensus         5 ALITGITGQDGsYLa~lLLekGY~VhGi~Rrss~~n~~ri~L~~~~~~~~~~l~l~~g-DLtD~~~l~r~l~~v~PdEIY   83 (345)
T COG1089           5 ALITGITGQDGSYLAELLLEKGYEVHGIKRRSSSFNTPRIHLYEDPHLNDPRLHLHYG-DLTDSSNLLRILEEVQPDEIY   83 (345)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHCCCCCCCCEEEEEEC-CCCCHHHHHHHHHHCCCHHHE
T ss_conf             9995445875389999998569489878603355776530111165557861799965-543568899999860944533


Q ss_pred             EEECCCC----CCCEEE------CCCCCHHHHHH---HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             7612444----331000------12210134432---0123343333201025762123453211234311345544555
Q gi|254780595|r   70 QCIKPSS----EGDPCI------ISMSKDFYKFM---PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        70 ~~~~~~~----~~~~~~------~~~~~~~~~~~---~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      ++++.+.    ...+.+      ....+.+.+.+   ....||-.+||+..||.....+.+|++|+.|.+||+.+|+-+-
T Consensus        84 NLaAQS~V~vSFe~P~~T~~~~~iGtlrlLEaiR~~~~~~~rfYQAStSE~fG~v~~~pq~E~TPFyPrSPYAvAKlYa~  163 (345)
T COG1089          84 NLAAQSHVGVSFEQPEYTADVDAIGTLRLLEAIRILGEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKLYAY  163 (345)
T ss_pred             ECCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCEEEECCCHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             03432345530358640253100678899999997487660799656177606766675446899988977889998777


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCC----------HHHHHHCCCCCCC--CCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             5432001234567642034777789850----------3444311345432--221100010247777999999951355
Q gi|254780595|r  137 KEWLAITKKLNIKLAVLRLSGIYGPKRN----------PFIKIRQKNSLRL--VKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       137 ~~~~~~~~~~~~~~~ilR~~~iyGp~r~----------~~~~~~~g~~~~~--~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      .....|-+.+|+-+|.-.+++-=+|.|.          ...+++.|..-.+  ++-+..+.|=|..|-++++..++.++.
T Consensus       164 W~tvNYResYgl~AcnGILFNHESP~Rge~FVTRKIt~ava~Ik~G~q~~l~lGNldAkRDWG~A~DYVe~mwlmLQq~~  243 (345)
T COG1089         164 WITVNYRESYGLFACNGILFNHESPLRGETFVTRKITRAVARIKLGLQDKLYLGNLDAKRDWGHAKDYVEAMWLMLQQEE  243 (345)
T ss_pred             HEEEEHHHHCCCEEECCEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             60301476347334311443378987753103389999999987066126874363310234316789999999974479


Q ss_pred             CCCEECCCCCHHHHHHHHHHHHHHHCCCCC-----------------CCCCCCCCCCCHHHHHHHCCCCEECHHHHH-HC
Q ss_conf             786162684333389999999999557998-----------------634310125682446553069451689999-73
Q gi|254780595|r  205 GGIFNLSDDEPAPPQNVIMEAASLMKITPP-----------------LEQCFDTANISPFTRFFYADNKRISNAKIK-SL  266 (289)
Q Consensus       205 ~~iyni~~~~~~s~~e~~~~i~~~~g~~~~-----------------~~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~l  266 (289)
                      ..-|+++.++.-|.+||++...+.+|+...                 ..+.+++....|....+..    =+.+|++ +|
T Consensus       244 PddyViATg~t~sVrefv~~Af~~~g~~l~w~g~g~~e~g~da~tG~~~V~idp~~fRPaEVd~Ll----gdp~KA~~~L  319 (345)
T COG1089         244 PDDYVIATGETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIVEIDPRYFRPAEVDLLL----GDPTKAKEKL  319 (345)
T ss_pred             CCCEEEECCCEEEHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHC----CCHHHHHHHC
T ss_conf             984488527522399999999997085588730355311312456752699870106831255652----8878989970


Q ss_pred             CCCCCCCCHHHHHHHHHHH
Q ss_conf             9844899999999999997
Q gi|254780595|r  267 GFQLLYPNYRISLKQLWKE  285 (289)
Q Consensus       267 G~~p~~p~~~~gl~~~~~~  285 (289)
                      ||+|++ +|+|=++.|++.
T Consensus       320 GW~~~~-~~~elv~~Mv~~  337 (345)
T COG1089         320 GWRPEV-SLEELVREMVEA  337 (345)
T ss_pred             CCCCCC-CHHHHHHHHHHH
T ss_conf             996666-799999999999


No 32 
>KOG1431 consensus
Probab=99.93  E-value=9.8e-25  Score=160.63  Aligned_cols=265  Identities=16%  Similarity=0.119  Sum_probs=182.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             93999888-8889999999998898--89999679446345564498289806786402346541156327876124443
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGV--YTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~--~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      |||||||. |.+|+++.+.+..+|.  +=..+..+.+           ..+- ...+.+.+.. -....+|+|+++--+.
T Consensus         2 ~kIlVtGg~GLVGsAi~~vv~~q~~~~e~wvf~~skd-----------~DLt-~~a~t~~lF~-~ekPthVIhlAAmVGG   68 (315)
T KOG1431           2 KKILVTGGTGLVGSAIVKVVQEQGFDDENWVFIGSKD-----------ADLT-NLADTRALFE-SEKPTHVIHLAAMVGG   68 (315)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEECCCC-----------CCCC-CHHHHHHHHH-CCCCCEEEEHHHHHCC
T ss_conf             5599936874178999999985388876569951554-----------4531-3688999984-0487000106766430


Q ss_pred             -C-------C--EEECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCC----CCCCCCH-HHHHHHHHHHHHH
Q ss_conf             -3-------1--00012210134--432012334333320102576212345321----1234311-3455445555432
Q gi|254780595|r   78 -G-------D--PCIISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHS----FVHPISC-VATQRFNAEKEWL  140 (289)
Q Consensus        78 -~-------~--~~~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~----~~~P~~~-y~~~k~~~E~~~~  140 (289)
                       .       |  ........+..  +....+++++++-|+.+|++....||+|..    |++|.+. |+..|..+.-+-.
T Consensus        69 lf~N~~ynldF~r~Nl~indNVlhsa~e~gv~K~vsclStCIfPdkt~yPIdEtmvh~gpphpsN~gYsyAKr~idv~n~  148 (315)
T KOG1431          69 LFHNNTYNLDFIRKNLQINDNVLHSAHEHGVKKVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNFGYSYAKRMIDVQNQ  148 (315)
T ss_pred             HHHCCCCCHHHHHHCCEECHHHHHHHHHHCHHHHHHHCCEEECCCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             44147785677764014140587888870605644413534468888888877886159999873089999999877778


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCC-------HHH----HH----HCCC--CCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             001234567642034777789850-------344----43----1134--543222110001024777799999995135
Q gi|254780595|r  141 AITKKLNIKLAVLRLSGIYGPKRN-------PFI----KI----RQKN--SLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       141 ~~~~~~~~~~~ilR~~~iyGp~r~-------~~~----~~----~~g~--~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      +|..++|..++..-|.++|||..+       .+.    |+    ++|.  ...++.|...+.|||++|+|+++++++.+-
T Consensus       149 aY~~qhg~~~tsviPtNvfGphDNfnpe~sHVlPali~r~h~ak~~gtd~~~VwGsG~PlRqFiys~DLA~l~i~vlr~Y  228 (315)
T KOG1431         149 AYRQQHGRDYTSVIPTNVFGPHDNFNPENSHVLPALIHRFHEAKRNGTDELTVWGSGSPLRQFIYSDDLADLFIWVLREY  228 (315)
T ss_pred             HHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998387123002344538877788343531299999999987458844899538980788756767999999999863


Q ss_pred             -CCCCEECCCCC--HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHH
Q ss_conf             -57861626843--333899999999995579986343101256824465530694516899997398448999999999
Q gi|254780595|r  204 -LGGIFNLSDDE--PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLK  280 (289)
Q Consensus       204 -~~~iyni~~~~--~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~  280 (289)
                       --+..|++.++  .+|++|.++.+.++++..  ..+.++..+.....+      |..||+||+.|+|.|++..|++|+.
T Consensus       229 ~~vEpiils~ge~~EVtI~e~aeaV~ea~~F~--G~l~~DttK~DGq~k------KtasnsKL~sl~pd~~ft~l~~ai~  300 (315)
T KOG1431         229 EGVEPIILSVGESDEVTIREAAEAVVEAVDFT--GKLVWDTTKSDGQFK------KTASNSKLRSLLPDFKFTPLEQAIS  300 (315)
T ss_pred             CCCCCEEECCCCCCEEEHHHHHHHHHHHHCCC--CEEEEECCCCCCCCC------CCCCHHHHHHHCCCCCCCHHHHHHH
T ss_conf             57554573168653367999999999982877--527863358898710------0135577998489866683899999


Q ss_pred             HHHHHH
Q ss_conf             999975
Q gi|254780595|r  281 QLWKEI  286 (289)
Q Consensus       281 ~~~~~~  286 (289)
                      +..++.
T Consensus       301 ~t~~Wy  306 (315)
T KOG1431         301 ETVQWY  306 (315)
T ss_pred             HHHHHH
T ss_conf             999999


No 33 
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase. Members of this protein family are L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31), product of the LYS2 gene. It is also called alpha-aminoadipate reductase. In fungi, lysine is synthesized via aminoadipate. Currently, all members of this family are fungal.
Probab=99.92  E-value=2.9e-24  Score=157.92  Aligned_cols=231  Identities=14%  Similarity=0.094  Sum_probs=156.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHC----CCEEEEEECCHHHHH---HHH-------------HCCCEEEECCCCCC-----C
Q ss_conf             3999888-88899999999988----988999967944634---556-------------44982898067864-----0
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKV----GVYTCGTTRSVSNLL---TLK-------------HKGISPFLFADQKI-----N   55 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~----g~~V~~~~r~~~~~~---~l~-------------~~~~~~~~~~~~~~-----~   55 (289)
                      +||+||| ||+|++|.++|+++    ..+|++++|..+...   .+.             ...+..+.+|....     .
T Consensus       973 ~VlLTGATGFLG~~lL~~LL~~~~~~~~~v~cLVRa~~~~~a~~Rl~~~~~~y~lw~~~~~~Ri~v~~GDLs~p~LGLs~ 1052 (1389)
T TIGR03443       973 TVFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLRKTGTTYGIWDEEWASRIEVVLGDLSKEKFGLSD 1052 (1389)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCHHCCCCEEEECCCCCCCCCCCCH
T ss_conf             79993876188999999998287878538999967898788999999999871886310115779981777874689699


Q ss_pred             HHHHHHHCCCCEEEEEECCCCCC------CEEECCCCCHHHHH--HHCCCCCCCCCCEEECCCC------------CCCC
Q ss_conf             23465411563278761244433------10001221013443--2012334333320102576------------2123
Q gi|254780595|r   56 NLLREKLYFTTHIVQCIKPSSEG------DPCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNR------------EGQW  115 (289)
Q Consensus        56 ~~~~~~~~~~~~v~~~~~~~~~~------~~~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~------------~g~~  115 (289)
                      ..+......+|.|+|+++.-.-.      ...+...+.++.+.  ..+.|.|-|+||++|++..            .+..
T Consensus      1053 ~~~~~La~~vD~IiHngA~Vn~~~pY~~Lr~aNV~gT~elLrla~~gr~k~~h~vST~sv~~~~~~~~~~~~~~~~g~~~ 1132 (1389)
T TIGR03443      1053 EKWSDLTNEVDVIIHNGALVHWVYPYSKLRDANVIGTINVLNLCAEGKAKQFSFVSSTSALDTEYYVNLSDELVQAGGAG 1132 (1389)
T ss_pred             HHHHHHHHHCCEEEECCCEECCCCCHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999984169999789353467668887544227899999998569997069971210068754344321011357778


Q ss_pred             CCCCCCCCC-----CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-------CHHHHHHCCCC--CCCCCCC
Q ss_conf             453211234-----311345544555543200123456764203477778985-------03444311345--4322211
Q gi|254780595|r  116 VDEHSFVHP-----ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR-------NPFIKIRQKNS--LRLVKKN  181 (289)
Q Consensus       116 i~E~~~~~P-----~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~--~~~~~~~  181 (289)
                      +.|++++.+     .+-|+++|+.+|+++++.. +.|+|++|.||+.|-|..+       +.|.|+.+|-.  ...++-+
T Consensus      1133 ~~E~d~l~~~~~~l~~GY~qSKWvaE~lv~~A~-~rGlpv~I~RpG~I~G~s~tG~~n~dDf~~r~ikg~iqlG~~P~~~ 1211 (1389)
T TIGR03443      1133 IPESDDLMGSSKGLGTGYGQSKWVAEYIIREAG-KRGLRGCIVRPGYVTGDSKTGATNTDDFLLRMLKGCIQLGLIPNIN 1211 (1389)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH-HCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             887765545422257743888999999999999-6699889977753501688788777889999999999748978988


Q ss_pred             CEECCHHHHHHHHHHHHHHCCC----CCCCEECCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             0001024777799999995135----5786162684333389999999999557998
Q gi|254780595|r  182 QVFNRIRVEDVARCVIFLMTHH----LGGIFNLSDDEPAPPQNVIMEAASLMKITPP  234 (289)
Q Consensus       182 ~~~~~ihv~Dva~~i~~l~~~~----~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~  234 (289)
                      ..++++.||-|+++++++.-++    ...+||+++...++++|++..+. .+|.+.+
T Consensus      1212 ~~~~~~PVD~va~~iv~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~-~~gy~~~ 1267 (1389)
T TIGR03443      1212 NTVNMVPVDHVARVVVAAALNPPKESELAVAHVTGHPRIRFNDFLGTLK-TYGYDVE 1267 (1389)
T ss_pred             CCCCEEEHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHHH-HHCCCCC
T ss_conf             8424242768999999987289867884289836999750999999999-8399887


No 34 
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=99.92  E-value=4.2e-24  Score=157.00  Aligned_cols=215  Identities=18%  Similarity=0.093  Sum_probs=147.1

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH--HHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             999888-888999999999889889999679446--34556449828980678640234654115632787612444331
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN--LLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGD   79 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~--~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~   79 (289)
                      |||||| |++|+++++.|+++||+|++++|++++  ...+...+++.+.+|. ++...+...+.++|.|+++++.....+
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~~~~l~~~gve~v~gD~-~d~~sl~~al~gvd~v~~~~~~~~~~~   79 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKSELAKSLKAAGVELVEGDL-DDHESLVEALKGVDVVFSVTGFWLSKE   79 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCEEEEECC-CCHHHHHHHHCCCCEEEEECCCCCCHH
T ss_conf             0998968289999999998589938999718736656666417988999068-887899999679988999158874177


Q ss_pred             EEECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             00012210134--4320123343333201025762123453211234311345544555543200123456764203477
Q gi|254780595|r   80 PCIISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSG  157 (289)
Q Consensus        80 ~~~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~  157 (289)
                        .. ...++.  +...++|||||.| ....       .++..+..|..+|..+|..+|+.++    +.+++++++||+.
T Consensus        80 --~~-~~~~~~~AA~~aGVk~~V~ss-~~~~-------~~~~~~~~~~~~~~~~K~~~e~~l~----~~g~~~tilrp~~  144 (232)
T pfam05368        80 --IE-DGKKLADAAKEAGVKHFIPSE-FGND-------VDRSNGVEPAVPHFDSKAEVERYIR----ALGIPYTFVYAGF  144 (232)
T ss_pred             --HH-HHHHHHHHHHHCCCCCEEEEE-ECCC-------CCCCCCCCCCCHHHHHHHHHHHHHH----HHCCCEEEEECCC
T ss_conf             --99-999999999973998345555-0125-------5456766655278898999999999----8199859996842


Q ss_pred             CCCCCCCHHH---HHHC--CCCCCCCCCC-CEECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             7789850344---4311--3454322211-0001024777799999995135--57861626843333899999999995
Q gi|254780595|r  158 IYGPKRNPFI---KIRQ--KNSLRLVKKN-QVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAASLM  229 (289)
Q Consensus       158 iyGp~r~~~~---~~~~--g~~~~~~~~~-~~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~~~i~~~~  229 (289)
                      ++++.-..+.   .+..  +.......++ ....+++++|+++++..+++++  .++.|....++.+|+.|+++.+.+.+
T Consensus       145 f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dva~~~~~~l~~p~~~~~~~~~~~~~~lT~~Eia~~~~~~~  224 (232)
T pfam05368       145 FMGNFLSNLAPPGDLAPPRDKVTLLGPGNPKAVPLDDEEDIGTYVIKILDDPRKLKGKYIRPPGNILSGNEIAELWSKKI  224 (232)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEEEEEEHHHHHHHHHHHHCCHHHCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             54301656544320257653699944898761126528899999999964912119999982898679999999999988


Q ss_pred             CCCC
Q ss_conf             5799
Q gi|254780595|r  230 KITP  233 (289)
Q Consensus       230 g~~~  233 (289)
                      |++.
T Consensus       225 Gr~v  228 (232)
T pfam05368       225 GKTV  228 (232)
T ss_pred             CCCC
T ss_conf             9983


No 35 
>pfam07993 NAD_binding_4 Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included.
Probab=99.91  E-value=9e-24  Score=155.14  Aligned_cols=190  Identities=14%  Similarity=0.084  Sum_probs=121.3

Q ss_pred             EECC-CHHHHHHHHHHHHCC--CEEEEEECCHHHHH-------HHH----------HCCCEEEECCCCC-----CCHHHH
Q ss_conf             9888-888999999999889--88999967944634-------556----------4498289806786-----402346
Q gi|254780595|r    5 IFGA-GYTGKFIADAALKVG--VYTCGTTRSVSNLL-------TLK----------HKGISPFLFADQK-----INNLLR   59 (289)
Q Consensus         5 I~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~~~~~-------~l~----------~~~~~~~~~~~~~-----~~~~~~   59 (289)
                      |||| ||||++|+++|++.+  .+|++++|.+....       .+.          ...++.+.+|...     ....+.
T Consensus         1 vTGaTGFlG~~ll~~Ll~~~~~~~V~~LvR~~~~~~~~~r~~~~~~~~~~~~~~~~~~ri~~v~gDl~~~~lGL~~~~~~   80 (245)
T pfam07993         1 LTGATGFLGKVLLEKLLRSCPEVKIYCLVRAKDGESALERLRQELLKYGLFDRLKALERIIPVAGDLSEPNLGLSDEDFQ   80 (245)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHCCCCEEEEECCCCCCCCCCCHHHHH
T ss_conf             93843599999999999579997899996789840589999999985675310103477799956168865798999999


Q ss_pred             HHHCCCCEEEEEECCCCCCCE------EECCCCCHHHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCC---------C
Q ss_conf             541156327876124443310------0012210134432--0123343333201025762123453211---------2
Q gi|254780595|r   60 EKLYFTTHIVQCIKPSSEGDP------CIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSF---------V  122 (289)
Q Consensus        60 ~~~~~~~~v~~~~~~~~~~~~------~~~~~~~~~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~---------~  122 (289)
                      .....+++|+|+++......+      .......++++.+  .+.++|+|+||..++|...+....|..+         .
T Consensus        81 ~l~~~vd~IiH~Aa~v~~~~~~~~~~~~NV~gt~~ll~~a~~~~~~~~v~vSS~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (245)
T pfam07993        81 ELAEEVDVIIHNAATVNFVEPYSDLRATNVLGTREVLRLAKQMKKLPFHHVSTAYVNGERGGLLEEKPYPLDEDEPALLG  160 (245)
T ss_pred             HHHHCCCEEEECCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCCCCCCCCCHHCCC
T ss_conf             99835999998743303568889999999999999999999769985999958165066778766656788876011036


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC---CC----CHHHH-----HHCCCCCCCCC-CCCEECCHHH
Q ss_conf             343113455445555432001234567642034777789---85----03444-----31134543222-1100010247
Q gi|254780595|r  123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP---KR----NPFIK-----IRQKNSLRLVK-KNQVFNRIRV  189 (289)
Q Consensus       123 ~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp---~r----~~~~~-----~~~g~~~~~~~-~~~~~~~ihv  189 (289)
                      ...+.|+++|+.+|+.++++.  .|+|++|+||+.|||+   |.    +.+..     +..|..+.+.+ ++..+++|+|
T Consensus       161 ~~~~~Y~~SK~~aE~lv~~~~--~gl~~~I~Rp~~v~G~s~~G~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~d~vpV  238 (245)
T pfam07993       161 GLPNGYTQSKWLAEQLVREAA--GGLPVVIYRPSIITGESRTGWINGDDFGPRGLLGGAGLGVLPDILGDPDARLDLVPV  238 (245)
T ss_pred             CCCCHHHHHHHHHHHHHHHHH--CCCCEEEEECCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEH
T ss_conf             668828999999999999973--329989996987865898887060546999999999879976246998855647739


Q ss_pred             HHHHHHH
Q ss_conf             7779999
Q gi|254780595|r  190 EDVARCV  196 (289)
Q Consensus       190 ~Dva~~i  196 (289)
                      |++|++|
T Consensus       239 D~va~ai  245 (245)
T pfam07993       239 DYVANAI  245 (245)
T ss_pred             HHHHHHC
T ss_conf             9997259


No 36 
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368   This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=99.90  E-value=5.7e-22  Score=144.87  Aligned_cols=285  Identities=16%  Similarity=0.119  Sum_probs=187.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----HHHH------HHCCC--EEEECCCCCCCHHHHHHHC--CCC
Q ss_conf             999888-888999999999889889999679446-----3455------64498--2898067864023465411--563
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----LLTL------KHKGI--SPFLFADQKINNLLREKLY--FTT   66 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----~~~l------~~~~~--~~~~~~~~~~~~~~~~~~~--~~~   66 (289)
                      =||||= |+=|++|++.|+++||+|+|+.|..+.     +..+      ...+.  -.+..+|.++...+...+.  ..+
T Consensus         3 ALiTGiTGQDGSYLAE~LL~~GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~kP~   82 (365)
T TIGR01472         3 ALITGITGQDGSYLAEFLLEKGYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEIKPT   82 (365)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             68834555767899999872696876458625542522456764053541016613542044210689999997404886


Q ss_pred             EEEEEEC----------CCCCCCEEECCCCCHHHHHHH-C----CC--CCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             2787612----------444331000122101344320-1----23--34333320102576212345321123431134
Q gi|254780595|r   67 HIVQCIK----------PSSEGDPCIISMSKDFYKFMP-H----VK--WIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        67 ~v~~~~~----------~~~~~~~~~~~~~~~~~~~~~-~----~~--~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      -|.++++          |....+..-..+.+.+-|.+. +    .+  ||=-+||+..||....-|.+|++|++|.|||+
T Consensus        83 EiYNLAAQSHV~VSFe~PeYTa~~~g~GTLrlLEA~r~hni~gl~~~~rFYQAStSElYG~v~~~PQ~E~TPF~PRSPYA  162 (365)
T TIGR01472        83 EIYNLAAQSHVKVSFEIPEYTADVDGIGTLRLLEAVRSHNILGLIKEIRFYQASTSELYGEVQEIPQNETTPFYPRSPYA  162 (365)
T ss_pred             EEECCCCCCCEEEECCCCCCHHCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             34202023710354165200001244317789998742334141203025524523113655578888888768887689


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--H--------HHHHHCCCCCCCCCCC--CEECCHHHHHHHHHHH
Q ss_conf             55445555432001234567642034777789850--3--------4443113454322211--0001024777799999
Q gi|254780595|r  130 TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN--P--------FIKIRQKNSLRLVKKN--QVFNRIRVEDVARCVI  197 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~--~--------~~~~~~g~~~~~~~~~--~~~~~ihv~Dva~~i~  197 (289)
                      .+|+.|=-....|-+.||+=++--=+++-=.|-|+  .        ..++.-|..-.+.-||  -.+.|=|..|-|+++-
T Consensus       163 aAK~yA~w~tvNYREAYgL~A~nGILFNHESP~RGetFVTRKITra~a~I~~G~~~~lyLGNLdA~RDWGhAkDYV~aMW  242 (365)
T TIGR01472       163 AAKLYAYWITVNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAAKIKLGLQEKLYLGNLDAKRDWGHAKDYVEAMW  242 (365)
T ss_pred             HHHHHHHHHEEEEECCCCCCHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             99884543102121003410003521046788778853225899999998615631112027544106650566999988


Q ss_pred             HHHCCCCCCCEECCCCCHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCHH------H----HHHHCCCC---------
Q ss_conf             99513557861626843333899999999995579--986343101256824------4----65530694---------
Q gi|254780595|r  198 FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT--PPLEQCFDTANISPF------T----RFFYADNK---------  256 (289)
Q Consensus       198 ~l~~~~~~~iyni~~~~~~s~~e~~~~i~~~~g~~--~~~~~~~~~~~~~~~------~----~~~~~~~~---------  256 (289)
                      .++.++..+=|=|++++..|.+||++.-....|..  ..-.-..+.......      +    .+-...++         
T Consensus       243 LMLQ~d~P~DYViATG~t~SVrefve~SF~~~G~~l~W~~~g~~E~G~~~~~dekranalklnlshlkkGk~~V~iD~rY  322 (365)
T TIGR01472       243 LMLQQDKPDDYVIATGETHSVREFVEVSFELVGITLEWKDKGIEEVGLIKETDEKRANALKLNLSHLKKGKVVVEIDPRY  322 (365)
T ss_pred             HHCCCCCCCCEEEECCCEEEHHHHHHHHHHHCCCEEEECCCCCCEECCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             75278688976887573333888999988740973686268820211301233555777765344413770799964865


Q ss_pred             ---------EECHHHHHH-CCCCCCCCCHHHHHHHHHH-HHHC
Q ss_conf             ---------516899997-3984489999999999999-7513
Q gi|254780595|r  257 ---------RISNAKIKS-LGFQLLYPNYRISLKQLWK-EIEN  288 (289)
Q Consensus       257 ---------~is~~kl~~-lG~~p~~p~~~~gl~~~~~-~~~~  288 (289)
                               .=|++|+|+ |||+|++ +|++=.+.|++ +++.
T Consensus       323 fRPTEVDlL~GD~~KAk~~LgW~~~~-~f~~Lvk~Mv~~Dl~~  364 (365)
T TIGR01472       323 FRPTEVDLLLGDATKAKEKLGWKPEV-SFEELVKEMVEEDLEL  364 (365)
T ss_pred             CCCHHHHHCCCCCHHHHHHCCCCCCC-CHHHHHHHHHHHHHHC
T ss_conf             78514230178834889736882455-7789999999997850


No 37 
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080   This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG . The mechanism of reduction involves activation of the substrate by adenylation and transfer to a covalently-linked pantetheine cofactor as a thioester. This thioester is then reduced to give an aldehyde (thus releasing the product) and a regenerated pantetheine thiol ; in myxochelin biosynthesis this aldehyde is further reduced to an alcohol or converted to an amine by an aminotransferase. This is a fundamentally different reaction than beta-ketoreductase domains of polyketide synthases which act at a carbonyl two carbons removed from the thioester and forms an alcohol as a product. The majority of bacterial sequences containing this domain are non-ribosomal peptide synthetases in which this domain is similarly located proximal to a thiolation domain (IPR006163 from INTERPRO). In some cases this domain is found at the end of a polyketide synthetase enzyme, but is unlike ketoreductase domains which are found before the thiolase domains. Exceptions to this observed relationship with the thiolase domain include three proteins which consist of stand-alone reductase domains (from Mycobacterium leprae, Anabaena and from Streptomyces coelicolor) and one protein (from Nostoc) which contains N-terminal homology with a small group of hypothetical proteins but no evidence of a thiolation domain next to the putative reductase domain.; GO: 0004043 L-aminoadipate-semialdehyde dehydrogenase activity.
Probab=99.89  E-value=2.6e-22  Score=146.84  Aligned_cols=240  Identities=16%  Similarity=0.149  Sum_probs=156.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC----CEEEEEEC-CHHHH---HHH----H--H-----------CCCEEEECCCCC--
Q ss_conf             3999888-888999999999889----88999967-94463---455----6--4-----------498289806786--
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG----VYTCGTTR-SVSNL---LTL----K--H-----------KGISPFLFADQK--   53 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g----~~V~~~~r-~~~~~---~~l----~--~-----------~~~~~~~~~~~~--   53 (289)
                      +||+||| ||+|.+|+++|++.+    -+|++++| .....   ..|    .  +           ..|..+.+|...  
T Consensus         1 ~vlLTGAtGfLG~~ll~~Ll~~~~s~~~~v~CLVRva~~~~~A~~RL~~~~~Gd~~~l~~~~~~~~~Ri~~~~GDl~~p~   80 (405)
T TIGR01746         1 TVLLTGATGFLGAYLLEELLRRNDSTEAKVICLVRVAKSEEHAMERLREALRGDSYRLWQEDLASIERIEVVAGDLSKPR   80 (405)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             95873362678999999997204886405687775149879999999851684223322333331136058868746666


Q ss_pred             ---CCHHHHHHH---CCCCEEEEEECCCC---CC---CEEECCCCCHHHHHH--HCCCCCCCCCCEEECCCCCCC-----
Q ss_conf             ---402346541---15632787612444---33---100012210134432--012334333320102576212-----
Q gi|254780595|r   54 ---INNLLREKL---YFTTHIVQCIKPSS---EG---DPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQ-----  114 (289)
Q Consensus        54 ---~~~~~~~~~---~~~~~v~~~~~~~~---~~---~~~~~~~~~~~~~~~--~~~~~~i~~SS~~VYg~~~g~-----  114 (289)
                         .+..+....   ..+|.|+|.++--.   .+   .......+..+++.+  .+.|-|+|+||.+|+......     
T Consensus        81 lGL~~~~~~~L~Gqs~~~D~i~HngA~Vn~~~pY~~Lr~~NV~Gt~~~L~L~~~~~~kpl~yvSt~~v~~~~~~~~~~~~  160 (405)
T TIGR01746        81 LGLSEAEWERLAGQSENVDTIVHNGALVNWVYPYEELRAANVLGTREVLRLAASGRAKPLHYVSTISVLAAIDLSGGKEE  160 (405)
T ss_pred             CCCCHHHHHHCCCCCEECCEEEECCEEECCCCCHHHHHHHCCHHHHHHHHHHHCCCCCEEEEECCHHCCCCCCCCCCCCC
T ss_conf             78871677324777300386783641422326826652102125999999961589851688524000253436788763


Q ss_pred             -CCCCCCCC-----CCCCHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCC---C----CCHHHHHHCCCC--C-
Q ss_conf             -34532112-----343113455445555432001234---567642034777789---8----503444311345--4-
Q gi|254780595|r  115 -WVDEHSFV-----HPISCVATQRFNAEKEWLAITKKL---NIKLAVLRLSGIYGP---K----RNPFIKIRQKNS--L-  175 (289)
Q Consensus       115 -~i~E~~~~-----~P~~~y~~~k~~~E~~~~~~~~~~---~~~~~ilR~~~iyGp---~----r~~~~~~~~g~~--~-  175 (289)
                       -+.|+++.     ...+.|+.||+.+|+.+....+..   |++++|+||+.|.|.   |    ++.+.++.++-.  . 
T Consensus       161 ~d~~~~~~~~~~~~~~~~GY~~SKwvaE~lv~~A~~~~PadGl~v~i~RpG~i~g~s~~G~~n~~D~l~r~v~~~~~~G~  240 (405)
T TIGR01746       161 EDVTEDDATVTAPPGLAGGYAQSKWVAELLVREASDRLPADGLPVTIYRPGRILGDSETGAINTSDILWRMVKGCLELGD  240 (405)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEECCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             67620460012677667873034999999999988737745573579827513416336735353088899999874400


Q ss_pred             -CCCCCCC-----EECCHHHHHHHHHHHHHHCCC------CCCCEECCCCCH--HHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             -3222110-----001024777799999995135------578616268433--33899999999995579986343101
Q gi|254780595|r  176 -RLVKKNQ-----VFNRIRVEDVARCVIFLMTHH------LGGIFNLSDDEP--APPQNVIMEAASLMKITPPLEQCFDT  241 (289)
Q Consensus       176 -~~~~~~~-----~~~~ihv~Dva~~i~~l~~~~------~~~iyni~~~~~--~s~~e~~~~i~~~~g~~~~~~~~~~~  241 (289)
                       ..+....     ...+++|+.++++|..+..+.      .+.+||+.++++  ++..+|..++.+..|.+.....+++.
T Consensus       241 l~~P~~~~Nrqr~~~~~~pVd~~a~ai~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~f~~~~~~~~G~~~~~~~~~~e  320 (405)
T TIGR01746       241 LAYPQLDENRQRLTEDLTPVDYVARAIVALSSQPAAEAQAGGAVFHLVNPEPEPVSLDEFLEWLKRSAGYELKLLVSFDE  320 (405)
T ss_pred             CCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             00466611012133223109999999999998764643277217872289985657899999998861886534289899


No 38 
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445    This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria. Members are typically encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate CDP-D-glucose. This is used by the proteins in this entry to produce CDP-4-keto-6-deoxyglucose..
Probab=99.88  E-value=1.8e-21  Score=141.98  Aligned_cols=281  Identities=16%  Similarity=0.178  Sum_probs=187.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CCCE------EEECCCCCCCHHHHHHH--CCCCEE
Q ss_conf             3999888-888999999999889889999679446345564----4982------89806786402346541--156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KGIS------PFLFADQKINNLLREKL--YFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~~~------~~~~~~~~~~~~~~~~~--~~~~~v   68 (289)
                      ||||||. ||=|+-|.-=|...|-+|.|.+-.|...+.+..    .+..      ...+.|..+...+.+.+  ..-++|
T Consensus         6 kVl~TGHTGFKGSWL~lWL~~lGA~V~GYSL~P~t~PnlFe~l~l~~~~~~~Wyf~~~~gDIrD~~~L~~~~~~~~PeIv   85 (361)
T TIGR02622         6 KVLITGHTGFKGSWLSLWLLELGAEVAGYSLDPPTSPNLFELLNLAKKIKDSWYFSSIFGDIRDAAKLEKAIAEFKPEIV   85 (361)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCHHHHHHHHHHCCCCEE
T ss_conf             78984578642558999998479679897168878840555752542432350554233032327899999997289898


Q ss_pred             EEEEC----------CCCCCCEEECCCCCHHHH--HHHCCCCCCCCCCEEECCCCCCC-CCCCCCCCCCCCHHHHHHHHH
Q ss_conf             87612----------444331000122101344--32012334333320102576212-345321123431134554455
Q gi|254780595|r   69 VQCIK----------PSSEGDPCIISMSKDFYK--FMPHVKWIGYLSSTSIYGNREGQ-WVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        69 ~~~~~----------~~~~~~~~~~~~~~~~~~--~~~~~~~~i~~SS~~VYg~~~g~-~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      +|+||          |-......+..+.+.+.+  ..+++|-+|-+.|.-||-+.+-. ...|++++..-.+|+.||.+|
T Consensus        86 FHlAAQPLVr~SY~~P~~Tf~TNVmGT~~lLea~r~~~~~~a~v~vTsDK~Y~N~EW~wgYRE~D~LGGhDPYS~SKAcA  165 (361)
T TIGR02622        86 FHLAAQPLVRKSYADPLETFETNVMGTVNLLEAIRAIKSVKAVVLVTSDKVYENKEWVWGYRETDPLGGHDPYSSSKACA  165 (361)
T ss_pred             EHHHHHHHHHHHHHCHHHHEEEHHHHHHHHHHHHHHCCCCEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             33354278898673202022200322257788997469956999861672330787887523247887716775328999


Q ss_pred             HHHHHH----CCC------CCCCCCCCCCCCCCCCCC-----C---CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             554320----012------345676420347777898-----5---0344431134543222110001024777799999
Q gi|254780595|r  136 EKEWLA----ITK------KLNIKLAVLRLSGIYGPK-----R---NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       136 E~~~~~----~~~------~~~~~~~ilR~~~iyGp~-----r---~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      |-.+.+    |++      ++++.+.+.|-++|.|=|     |   +.+..+.+++...|=.|.-.+.|=||-|=-.+.+
T Consensus       166 ELv~~syR~SF~~~~~f~~~h~~~iAsaRAGNVIGGGDWs~DRliPD~irA~~~n~~v~IRnP~A~RPWQHVLEPL~GYL  245 (361)
T TIGR02622       166 ELVIASYRSSFFGEANFQSTHGIKIASARAGNVIGGGDWSEDRLIPDVIRALSSNKIVTIRNPDATRPWQHVLEPLSGYL  245 (361)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHH
T ss_conf             99999998606888875546863689986064047675001041789999642687377437788589743014511079


Q ss_pred             HH----HCCC--CCC-CEECCC--CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCEECHHHHHH-CC
Q ss_conf             99----5135--578-616268--43333899999999995579986343101256824465530694516899997-39
Q gi|254780595|r  198 FL----MTHH--LGG-IFNLSD--DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LG  267 (289)
Q Consensus       198 ~l----~~~~--~~~-iyni~~--~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~kl~~-lG  267 (289)
                      .|    .+++  ..+ .||.+.  .+..+..+++..+.+........+... .....|=...+    .++|++|+++ ||
T Consensus       246 lLAekL~~~~~~~~~eafNFGP~~~~~~~v~~~v~~~~~~~~g~~~~~~~~-~~~~~PhEA~l----L~Ld~~KA~~~Lg  320 (361)
T TIGR02622       246 LLAEKLFEGQAELAGEAFNFGPEASENARVVELVADALELWPGDDAEWEKQ-SDNNHPHEANL----LKLDSDKARALLG  320 (361)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEECC-CCCCCCCCCCC----CCCCHHHHHHHCC
T ss_conf             999998528734124554558887776555999999999668983164067-78988723566----7758799984318


Q ss_pred             CCCCCCCHHHHHHHHHHHHHC
Q ss_conf             844899999999999997513
Q gi|254780595|r  268 FQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       268 ~~p~~p~~~~gl~~~~~~~~~  288 (289)
                      |+|+- +++++++.++++..|
T Consensus       321 W~P~w-~~~~~v~~T~~WYk~  340 (361)
T TIGR02622       321 WQPRW-GLEEAVSRTVEWYKN  340 (361)
T ss_pred             CCCCC-CHHHHHHHHHHHHHH
T ss_conf             86554-588999999987326


No 39 
>KOG3019 consensus
Probab=99.88  E-value=3.4e-23  Score=151.88  Aligned_cols=266  Identities=14%  Similarity=0.143  Sum_probs=176.3

Q ss_pred             CC-CHHHHHHHH-----HHHHCC----CEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEE-CCC
Q ss_conf             88-888999999-----999889----8899996794463455644982898067864023465411563278761-244
Q gi|254780595|r    7 GA-GYTGKFIAD-----AALKVG----VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCI-KPS   75 (289)
Q Consensus         7 Ga-G~iG~~l~~-----~L~~~g----~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~-~~~   75 (289)
                      +. |+|+..|..     ++-+.+    |+|+.++|.+.+..         ..|+..+.......-...+..+...+ -|.
T Consensus        19 ~~~g~i~~nl~~~~~~~H~t~~~~a~~h~vtv~sR~pg~~r---------itw~el~~~Gip~sc~a~vna~g~n~l~P~   89 (315)
T KOG3019          19 WSNGIIRENLGSETSCCHDTNVHSADNHAVTVLSRSPGKAR---------ITWPELDFPGIPISCVAGVNAVGNNALLPI   89 (315)
T ss_pred             CCCCCHHCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCC---------CCCCHHCCCCCCEEHHHHHHHHHHHCCCCH
T ss_conf             66640320136763001248888655431699964899752---------345022079985026877756655324923


Q ss_pred             C------CC--CEEECCCCCHHHHHHHC----CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             4------33--10001221013443201----233433332010257621234532112343113455445555432001
Q gi|254780595|r   76 S------EG--DPCIISMSKDFYKFMPH----VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAIT  143 (289)
Q Consensus        76 ~------~~--~~~~~~~~~~~~~~~~~----~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~  143 (289)
                      .      +.  .......+..++.+.++    .+-++.+|.+++|--......+|+++....+..+.-..+.|...+.-.
T Consensus        90 rRWsp~fqkev~gSRi~~t~~la~aI~~aPq~~~~~Vlv~gva~y~pS~s~eY~e~~~~qgfd~~srL~l~WE~aA~~~~  169 (315)
T KOG3019          90 RRWSPEFQKEVKGSRIRVTSKLADAINNAPQEARPTVLVSGVAVYVPSESQEYSEKIVHQGFDILSRLCLEWEGAALKAN  169 (315)
T ss_pred             HHCCHHHHHHHHCCEEEHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             21697788775324200889999998549887877589876688614511003322656775799999898888763467


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCH----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC-CCCCCEECCCCCHHHH
Q ss_conf             2345676420347777898503----4443113454322211000102477779999999513-5578616268433338
Q gi|254780595|r  144 KKLNIKLAVLRLSGIYGPKRNP----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP  218 (289)
Q Consensus       144 ~~~~~~~~ilR~~~iyGp~r~~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~-~~~~iyni~~~~~~s~  218 (289)
                      +  ..+++++|.+.|.|-|...    +..++.|....++.|.|+++|||++|++..|..++++ +..|+.|-+.+++.+.
T Consensus       170 ~--~~r~~~iR~GvVlG~gGGa~~~M~lpF~~g~GGPlGsG~Q~fpWIHv~DL~~li~~ale~~~v~GViNgvAP~~~~n  247 (315)
T KOG3019         170 K--DVRVALIRIGVVLGKGGGALAMMILPFQMGAGGPLGSGQQWFPWIHVDDLVNLIYEALENPSVKGVINGVAPNPVRN  247 (315)
T ss_pred             C--CEEEEEEEEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCCCEECCCCCCCCCH
T ss_conf             6--40479999757983387401232222230367867887744335666778999999975689774234658984405


Q ss_pred             HHHHHHHHHHHCCCCCCCCCC--CCCCCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             999999999955799863431--01256824465530694516899997398448999999999999
Q gi|254780595|r  219 QNVIMEAASLMKITPPLEQCF--DTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW  283 (289)
Q Consensus       219 ~e~~~~i~~~~g~~~~~~~~~--~~~~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~~~~  283 (289)
                      .||.+.++++++.+....++.  -.+-..|--.....++.+|-.+|.+++||+++||.++++|+++.
T Consensus       248 ~Ef~q~lg~aL~Rp~~~pvP~fvvqA~fG~erA~~vLeGqKV~Pqral~~Gf~f~yp~vk~Al~~i~  314 (315)
T KOG3019         248 GEFCQQLGSALSRPSWLPVPDFVVQALFGPERATVVLEGQKVLPQRALELGFEFKYPYVKDALRAIM  314 (315)
T ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCHHHHHCCCEEECHHHHHHHHHHH
T ss_conf             8999999988578853577099999874744406996077014366764376330647999999974


No 40 
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.85  E-value=9.2e-22  Score=143.67  Aligned_cols=231  Identities=15%  Similarity=0.065  Sum_probs=140.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC-EEEEEECCHH------HHH----------HHHHCCCEEEECCCCC-----CCHH
Q ss_conf             93999888-8889999999998898-8999967944------634----------5564498289806786-----4023
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGV-YTCGTTRSVS------NLL----------TLKHKGISPFLFADQK-----INNL   57 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~-~V~~~~r~~~------~~~----------~l~~~~~~~~~~~~~~-----~~~~   57 (289)
                      |++|+||| ||+|.+|+.+|+.+-. +|++++|-.+      ++.          +.....++++.+|...     ....
T Consensus         1 ~~vlLTGATGFLG~yLl~eLL~~~~~kv~cLVRA~s~E~a~~RL~~~~~~~~~~~e~~~~ri~vv~gDl~e~~lGL~~~~   80 (382)
T COG3320           1 RNVLLTGATGFLGAYLLLELLDRSDAKVICLVRAQSDEAALARLEKTFDLYRHWDELSADRVEVVAGDLAEPDLGLSERT   80 (382)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHH
T ss_conf             91899457027699999999716887289998227779999999997655301344302537998134445568987889


Q ss_pred             HHHHHCCCCEEEEEECCCC------CCCEEECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCC----CCCCCCCCC---
Q ss_conf             4654115632787612444------33100012210134--43201233433332010257621----234532112---
Q gi|254780595|r   58 LREKLYFTTHIVQCIKPSS------EGDPCIISMSKDFY--KFMPHVKWIGYLSSTSIYGNREG----QWVDEHSFV---  122 (289)
Q Consensus        58 ~~~~~~~~~~v~~~~~~~~------~~~~~~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g----~~i~E~~~~---  122 (289)
                      +....+.+|.|+|+++--.      +-..........+.  ++..+.|.++|+||++|+.....    .-.+|.++.   
T Consensus        81 ~~~La~~vD~I~H~gA~Vn~v~pYs~L~~~NVlGT~evlrLa~~gk~Kp~~yVSsisv~~~~~~~~~~~~~~~~~~~~~~  160 (382)
T COG3320          81 WQELAENVDLIIHNAALVNHVFPYSELRGANVLGTAEVLRLAATGKPKPLHYVSSISVGETEYYSNFTVDFDEISPTRNV  160 (382)
T ss_pred             HHHHHHHCCEEEECCHHHCCCCCHHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99986320357754324435576887347645769999999961798404997100114532467775331224532245


Q ss_pred             --CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-------CHHHHHHCCCC--CCCCCCCCEECCHHHHH
Q ss_conf             --34311345544555543200123456764203477778985-------03444311345--43222110001024777
Q gi|254780595|r  123 --HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR-------NPFIKIRQKNS--LRLVKKNQVFNRIRVED  191 (289)
Q Consensus       123 --~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~--~~~~~~~~~~~~ihv~D  191 (289)
                        .+.+.|++||+.+|+.+++..+. |+|++|+||+.|-|+.+       +.+.|+..+-.  ..++......+-+.+++
T Consensus       161 ~~~~~~GY~~SKwvaE~Lvr~A~~r-GLpv~I~Rpg~I~gds~tG~~n~~D~~~Rlv~~~~~lg~~P~~~~~~~~~p~~~  239 (382)
T COG3320         161 GQGLAGGYGRSKWVAEKLVREAGDR-GLPVTIFRPGYITGDSRTGALNTRDFLTRLVLGLLQLGIAPDSEYSLDMLPVDH  239 (382)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEECCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCE
T ss_conf             6766788412389999999998663-897699816724116766763543499999999998577898655543376520


Q ss_pred             -----------HHHHHHHHHCCC--CCCCEE-CCCCCHHHHHHHHHHHHH--HHCCC
Q ss_conf             -----------799999995135--578616-268433338999999999--95579
Q gi|254780595|r  192 -----------VARCVIFLMTHH--LGGIFN-LSDDEPAPPQNVIMEAAS--LMKIT  232 (289)
Q Consensus       192 -----------va~~i~~l~~~~--~~~iyn-i~~~~~~s~~e~~~~i~~--~~g~~  232 (289)
                                 ++.++.++..++  ....|+ ..-|.++...++.+++.+  ..+.+
T Consensus       240 v~~~v~~~~~~~~~~~~~l~~~~~~~f~~~~~~~~~~~i~l~~~~~w~~~~~~a~~~  296 (382)
T COG3320         240 VARAVVAPSVQVAEAIAALGAHSDIRFNQLHMLTHPDEIGLDEYVDWLISLDIAGYP  296 (382)
T ss_pred             EEEEEEHHHHHHHHHHHHHCCCCCCHHHHEECCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             357752024547888997326863113210034688754545787767641025784


No 41 
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=99.81  E-value=3.6e-19  Score=128.88  Aligned_cols=256  Identities=14%  Similarity=0.086  Sum_probs=147.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHH---HHCCCCEEEEEECCCCC
Q ss_conf             3999888-8889999999998898899996794463455644982898067864023465---41156327876124443
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE---KLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~---~~~~~~~v~~~~~~~~~   77 (289)
                      -|||||| |.+|+.+++.|++.|+.|++.+|++++.......++.....|..+....+..   ...+++.++. .+|...
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v~l-~~p~~~   79 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAVYL-VAPPIP   79 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE-CCCCCC
T ss_conf             9899989981899999999868997899958856646666753686444811488897635323127418998-389987


Q ss_pred             CCEEECCCCCHH-HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             310001221013-4432012334333320102576212345321123431134554455554320012345676420347
Q gi|254780595|r   78 GDPCIISMSKDF-YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS  156 (289)
Q Consensus        78 ~~~~~~~~~~~~-~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~  156 (289)
                       + ........+ ++...+++|++|+|+..+-   .+      .   |.    ..+.. | .+.   ...|++++||||+
T Consensus        80 -~-~~~~~~~~i~aA~~aGV~~iV~lS~~~~~---~~------~---~~----~~~~~-~-~~~---~~sg~~~tiLRp~  136 (285)
T TIGR03649        80 -D-LAPPMIKFIDFARSKGVRRFVLLSASIIE---KG------G---PA----MGQVH-A-HLD---SLGGVEYTVLRPT  136 (285)
T ss_pred             -C-HHHHHHHHHHHHHHCCCCEEEEEECCCCC---CC------C---CC----CHHHH-H-HHH---HHCCCCEEEEECH
T ss_conf             -7-67899999999998499889998303566---79------8---61----03899-9-999---7369976999663


Q ss_pred             CCCCCC-CC-HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             777898-50-344431134543222110001024777799999995135--57861626843333899999999995579
Q gi|254780595|r  157 GIYGPK-RN-PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAASLMKIT  232 (289)
Q Consensus       157 ~iyGp~-r~-~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~~~i~~~~g~~  232 (289)
                      ..+-.- .. ....++.........++...+||+.+|++++...++..+  .++.|.++.++.+|+.|++..+.+.+|.+
T Consensus       137 ~fm~N~~~~~~~~~i~~~g~~~~~~gd~~~~~V~~~DiA~vaa~~L~~~~~~~~~~~ltGpe~lt~~eiA~~ls~vlGr~  216 (285)
T TIGR03649       137 WFMENFSEEFHVEAIRKENKIYSATGDGKIPFVSADDIARVAYRALTDKVAPNTDYVVLGPELLTYDDVAEILSRVLGRK  216 (285)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             99875056665899974897844478877573558789999999974977689779986886579999999999987992


Q ss_pred             CCCC-CCCCC-------CCCCHHHHHH----H---CCC--CEECHHHHHH-CCCCCCCCCHHHHHHHHHH
Q ss_conf             9863-43101-------2568244655----3---069--4516899997-3984489999999999999
Q gi|254780595|r  233 PPLE-QCFDT-------ANISPFTRFF----Y---ADN--KRISNAKIKS-LGFQLLYPNYRISLKQLWK  284 (289)
Q Consensus       233 ~~~~-~~~~~-------~~~~~~~~~~----~---~~~--~~is~~kl~~-lG~~p~~p~~~~gl~~~~~  284 (289)
                      +... ++.+.       ..+++.....    +   ..+  ..+++. +++ ||=.|+  ||++-+++-..
T Consensus       217 V~y~~v~~~~~~~~l~~~G~p~~~a~~~~~~~~~~~~G~~~~~t~~-v~~l~Gr~p~--s~~~f~~e~~~  283 (285)
T TIGR03649       217 ITHVKLTEEELAQRLQSFGMPEDLARMLASLDTAVKNGAEVRLNDV-VKAVTGSKPR--GFRDFAESNKA  283 (285)
T ss_pred             EEEEECCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCH-HHHHHCCCCC--CHHHHHHHHHH
T ss_conf             2788599999999998749999999999999999976987787887-8897493997--89999999886


No 42 
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.78  E-value=1.7e-17  Score=119.35  Aligned_cols=215  Identities=15%  Similarity=0.109  Sum_probs=149.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             93999888-88899999999988988999967944634556449828980678640234654115632787612444331
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGD   79 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~   79 (289)
                      |+|||||+ |++|++++++|+++||+|++.+|++++...+. .+++.. ..+..+...+.....+++.++++.+... .+
T Consensus         1 ~~ilV~GatG~~G~~~~~~L~~~~~~v~~~~r~~~~~~~~~-~~v~~~-~~d~~~~~~l~~~~~G~~~~~~i~~~~~-~~   77 (275)
T COG0702           1 MKILVTGATGFVGGAVVRELLARGHEVRAAVRNPEAAAALA-GGVEVV-LGDLRDPKSLVAGAKGVDGVLLISGLLD-GS   77 (275)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHCC-CCCEEE-CCCCCCCHHHHHHHCCCEEEEEECCCCC-CC
T ss_conf             93899867775799999999975986999736822111103-785288-4564160779998489417999525455-66


Q ss_pred             E-EE-CCC---CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             0-00-122---101344320123343333201025762123453211234311345544555543200123456764203
Q gi|254780595|r   80 P-CI-ISM---SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR  154 (289)
Q Consensus        80 ~-~~-~~~---~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR  154 (289)
                      . .. ...   .....+.....+++++.|....-         +    .....|...|..+|+.+.    ..+++.+++|
T Consensus        78 ~~~~~~~~~~~~~~a~~a~~~~~~~~~~s~~~~~---------~----~~~~~~~~~~~~~e~~l~----~sg~~~t~lr  140 (275)
T COG0702          78 DAFRAVQVTAVVRAAEAAGAGVKHGVSLSVLGAD---------A----ASPSALARAKAAVEAALR----SSGIPYTTLR  140 (275)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCC---------C----CCCHHHHHHHHHHHHHHH----HCCCCCCCCC
T ss_conf             3012003678999998627442432687502356---------6----880678999999999998----5698620355


Q ss_pred             CCCCCCCCCCH-HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             47777898503-44431134543222110001024777799999995135--5786162684333389999999999557
Q gi|254780595|r  155 LSGIYGPKRNP-FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAASLMKI  231 (289)
Q Consensus       155 ~~~iyGp~r~~-~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~~~i~~~~g~  231 (289)
                      ++.+|...... .........+....+...++.+..+|++.++...+..+  .+++|.++.++..+..+....+....+.
T Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~a~~~~~~l~~~~~~~~~~~l~g~~~~~~~~~~~~l~~~~gr  220 (275)
T COG0702         141 RAAFYLGAGAAFIEAAEAAGLPVIPRGIGRLSPIAVDDVAEALAAALDAPATAGRTYELAGPEALTLAELASGLDYTIGR  220 (275)
T ss_pred             CCCEECCCCHHHHHHHHHCCCCEEECCCCCCCCEEHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             63001153056799998458851412566547145656799999871485334867999574003556898778998788


Q ss_pred             CCCC
Q ss_conf             9986
Q gi|254780595|r  232 TPPL  235 (289)
Q Consensus       232 ~~~~  235 (289)
                      +...
T Consensus       221 ~~~~  224 (275)
T COG0702         221 PVGL  224 (275)
T ss_pred             CCCC
T ss_conf             7545


No 43 
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.77  E-value=2.2e-17  Score=118.70  Aligned_cols=222  Identities=16%  Similarity=0.188  Sum_probs=160.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC-CEEEEEECCHHHHHH----HHH----CCCEEEECCCCCCCHHHHHHHCC--CCEEE
Q ss_conf             3999888-888999999999889-889999679446345----564----49828980678640234654115--63278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG-VYTCGTTRSVSNLLT----LKH----KGISPFLFADQKINNLLREKLYF--TTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~----l~~----~~~~~~~~~~~~~~~~~~~~~~~--~~~v~   69 (289)
                      +|||||+ |-||+.+|+++++.+ -+++.++|+..+...    +..    ..+.++++|.. +.+.+.....+  +|.|+
T Consensus       252 ~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVr-D~~~~~~~~~~~kvd~Vf  330 (588)
T COG1086         252 TVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVR-DRDRVERAMEGHKVDIVF  330 (588)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCC-CHHHHHHHHHCCCCCEEE
T ss_conf             8999689873679999999854987899961763779999999986278751689963534-689999998638886688


Q ss_pred             EEEC----CCCCCCEE-----ECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7612----44433100-----012210134--432012334333320102576212345321123431134554455554
Q gi|254780595|r   70 QCIK----PSSEGDPC-----IISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKE  138 (289)
Q Consensus        70 ~~~~----~~~~~~~~-----~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~  138 (289)
                      |+|+    |..+.++.     ..-.+.+.+  +...++++++.+||.-              ..+|.|.+|.+|..+|+.
T Consensus       331 HAAA~KHVPl~E~nP~Eai~tNV~GT~nv~~aa~~~~V~~~V~iSTDK--------------AV~PtNvmGaTKr~aE~~  396 (588)
T COG1086         331 HAAALKHVPLVEYNPEEAIKTNVLGTENVAEAAIKNGVKKFVLISTDK--------------AVNPTNVMGATKRLAEKL  396 (588)
T ss_pred             EHHHHCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCC--------------CCCCCHHHHHHHHHHHHH
T ss_conf             755553686310188999987217389999999983977899970586--------------668841766889999999


Q ss_pred             HHHCCCCCC---CCCCCCCCCCCCCCCCCH----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEEC
Q ss_conf             320012345---676420347777898503----44431134543222110001024777799999995135-5786162
Q gi|254780595|r  139 WLAITKKLN---IKLAVLRLSGIYGPKRNP----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNL  210 (289)
Q Consensus       139 ~~~~~~~~~---~~~~ilR~~~iyGp~r~~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni  210 (289)
                      +.++.++..   ...+++|+++|.|.....    -.++++|.+..+..++-.+-|.-+.++++.++++.... -|++|-+
T Consensus       397 ~~a~~~~~~~~~T~f~~VRFGNVlGSrGSViPlFk~QI~~GgplTvTdp~mtRyfMTI~EAv~LVlqA~a~~~gGeifvl  476 (588)
T COG1086         397 FQAANRNVSGTGTRFCVVRFGNVLGSRGSVIPLFKKQIAEGGPLTVTDPDMTRFFMTIPEAVQLVLQAGAIAKGGEIFVL  476 (588)
T ss_pred             HHHHHHCCCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99974104888857999982545458877778899999759984546867056788899999999998750689858998


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             6843333899999999995579986343
Q gi|254780595|r  211 SDDEPAPPQNVIMEAASLMKITPPLEQC  238 (289)
Q Consensus       211 ~~~~~~s~~e~~~~i~~~~g~~~~~~~~  238 (289)
                      =-|+|+++.|+++..-...|..++..+.
T Consensus       477 dMGepvkI~dLAk~mi~l~g~~~~~dI~  504 (588)
T COG1086         477 DMGEPVKIIDLAKAMIELAGQTPPGDIA  504 (588)
T ss_pred             CCCCCEEHHHHHHHHHHHHCCCCCCCCC
T ss_conf             1899727999999999981779988877


No 44 
>KOG1372 consensus
Probab=99.75  E-value=1.1e-16  Score=114.61  Aligned_cols=278  Identities=14%  Similarity=0.102  Sum_probs=167.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----HHHHHHC------CCEEEECCCCCCCHHHHHHHC--CCCEE
Q ss_conf             999888-888999999999889889999679446-----3455644------982898067864023465411--56327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----LLTLKHK------GISPFLFADQKINNLLREKLY--FTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----~~~l~~~------~~~~~~~~~~~~~~~~~~~~~--~~~~v   68 (289)
                      -||||- |+=|+.|++.|+.+||+|.|+.|..+.     +..+-..      +.-.....|.++...+...+.  ..+-|
T Consensus        31 ALITGItGQDGSYLaEfLL~KgYeVHGiiRRsSsFNT~RIeHlY~nP~~h~~~~mkLHYgDmTDss~L~k~I~~ikPtEi  110 (376)
T KOG1372          31 ALITGITGQDGSYLAEFLLSKGYEVHGIIRRSSSFNTARIEHLYSNPHTHNGASMKLHYGDMTDSSCLIKLISTIKPTEV  110 (376)
T ss_pred             EEEECCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCHHH
T ss_conf             99962368872699999870885676788604665345577764584002564047853455543889999860582554


Q ss_pred             EEEEC----------CCCCCCEEECCCCCHHHHH----HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             87612----------4443310001221013443----201233433332010257621234532112343113455445
Q gi|254780595|r   69 VQCIK----------PSSEGDPCIISMSKDFYKF----MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN  134 (289)
Q Consensus        69 ~~~~~----------~~~~~~~~~~~~~~~~~~~----~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~  134 (289)
                      .|+++          |....+-......+.+-+.    +.+--||-.+||+..||-....|.+|.+|+.|.++|+.+|+.
T Consensus       111 YnLaAQSHVkvSFdlpeYTAeVdavGtLRlLdAi~~c~l~~~VrfYQAstSElyGkv~e~PQsE~TPFyPRSPYa~aKmy  190 (376)
T KOG1372         111 YNLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIRACRLTEKVRFYQASTSELYGKVQEIPQSETTPFYPRSPYAAAKMY  190 (376)
T ss_pred             HHHHHHCCEEEEECCCHHHEECCCCCHHHHHHHHHHCCCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCHHHHHHHE
T ss_conf             11200032679851422100010200435898998616454526885252765466546875568888889855776441


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--HHH--------HHHCCCC--CCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             555432001234567642034777789850--344--------4311345--4322211000102477779999999513
Q gi|254780595|r  135 AEKEWLAITKKLNIKLAVLRLSGIYGPKRN--PFI--------KIRQKNS--LRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       135 ~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~--~~~--------~~~~g~~--~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      +-..+..|-+.+++=.|--=+++-=.|.|.  ..+        ++.-|..  ..+++-+..+.|=|..|-+.|+..++.+
T Consensus       191 ~~WivvNyREAYnmfAcNGILFNHESPRRGenFVTRKItRsvakI~~gqqe~~~LGNL~a~RDWGhA~dYVEAMW~mLQ~  270 (376)
T KOG1372         191 GYWIVVNYREAYNMFACNGILFNHESPRRGENFVTRKITRSVAKISLGQQEKIELGNLSALRDWGHAGDYVEAMWLMLQQ  270 (376)
T ss_pred             EEEEEEEHHHHHCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             05899884884120131317654778766653135788888878521322257634703420233067799999999713


Q ss_pred             CCCCCEECCCCCHHHHHHHHHHHHHHHCCCCC-C---------------CCCCCCCCCCHHHHHHHCCCCEECHHHHH-H
Q ss_conf             55786162684333389999999999557998-6---------------34310125682446553069451689999-7
Q gi|254780595|r  203 HLGGIFNLSDDEPAPPQNVIMEAASLMKITPP-L---------------EQCFDTANISPFTRFFYADNKRISNAKIK-S  265 (289)
Q Consensus       203 ~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~-~---------------~~~~~~~~~~~~~~~~~~~~~~is~~kl~-~  265 (289)
                      +...-|-++.++..|.+||.+.....+|.... .               .+..++....|....+..    =+.+|++ .
T Consensus       271 d~PdDfViATge~hsVrEF~~~aF~~ig~~l~Weg~gv~~~~~n~~g~v~V~v~~kYyRPtEVd~Lq----GdasKAk~~  346 (376)
T KOG1372         271 DSPDDFVIATGEQHSVREFCNLAFAEIGEVLNWEGEGVDEVGKNDDGVVRVKVDPKYYRPTEVDTLQ----GDASKAKKT  346 (376)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHC----CCHHHHHHH
T ss_conf             7987658862775419999999998637177743555423333678559999664426730223213----776776664


Q ss_pred             CCCCCCCCCHHHHHHHHHHH
Q ss_conf             39844899999999999997
Q gi|254780595|r  266 LGFQLLYPNYRISLKQLWKE  285 (289)
Q Consensus       266 lG~~p~~p~~~~gl~~~~~~  285 (289)
                      |||+|+. +|.|-.++|.++
T Consensus       347 LgW~pkv-~f~eLVkeMv~~  365 (376)
T KOG1372         347 LGWKPKV-TFPELVKEMVAS  365 (376)
T ss_pred             CCCCCCC-CHHHHHHHHHHH
T ss_conf             0998757-689999999986


No 45 
>PRK12320 hypothetical protein; Provisional
Probab=99.70  E-value=4.7e-16  Score=111.11  Aligned_cols=240  Identities=11%  Similarity=0.141  Sum_probs=140.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC-CC
Q ss_conf             93999888-88899999999988988999967944634556449828980678640234654115632787612444-33
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS-EG   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~-~~   78 (289)
                      |+|+|||| |-+|+-++.+|+.+||+|.|+.|.+...   ...+++++-.+..+  ....+...+.|.|+||+.... .-
T Consensus         1 M~i~VT~A~G~lGR~la~rLla~GH~V~Giar~r~~s---~~~~~dFV~A~iRd--~v~~el~~~AD~V~HlA~~~~~~p   75 (699)
T PRK12320          1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDA---LDPRVDYVCASLRN--PVLQELAGEADAVIHLAPVDTSAP   75 (699)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCC---CCCCCCEEECHHHH--HHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             9478834621567789999986687245440479866---67545554211230--999974045554888225568999


Q ss_pred             CEEECCCCCHHH-HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             100012210134-4320123343333201025762123453211234311345544555543200123456764203477
Q gi|254780595|r   79 DPCIISMSKDFY-KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSG  157 (289)
Q Consensus        79 ~~~~~~~~~~~~-~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~  157 (289)
                      +........+.. +......+++|.|+.+      |.+          ..|.    .+|.++    ...+-++.++|.+.
T Consensus        76 ~~~~idG~a~V~~A~a~~G~R~vfvs~Aa------g~p----------~lyr----~~E~lv----a~~~~~~v~iR~A~  131 (699)
T PRK12320         76 GGVGITGLAHVANAAARAGARLLFVSQAA------GRP----------ELYR----QAETLV----STGWAPSLVIRIAP  131 (699)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEECCC------CCH----------HHCC----HHHHHH----HCCCCCEEEEEECC
T ss_conf             85463668899999986188179860578------980----------3315----799998----62488606999615


Q ss_pred             CCCCCCC-HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7789850-344431134543222110001024777799999995135578616268433338999999999955799863
Q gi|254780595|r  158 IYGPKRN-PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE  236 (289)
Q Consensus       158 iyGp~r~-~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~  236 (289)
                      ++|-.-+ ...|... .........+...-+|.||+.+.+...+....+|+.|++.++..++.    .+..+++-..|..
T Consensus       132 ~vGR~lD~~V~R~~A-~~~~~~~Sa~pmqVvHlDD~~R~Lv~Al~~~~sGvVnLAap~~~~~~----~a~~llr~~~P~~  206 (699)
T PRK12320        132 PVGRQLDWMVCRTVA-TLLRSKVSARPIRVLHLDDLVRFLVLALNTDRNGVVDLATPDTTNVV----TAWRLLRSVDPHL  206 (699)
T ss_pred             CCCCCHHHHHHHHHH-HCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCEEECCCCCCHHH----HHHHHHCCCCCCC
T ss_conf             545316789998753-23267777672278757779999999982467774331489851599----9999717778433


Q ss_pred             CCCCCCCCCHHHHHHHCCCCEECHHHHHH-CCCCCCCCCHHHHHHHH
Q ss_conf             43101256824465530694516899997-39844899999999999
Q gi|254780595|r  237 QCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL  282 (289)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~~~~is~~kl~~-lG~~p~~p~~~~gl~~~  282 (289)
                      ..   -........    -..++-+++++ -||+|-. +-.|.+.++
T Consensus       207 r~---~Rv~s~a~l----~P~mD~a~~qe~W~F~~~W-~a~eav~D~  245 (699)
T PRK12320        207 RT---RRVRSWEQL----IPEVDIAAVQEDWNFEFGW-QATEAIVDT  245 (699)
T ss_pred             CC---CCCCCHHHH----CCHHHHHHHHHHHCCCCCC-CHHHHHHHH
T ss_conf             44---457757773----6245588777864888342-247788764


No 46 
>PRK05865 hypothetical protein; Provisional
Probab=99.67  E-value=8.2e-15  Score=104.02  Aligned_cols=197  Identities=15%  Similarity=0.175  Sum_probs=125.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             93999888-88899999999988988999967944634556449828980678640234654115632787612444331
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGD   79 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~   79 (289)
                      |+|+|||| |-+|+-++.+|+.+||+|.|+.|.+...   ...+++ |+..+..+...+.......|.|+||+.......
T Consensus         1 M~i~VT~A~G~lGR~va~qLia~GH~V~GIAr~r~~~---~~~~~D-FV~A~iRd~~~~~~a~~~AD~V~H~A~~~~~~~   76 (854)
T PRK05865          1 MRIAVTGASGVLGRGLTARLLSQGHEVVGIARHRPDS---WPSSAD-FIAADIRDATAVESAMTGADVVAHCAWVRGRND   76 (854)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCC---CCCCCC-EEECCCCCHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             9378833621577789999986687245540579865---675566-663233478999875246654898312158876


Q ss_pred             EEECCCCCHHH-HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             00012210134-43201233433332010257621234532112343113455445555432001234567642034777
Q gi|254780595|r   80 PCIISMSKDFY-KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI  158 (289)
Q Consensus        80 ~~~~~~~~~~~-~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~i  158 (289)
                      ........+.. +....-.+.||.|++.      +         .|         ..|+++.    ..+.++.++|.+.+
T Consensus        77 ~~~idG~a~V~~A~a~aG~r~i~~sqsa------~---------~~---------~~e~~la----~sg~~~v~iR~A~~  128 (854)
T PRK05865         77 HINIDGTANVLKAMAETGTGRIVFTSSG------H---------QP---------RVEQMLA----DCGLEWVAVRCALI  128 (854)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEECCC------C---------CH---------HHHHHHH----HCCCCEEEEEECCC
T ss_conf             4462768899999986188369981588------8---------56---------6999998----53897169996155


Q ss_pred             CCCCCCHH-HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             78985034-4431134543222110001024777799999995135--578616268433338999999999955799
Q gi|254780595|r  159 YGPKRNPF-IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAASLMKITP  233 (289)
Q Consensus       159 yGp~r~~~-~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~~~i~~~~g~~~  233 (289)
                      +|-.-+.+ .|...-....-...++...-+|.||+.+.+...+...  .+|+.|++.+...++..+    +..++.+.
T Consensus       129 vGR~lD~~V~R~~Al~~~~~~~s~~pmrVlHlDD~~R~Lv~Al~t~~~~sGvVdLAap~~~~~~~~----a~~L~r~~  202 (854)
T PRK05865        129 FGRNVDNWVQRLFALPVLPAGYADRVVQVVHSDDAQRLLVRALLDTVIDSGPVNLAAPGELTFRRI----AAALGRPM  202 (854)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCHHHH----HHHHCCCC
T ss_conf             453157899988766413465566633787577899999999732666676233248997619999----99965887


No 47 
>KOG2865 consensus
Probab=99.64  E-value=4.4e-15  Score=105.57  Aligned_cols=211  Identities=16%  Similarity=0.218  Sum_probs=146.0

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHH---CCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             999888-888999999999889889999679-446345564---498289806786402346541156327876124443
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRS-VSNLLTLKH---KGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~-~~~~~~l~~---~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      ..|.|| ||+|..++++|.+.|-+|+.--|. +.....+.-   .|--.+..-+..+...+.........||++++...+
T Consensus        64 aTVFGAtGFlGryvvnklak~GSQviiPyR~d~~~~r~lkvmGdLGQvl~~~fd~~DedSIr~vvk~sNVVINLIGrd~e  143 (391)
T KOG2865          64 ATVFGATGFLGRYVVNKLAKMGSQVIIPYRGDEYDPRHLKVMGDLGQVLFMKFDLRDEDSIRAVVKHSNVVINLIGRDYE  143 (391)
T ss_pred             EEEECCCCCCCHHHHHHHHHCCCEEEEECCCCCCCHHHEEECCCCCCEEEECCCCCCHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             99852644120899998863587699853588644545000254333456416777879999998747579984035344


Q ss_pred             C-----CEEECCCCCHHHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             3-----1000122101344320--12334333320102576212345321123431134554455554320012345676
Q gi|254780595|r   78 G-----DPCIISMSKDFYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL  150 (289)
Q Consensus        78 ~-----~~~~~~~~~~~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~  150 (289)
                      +     .++.....+.++..++  .+.|+|++|+-+.  +           ....+.+-.+|.++|.++++..-+    .
T Consensus       144 Tknf~f~Dvn~~~aerlAricke~GVerfIhvS~Lga--n-----------v~s~Sr~LrsK~~gE~aVrdafPe----A  206 (391)
T KOG2865         144 TKNFSFEDVNVHIAERLARICKEAGVERFIHVSCLGA--N-----------VKSPSRMLRSKAAGEEAVRDAFPE----A  206 (391)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCHHHEEEHHHCCC--C-----------CCCHHHHHHHHHHHHHHHHHHCCC----C
T ss_conf             5886612001458999999998628352541654566--5-----------457678877653237999863874----4


Q ss_pred             CCCCCCCCCCCC-CC--HHHHH--HCCCCCCCCCCCC-EECCHHHHHHHHHHHHHHCCC--CCCCEECCCCCHHHHHHHH
Q ss_conf             420347777898-50--34443--1134543222110-001024777799999995135--5786162684333389999
Q gi|254780595|r  151 AVLRLSGIYGPK-RN--PFIKI--RQKNSLRLVKKNQ-VFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVI  222 (289)
Q Consensus       151 ~ilR~~~iyGp~-r~--~~~~~--~~g~~~~~~~~~~-~~~~ihv~Dva~~i~~l~~~~--~~~iyni~~~~~~s~~e~~  222 (289)
                      +|+||+.|||.. |-  .+..+  +-|..+.+.+|.. +...|||.|||.+|..+.+.+  .|.+|-.+.++.....|++
T Consensus       207 tIirPa~iyG~eDrfln~ya~~~rk~~~~pL~~~GekT~K~PVyV~DVaa~IvnAvkDp~s~Gktye~vGP~~yql~eLv  286 (391)
T KOG2865         207 TIIRPADIYGTEDRFLNYYASFWRKFGFLPLIGKGEKTVKQPVYVVDVAAAIVNAVKDPDSMGKTYEFVGPDRYQLSELV  286 (391)
T ss_pred             EEECHHHHCCCCHHHHHHHHHHHHHCCCEEEECCCCCEEECCEEEEHHHHHHHHHCCCCCCCCCEEEECCCCHHHHHHHH
T ss_conf             35242551155136778999998733734510477514634578751889999860394225845661387221099999


Q ss_pred             HHHHHHHC
Q ss_conf             99999955
Q gi|254780595|r  223 MEAASLMK  230 (289)
Q Consensus       223 ~~i~~~~g  230 (289)
                      +++.+..-
T Consensus       287 d~my~~~~  294 (391)
T KOG2865         287 DIMYDMAR  294 (391)
T ss_pred             HHHHHHHH
T ss_conf             99999975


No 48 
>KOG1221 consensus
Probab=99.53  E-value=2.6e-13  Score=95.42  Aligned_cols=227  Identities=19%  Similarity=0.179  Sum_probs=134.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC---CEEEEEECCHHHH------HHH---------HH------CCCEEEECCCCCCC-
Q ss_conf             3999888-888999999999889---8899996794463------455---------64------49828980678640-
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG---VYTCGTTRSVSNL------LTL---------KH------KGISPFLFADQKIN-   55 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g---~~V~~~~r~~~~~------~~l---------~~------~~~~~~~~~~~~~~-   55 (289)
                      .|||||+ ||+|..++++|++.-   -+++.+.|.+.+.      ...         .+      ..+.++.+|...++ 
T Consensus        14 ~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~pi~GDi~~~~L   93 (467)
T KOG1221          14 TIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVPIAGDISEPDL   93 (467)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCEECCCCCCCCCC
T ss_conf             59997276345789999998507676569999834789877899999874469999986395210200001256668666


Q ss_pred             ----HHHHHHHCCCCEEEEEECCCCCCCEEECCC------CC---HHHHHHHCCCCCCCCCCEEECCC-----------C
Q ss_conf             ----234654115632787612444331000122------10---13443201233433332010257-----------6
Q gi|254780595|r   56 ----NLLREKLYFTTHIVQCIKPSSEGDPCIISM------SK---DFYKFMPHVKWIGYLSSTSIYGN-----------R  111 (289)
Q Consensus        56 ----~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~------~~---~~~~~~~~~~~~i~~SS~~VYg~-----------~  111 (289)
                          .........++.|+|+++-....++.....      ..   .++..+.+.+-++|+||+++.-.           .
T Consensus        94 Gis~~D~~~l~~eV~ivih~AAtvrFde~l~~al~iNt~Gt~~~l~lak~~~~l~~~vhVSTAy~n~~~~~i~E~~y~~~  173 (467)
T KOG1221          94 GISESDLRTLADEVNIVIHSAATVRFDEPLDVALGINTRGTRNVLQLAKEMVKLKALVHVSTAYSNCNVGHIEEKPYPMP  173 (467)
T ss_pred             CCCHHHHHHHHHCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEHHHEECCCCCCCCCCCCCC
T ss_conf             88827788887457789995304225536656542222748999999998521126898421222246665210256764


Q ss_pred             C---CC-C--CCCC---------CC-C--CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHH----HHH
Q ss_conf             2---12-3--4532---------11-2--34311345544555543200123456764203477778985034----443
Q gi|254780595|r  112 E---GQ-W--VDEH---------SF-V--HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF----IKI  169 (289)
Q Consensus       112 ~---g~-~--i~E~---------~~-~--~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~~----~~~  169 (289)
                      .   .. .  .+|+         .| +  ...+-|..+|..+|..+.++  ..++|++|+||+.|...-+.++    +.+
T Consensus       174 ~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~--~~~lPivIiRPsiI~st~~EP~pGWidn~  251 (467)
T KOG1221         174 ETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKE--AENLPLVIIRPSIITSTYKEPFPGWIDNL  251 (467)
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHH--CCCCCEEEECCCCEECCCCCCCCCCCCCC
T ss_conf             5589888876432221899987647750899986301186589999852--64898699748741013337998703268


Q ss_pred             H----------CCCC-CCCCCCCCEECCHHHHHHHHHHHHHH-CC--CC----CCCEECCC--CCHHHHHHHHHHHHHHH
Q ss_conf             1----------1345-43222110001024777799999995-13--55----78616268--43333899999999995
Q gi|254780595|r  170 R----------QKNS-LRLVKKNQVFNRIRVEDVARCVIFLM-TH--HL----GGIFNLSD--DEPAPPQNVIMEAASLM  229 (289)
Q Consensus       170 ~----------~g~~-~~~~~~~~~~~~ihv~Dva~~i~~l~-~~--~~----~~iyni~~--~~~~s~~e~~~~i~~~~  229 (289)
                      .          .|.. ....+++.....|.+|.++++++.+. ..  ..    -.+||+++  ..|+++.++++...+..
T Consensus       252 ~gp~g~i~g~gkGvlr~~~~d~~~vadiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~t~~~~~e~~~~~~  331 (467)
T KOG1221         252 NGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPVTWGDFIELALRYF  331 (467)
T ss_pred             CCCCEEEEEECCCEEEEEEECCCCCCCEEEHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHC
T ss_conf             78754789850225999987655466551289999999999999850488899867985355657610899999999743


Q ss_pred             C
Q ss_conf             5
Q gi|254780595|r  230 K  230 (289)
Q Consensus       230 g  230 (289)
                      .
T Consensus       332 ~  332 (467)
T KOG1221         332 E  332 (467)
T ss_pred             C
T ss_conf             1


No 49 
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=99.48  E-value=4.1e-13  Score=94.35  Aligned_cols=195  Identities=17%  Similarity=0.128  Sum_probs=123.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC-CCC
Q ss_conf             93999888-8889999999998898899996794463455644982898067864023465411563278761244-433
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS-SEG   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~~~   78 (289)
                      |||-|+|| |.+|+++.+++.++||+|++++|++.+...+  .++.....|.. +...+...+.+.|.|+.+.... ...
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~--~~~~i~q~Dif-d~~~~a~~l~g~DaVIsA~~~~~~~~   77 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAAR--QGVTILQKDIF-DLTSLASDLAGHDAVISAFGAGASDN   77 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCC--CCCEEECCCCC-CHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9078995374567999999986798048998076766522--35302000222-74566766358766997215788871


Q ss_pred             CEEECCCCCHHHHHHH--CCCCCCCCCCE-EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             1000122101344320--12334333320-10257621234532112343113455445555432001234567642034
Q gi|254780595|r   79 DPCIISMSKDFYKFMP--HVKWIGYLSST-SIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL  155 (289)
Q Consensus        79 ~~~~~~~~~~~~~~~~--~~~~~i~~SS~-~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~  155 (289)
                      +.........+....+  .++|++-+... |.|=+..-..  .++|.-|...+...+..+|. +..+-.+.+++++-+-|
T Consensus        78 ~~~~~k~~~~li~~l~~agv~RllVVGGAGSL~id~g~rL--vD~p~fP~ey~~~A~~~ae~-L~~Lr~~~~l~WTfvSP  154 (211)
T COG2910          78 DELHSKSIEALIEALKGAGVPRLLVVGGAGSLEIDEGTRL--VDTPDFPAEYKPEALAQAEF-LDSLRAEKSLDWTFVSP  154 (211)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEECCCCEE--ECCCCCCHHHHHHHHHHHHH-HHHHHHCCCCCEEEECC
T ss_conf             5778889999999986159705999847420587688455--05899856677999877899-99986356764599671


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             777789850344431134543222110001024777799999995135
Q gi|254780595|r  156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       156 ~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      +..|-||. .--.++.|......+. .--|+|-..|.|-+++--++++
T Consensus       155 aa~f~PGe-rTg~yrlggD~ll~n~-~G~SrIS~aDYAiA~lDe~E~~  200 (211)
T COG2910         155 AAFFEPGE-RTGNYRLGGDQLLVNA-KGESRISYADYAIAVLDELEKP  200 (211)
T ss_pred             HHHCCCCC-CCCCEEECCCEEEECC-CCCEEEEHHHHHHHHHHHHHCC
T ss_conf             78457765-5685676363577748-8850344899999999877464


No 50 
>KOG2774 consensus
Probab=99.37  E-value=2.9e-11  Score=83.82  Aligned_cols=225  Identities=14%  Similarity=0.186  Sum_probs=134.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHH--CCCCEEEEEEC---C
Q ss_conf             3999888-8889999999998-89889999679446345564498289806786402346541--15632787612---4
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALK-VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL--YFTTHIVQCIK---P   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~-~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~v~~~~~---~   74 (289)
                      ||||||+ |++|..+++.|.. .|-+-..++.-.+......+  .-++++.|.-+...+.++.  ..+|-++|-.+   .
T Consensus        46 rvLITG~LGQLG~~~A~LLR~~yGs~~VILSDI~KPp~~V~~--~GPyIy~DILD~K~L~eIVVn~RIdWL~HfSALLSA  123 (366)
T KOG2774          46 RVLITGSLGQLGRGLASLLRYMYGSECVILSDIVKPPANVTD--VGPYIYLDILDQKSLEEIVVNKRIDWLVHFSALLSA  123 (366)
T ss_pred             EEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHCC--CCCEEEHHHHCCCCHHHHHHCCEEEEEEHHHHHHHH
T ss_conf             588845536776889999999847763760103588554325--687543245420147887534511021119999987


Q ss_pred             CCCCC-----EEECCCCCHHHHHHHCCC-CCCCCCCEEECCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             44331-----000122101344320123-3433332010257621234532-1123431134554455554320012345
Q gi|254780595|r   75 SSEGD-----PCIISMSKDFYKFMPHVK-WIGYLSSTSIYGNREGQWVDEH-SFVHPISCVATQRFNAEKEWLAITKKLN  147 (289)
Q Consensus        75 ~~~~~-----~~~~~~~~~~~~~~~~~~-~~i~~SS~~VYg~~~g~~i~E~-~~~~P~~~y~~~k~~~E~~~~~~~~~~~  147 (289)
                      -++.+     .+......++....+.-+ ++.-.||.+.||-+....-+.+ +-..|.+.||.+|+.+|-+-.-+....|
T Consensus       124 vGE~NVpLA~~VNI~GvHNil~vAa~~kL~iFVPSTIGAFGPtSPRNPTPdltIQRPRTIYGVSKVHAEL~GEy~~hrFg  203 (366)
T KOG2774         124 VGETNVPLALQVNIRGVHNILQVAAKHKLKVFVPSTIGAFGPTSPRNPTPDLTIQRPRTIYGVSKVHAELLGEYFNHRFG  203 (366)
T ss_pred             HCCCCCCCEEEECCHHHHHHHHHHHHHCEEEEECCCCCCCCCCCCCCCCCCCEECCCCEEECHHHHHHHHHHHHHHHHCC
T ss_conf             51157741356510436689999987073686024334568999999899813226731203358899999999886507


Q ss_pred             CCCCCCCCCCCCC---CCCCH--------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----CCCCEECCC
Q ss_conf             6764203477778---98503--------44431134543222110001024777799999995135----578616268
Q gi|254780595|r  148 IKLAVLRLSGIYG---PKRNP--------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----LGGIFNLSD  212 (289)
Q Consensus       148 ~~~~ilR~~~iyG---p~r~~--------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----~~~iyni~~  212 (289)
                      ++...+|.+++..   ||...        ...+++|+......++-.....|.+|+.++++.++..+    +..+||++.
T Consensus       204 ~dfr~~rfPg~is~~~pgggttdya~A~f~~Al~~gk~tCylrpdtrlpmmy~~dc~~~~~~~~~a~~~~lkrr~ynvt~  283 (366)
T KOG2774         204 VDFRSMRFPGIISATKPGGGTTDYAIAIFYDALQKGKHTCYLRPDTRLPMMYDTDCMASVIQLLAADSQSLKRRTYNVTG  283 (366)
T ss_pred             CCCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHEEEEEE
T ss_conf             54000247751026899998531145530788865886655477765740015889999999986888875554150000


Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             43333899999999995
Q gi|254780595|r  213 DEPAPPQNVIMEAASLM  229 (289)
Q Consensus       213 ~~~~s~~e~~~~i~~~~  229 (289)
                       --.+-+|++..+.+.+
T Consensus       284 -~sftpee~~~~~~~~~  299 (366)
T KOG2774         284 -FSFTPEEIADAIRRVM  299 (366)
T ss_pred             -ECCCHHHHHHHHHHHC
T ss_conf             -1058899999997228


No 51 
>PRK05693 short chain dehydrogenase; Provisional
Probab=99.21  E-value=1.9e-09  Score=73.36  Aligned_cols=147  Identities=12%  Similarity=0.097  Sum_probs=94.6

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEEEE
Q ss_conf             93-999888-8889999999998898899996794463455644982898067864023------465411563278761
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL------LREKLYFTTHIVQCI   72 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~   72 (289)
                      || +||||| +=||..++++|.++|++|++..|+.++...+...++..+..|..+.+..      +......+|.+++++
T Consensus         1 MKvvlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dvtd~~~i~~~~~~~~~~~g~iDiLVNNA   80 (274)
T PRK05693          1 MPVVLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAAAGFTAVQLDVNDGAALARLAEELEAEHQGLDVLINNA   80 (274)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99899948885899999999998799999997999999999848991899846998999999999999729976899888


Q ss_pred             CCCCCC-------CEEECCCCCHH----------HHH-HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             244433-------10001221013----------443-201233433332010257621234532112343113455445
Q gi|254780595|r   73 KPSSEG-------DPCIISMSKDF----------YKF-MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN  134 (289)
Q Consensus        73 ~~~~~~-------~~~~~~~~~~~----------~~~-~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~  134 (289)
                      +.....       +.....+..|+          .-. ..+-.++|.+||.+-+  ..       .|.  .+.|+.+|.+
T Consensus        81 G~~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~G~IVnisS~ag~--~~-------~p~--~~~Y~aSK~A  149 (274)
T PRK05693         81 GYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRSRGLVVNIGSVSGV--LV-------TPF--AGAYCASKAA  149 (274)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHC--CC-------CCC--CHHHHHHHHH
T ss_conf             677887589876899999999981999999999999997589679998140532--68-------999--7379999999


Q ss_pred             HHHHH---HHCCCCCCCCCCCCCCCCC
Q ss_conf             55543---2001234567642034777
Q gi|254780595|r  135 AEKEW---LAITKKLNIKLAVLRLSGI  158 (289)
Q Consensus       135 ~E~~~---~~~~~~~~~~~~ilR~~~i  158 (289)
                      .|...   +......|+.++.+-|+.|
T Consensus       150 l~~~s~sLr~El~~~gI~V~~v~PG~i  176 (274)
T PRK05693        150 VHALSDALRLELAPFGVQVMEVQPGAI  176 (274)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             999999999984202878999971888


No 52 
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=99.17  E-value=8.1e-10  Score=75.52  Aligned_cols=191  Identities=15%  Similarity=0.101  Sum_probs=106.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCH---HH---HHHHCCCCEEEE
Q ss_conf             93999888-8889999999998898899996794463455644---98289806786402---34---654115632787
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINN---LL---REKLYFTTHIVQ   70 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~   70 (289)
                      |-+||||| +=||..+++.|.++|++|..+.|+.++...+...   .+..+..|..+.+.   .+   ......+|.+++
T Consensus         1 mVvlVTGassGIG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~lg~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iDiLVn   80 (248)
T PRK10538          1 MIVLVTGATAGFGECITRRFIQNGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEWRNIDILVN   80 (248)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99999888669999999999987999999989999999999984886799997348889999999999997099759997


Q ss_pred             EECCCCCCCEE----ECC----CCCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             61244433100----012----2101----------34432--0123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGDPC----IIS----MSKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~~~----~~~----~~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++-.....+.    ...    +..|          ....+  .+-.++|++||++-.           .+......|+.
T Consensus        81 NAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~-----------~~~~~~~~Y~a  149 (248)
T PRK10538         81 NAGLALGLEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAGS-----------WPYAGGNVYGA  149 (248)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC-----------CCCCCCHHHHH
T ss_conf             7854678886376899999877752413199999998676663599589999360007-----------88999688999


Q ss_pred             HHHHHHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHH-CCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             5445555432001---234567642034777789850344431-13454322211000102477779999999513557
Q gi|254780595|r  131 QRFNAEKEWLAIT---KKLNIKLAVLRLSGIYGPKRNPFIKIR-QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG  205 (289)
Q Consensus       131 ~k~~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~r~~~~~~~-~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~  205 (289)
                      +|...+.+.+..+   ..+|+.+..+.|+.|=.+.   +..+. .+......+.-.......-+|+|+++.++...+..
T Consensus       150 sKaal~~~t~~La~El~~~gIrVn~v~PG~v~t~~---~~~~~~~~~~~~~~~~~~~~~~l~PedVA~av~fl~s~p~~  225 (248)
T PRK10538        150 TKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTE---FSNVRFKGDDGKAEKTYQNTVALTPEDVSEAVWWVATLPAH  225 (248)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCC---HHCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             99999999999999847868599999847576841---11145567688897403578999999999999999829998


No 53 
>PRK08017 short chain dehydrogenase; Provisional
Probab=99.15  E-value=9.1e-10  Score=75.24  Aligned_cols=191  Identities=14%  Similarity=0.067  Sum_probs=107.9

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH---HHHH---H-CCCCEEEEEECC
Q ss_conf             999888-8889999999998898899996794463455644982898067864023---4654---1-156327876124
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL---LREK---L-YFTTHIVQCIKP   74 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~---~~~~---~-~~~~~v~~~~~~   74 (289)
                      |||||| +=||..++++|.++|++|++..|++++...+...+.+.+..|..+.+..   ..+.   . ...|.++++++.
T Consensus         5 vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~g~id~linnAG~   84 (256)
T PRK08017          5 VLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMNSMGFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGF   84 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             99965876899999999998799999996998999999856994699835898999999999999848974899988966


Q ss_pred             CCCC-------CEEECCCCCHHH-------HHH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4433-------100012210134-------432-----012334333320102576212345321123431134554455
Q gi|254780595|r   75 SSEG-------DPCIISMSKDFY-------KFM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        75 ~~~~-------~~~~~~~~~~~~-------~~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      ....       +.....+..|+.       +..     .+-.++|++||.+-+-  .       .  --...|+.+|.+.
T Consensus        85 ~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IV~isS~ag~~--~-------~--p~~~~Y~asKaal  153 (256)
T PRK08017         85 GVYGPLSTISRQQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLI--S-------T--PGRGAYAASKYAL  153 (256)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCEEEEEECHHHCC--C-------C--CCCHHHHHHHHHH
T ss_conf             778885876645334676321133202766417122104894499995766648--8-------9--9974899999999


Q ss_pred             HHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHCCC-CCCCCCCC--CEECCHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             55432001---234567642034777789850344431134-54322211--000102477779999999513557861
Q gi|254780595|r  136 EKEWLAIT---KKLNIKLAVLRLSGIYGPKRNPFIKIRQKN-SLRLVKKN--QVFNRIRVEDVARCVIFLMTHHLGGIF  208 (289)
Q Consensus       136 E~~~~~~~---~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~-~~~~~~~~--~~~~~ihv~Dva~~i~~l~~~~~~~iy  208 (289)
                      +...+...   ...|+.+..+.|+.|--|   ..+...+.. ......++  +.+ ..--++||+.++..++.+...++
T Consensus       154 ~~~~~sL~~El~~~gI~V~~V~PG~v~T~---~~~~~~~~~~~~~~~~~~~~~~~-~~~pe~vA~~i~~ai~~~~~~~~  228 (256)
T PRK08017        154 EAWSDALRMELRHSGIKVSLIEPGPIRTR---FTDNVNQTQSDKPVENPGIAARF-TLGPEAVVDKVRHAFESPKPKLR  228 (256)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCH---HHCCCCCCCCCCCCCCCCHHHCC-CCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             99999999984621928999972899772---01052511333544351023114-79999999999999956998399


No 54 
>PRK06101 short chain dehydrogenase; Provisional
Probab=99.13  E-value=9.7e-10  Score=75.09  Aligned_cols=185  Identities=15%  Similarity=0.076  Sum_probs=105.2

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC--CEEEECCCCCCCH---HHHHHHCCCCEEEEEEC
Q ss_conf             93-999888-88899999999988988999967944634556449--8289806786402---34654115632787612
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG--ISPFLFADQKINN---LLREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~--~~~~~~~~~~~~~---~~~~~~~~~~~v~~~~~   73 (289)
                      || |||||| +=||..++++|.++|++|+.+.|+.+....+....  +..+..|..+.++   .+.+.....|.++++++
T Consensus         1 MktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~~~~~~~~~~Dvtd~~~~~~~~~~~~~~~d~~i~naG   80 (241)
T PRK06101          1 MTSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQSSNIFTLAFDVTDYEETKAALSQLPFIPELWIFNAG   80 (241)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             99899922404999999999998799899998999999999973288048985226799999999971877778999886


Q ss_pred             CCCCCCEE---E----CCCCCHH----------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             44433100---0----1221013----------44320123343333201025762123453211234311345544555
Q gi|254780595|r   74 PSSEGDPC---I----ISMSKDF----------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        74 ~~~~~~~~---~----~~~~~~~----------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      .....+..   .    ..+..|+          .....+-.+++.+||.+-+-   +      .|  ....|+.+|.+..
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~~p~m~~~~~iv~isS~a~~~---~------~p--~~~~Y~ASKaal~  149 (241)
T PRK06101         81 DCEYMDDGIVDAQLMARVFNVNVVGVANCIEACQPHFQRGHRVVIVGSIASEL---A------LP--RAEAYGASKAAVS  149 (241)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCC---C------CC--CCHHHHHHHHHHH
T ss_conf             66768734489999999999988999999999999987389505775401056---8------89--8468899999999


Q ss_pred             HHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             543200---1234567642034777789850344431134543222110001024777799999995135578616
Q gi|254780595|r  137 KEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN  209 (289)
Q Consensus       137 ~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iyn  209 (289)
                      ...+..   ...+|+.++.+.|+.|--|    |..   +....  .+    -.+..+++|+.++..++++...+|-
T Consensus       150 ~~~~sLa~el~~~gI~V~~V~PG~v~T~----m~~---~~~~~--~p----~~~~~e~~A~~i~~~i~~~k~~i~~  212 (241)
T PRK06101        150 YFARTLALDLKKKGIKVVTVFPGFVATP----LTD---KNTFA--MP----MIITVEQASQAIRKQLAAGKSHIYF  212 (241)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEECCCCCC----CCC---CCCCC--CC----CCCCHHHHHHHHHHHHHCCCCEEEC
T ss_conf             9999999985254958999971899388----877---89988--98----7579999999999999749979996


No 55 
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=99.12  E-value=2.5e-09  Score=72.79  Aligned_cols=202  Identities=16%  Similarity=0.180  Sum_probs=111.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHC-CCEEEECCCCCCCH---HHH---HHHCCCCEE
Q ss_conf             93999888-888999999999889889999679446345----5644-98289806786402---346---541156327
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHK-GISPFLFADQKINN---LLR---EKLYFTTHI   68 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~-~~~~~~~~~~~~~~---~~~---~~~~~~~~v   68 (289)
                      |||||||+ +=||..+++.|.++|++|....|+.++...    +... ++..+..|..+.+.   .+.   +....+|.+
T Consensus         1 mnVlITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD~L   80 (259)
T PRK08340          1 MNVLVTASSRGIGFNVARELLKKGARVVISSRNEENLEKALKELKELGEVYAIKADLSDKDDLKNLVKEAWELLGGIDAL   80 (259)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             98999758778999999999987999999979989999999998741887999963699899999999999985998889


Q ss_pred             EEEECCCC-----CCCEEECC----CCCHH----------H-HHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             87612444-----33100012----21013----------4-432--012334333320102576212345321123431
Q gi|254780595|r   69 VQCIKPSS-----EGDPCIIS----MSKDF----------Y-KFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        69 ~~~~~~~~-----~~~~~~~~----~~~~~----------~-~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      +++++...     ..+.....    ...++          . ...  ..-.++|++||.+...           +..+..
T Consensus        81 VnNAg~~~~~p~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~G~Ii~isS~~~~~-----------~~~~~~  149 (259)
T PRK08340         81 VWNAGNVKCEPCMLHEAGYSDWLEAALLHLVAPGYLTTLLLQTWLEKKMKGVLVYLSSVSVKE-----------PMPPLL  149 (259)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHEEEC-----------CCCCHH
T ss_conf             985766778974335499999999999871559999999999999865886499972121025-----------578626


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHHHHHHCCCCCCC--------CCCCCEECCHHHHHHHH
Q ss_conf             1345544555543200123---45676420347777898-503444311345432--------22110001024777799
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPFIKIRQKNSLRL--------VKKNQVFNRIRVEDVAR  194 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~~~~~~g~~~~~--------~~~~~~~~~ihv~Dva~  194 (289)
                      .|+.+|...+.+.+..+.+   +|+.+-.+-|+.+--|+ +..+.++........        ......--+-..+|+|+
T Consensus       150 ~y~asKaal~~ltk~lA~e~~~~gIrvN~v~pG~i~tp~~~~~~~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~  229 (259)
T PRK08340        150 LADVTRAGLVQLAKGVSRTYGGRGIRAYTVLLGSFDTPGARENLARIAEERGVSPEETWEKEVLERTPLHRTGRWEELGS  229 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHH
T ss_conf             89998899999999999998422919999854889896367789999987289978999999970899999859999999


Q ss_pred             HHHHHHCCCC----CCCEECCCC
Q ss_conf             9999951355----786162684
Q gi|254780595|r  195 CVIFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       195 ~i~~l~~~~~----~~iyni~~~  213 (289)
                      ++.+|+....    |++..+-.+
T Consensus       230 ~v~fL~Sd~a~~iTG~~i~VDGG  252 (259)
T PRK08340        230 LIAFLLSENAEYMLGSTIVFDGA  252 (259)
T ss_pred             HHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999586426821823899965


No 56 
>KOG1203 consensus
Probab=99.11  E-value=9.6e-10  Score=75.11  Aligned_cols=190  Identities=15%  Similarity=0.120  Sum_probs=98.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----CCCEEEECCCCCCCHHHHHHHCC----CCEEEE
Q ss_conf             93999888-888999999999889889999679446345564-----49828980678640234654115----632787
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-----KGISPFLFADQKINNLLREKLYF----TTHIVQ   70 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-----~~~~~~~~~~~~~~~~~~~~~~~----~~~v~~   70 (289)
                      |.|||.|| |.+|+.+++.|+++||.|+++.|+..+...+..     .+.+.+..+.......+......    ...++-
T Consensus        80 ~~VlVvGatG~vG~~iv~~llkrgf~vra~VRd~~~a~~~~~~~~~d~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~v~~  159 (411)
T KOG1203          80 TTVLVVGATGKVGRRIVKILLKRGFSVRALVRDEQKAEDLLGVFFVDLGLQNVEADVVTAIDILKKLVEAVPKGVVIVIK  159 (411)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCCCCCCCCEEEECCCCCCCHHHHHHHHCCCCCEEEEE
T ss_conf             74999558873639999999977970234215736554443253334442224302256541225666301345315874


Q ss_pred             EECCCCCC------CEEECCCCCHHHHH--HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHH
Q ss_conf             61244433------10001221013443--2012334333320102576212345321123431---1345544555543
Q gi|254780595|r   71 CIKPSSEG------DPCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS---CVATQRFNAEKEW  139 (289)
Q Consensus        71 ~~~~~~~~------~~~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~---~y~~~k~~~E~~~  139 (289)
                      ++....+.      +.+-....+++..+  ...++|++++|+.+.   ++     =+.+++...   .+-.+|..+|   
T Consensus       160 ~~ggrp~~ed~~~p~~VD~~g~knlvdA~~~aGvk~~vlv~si~~---~~-----~~~~~~~~~~~~~~~~~k~~~e---  228 (411)
T KOG1203         160 GAGGRPEEEDIVTPEKVDYEGTKNLVDACKKAGVKRVVLVGSIGG---TK-----FNQPPNILLLNGLVLKAKLKAE---  228 (411)
T ss_pred             CCCCCCCCCCCCCCCEECHHHHHHHHHHHHHHCCCEEEEEEEECC---CC-----CCCCCHHHHHHHHHHHHHHHHH---
T ss_conf             234778754578844216788899999999838745999976347---64-----6777255555443567877699---


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             2001234567642034777789850344431134543222110001024777799999995135
Q gi|254780595|r  140 LAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       140 ~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                       ++.++.|++++|+|+++..-+ ..................+..--.|-..|+|+.++.++.+.
T Consensus       229 -~~~~~Sgl~ytiIR~g~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~i~r~~vael~~~all~~  290 (411)
T KOG1203         229 -KFLQDSGLPYTIIRPGGLEQD-TGGQREVVVDDEKELLTVDGGAYSISRLDVAELVAKALLNE  290 (411)
T ss_pred             -HHHHHCCCCCEEEECCCCCCC-CCCCCEECCCCCCCCCCCCCCCEEEEHHHHHHHHHHHHHHH
T ss_conf             -999865898679953210048-88710111457421123345532561146899999987302


No 57 
>PRK07102 short chain dehydrogenase; Provisional
Probab=99.03  E-value=2.1e-09  Score=73.19  Aligned_cols=185  Identities=11%  Similarity=0.103  Sum_probs=103.5

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CC---CEEEECCCCCCC---HHHHHHHCCCCEE
Q ss_conf             93-999888-888999999999889889999679446345564----49---828980678640---2346541156327
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KG---ISPFLFADQKIN---NLLREKLYFTTHI   68 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~---~~~~~~~~~~~~---~~~~~~~~~~~~v   68 (289)
                      || |||||| +=||..++++|.++|++|..+.|+.+++..+..    .+   +..+..|..+.+   ..+.......|.+
T Consensus         1 MK~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~d~~   80 (243)
T PRK07102          1 MKKILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPALPDTV   80 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEE
T ss_conf             99799915745999999999998799899998988999999999985358628998434036999999999987537979


Q ss_pred             EEEECCCCCC---CEEE----CCCCCHHHH-------H---H--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000----122101344-------3---2--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCI----ISMSKDFYK-------F---M--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~----~~~~~~~~~-------~---~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +...    .....|+..       .   .  .+-.++|.+||.+-+-   +.      |  ....|+
T Consensus        81 v~~aG~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~~~m~~~~~G~Iv~isS~ag~~---g~------p--~~~~Y~  149 (243)
T PRK07102         81 LIAVGTLGDQAACEADPALALREFRTNFEGPIALLTLLANRFEARGSGTIVGISSVAGDR---GR------A--SNYVYG  149 (243)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC---CC------C--CCCHHH
T ss_conf             997303678730239999999999999899999999999998872397499982566477---89------9--982699


Q ss_pred             HHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             5544555543200---1234567642034777789850344431134543222110001024777799999995135578
Q gi|254780595|r  130 TQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG  206 (289)
Q Consensus       130 ~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~  206 (289)
                      .+|.+.+...+..   ...+|+.++.+.|+.|=    .++..   +..  .  +...  ...-+++|+.++..++++...
T Consensus       150 aSKaal~~~~~sL~~El~~~gI~V~~v~PG~v~----T~m~~---~~~--~--~~~~--~~~pe~vA~~i~~ai~~~k~~  216 (243)
T PRK07102        150 SAKAALTAFLSGLRNRLFKSGVHVLTVKPGFVD----TPMTA---GLK--L--PGPL--TAQPEEVAKDIFRAIEKGKDV  216 (243)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCC----CCCCC---CCC--C--CCCC--CCCHHHHHHHHHHHHHCCCCE
T ss_conf             999999999999999850209199999718896----75666---899--9--8877--699999999999999769989


Q ss_pred             CEE
Q ss_conf             616
Q gi|254780595|r  207 IFN  209 (289)
Q Consensus       207 iyn  209 (289)
                      +|-
T Consensus       217 i~~  219 (243)
T PRK07102        217 LYT  219 (243)
T ss_pred             EEC
T ss_conf             985


No 58 
>PRK05993 short chain dehydrogenase; Provisional
Probab=99.00  E-value=2.6e-09  Score=72.64  Aligned_cols=146  Identities=16%  Similarity=0.166  Sum_probs=92.3

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH---HHHHH----CCCCEEEEEECC
Q ss_conf             999888-8889999999998898899996794463455644982898067864023---46541----156327876124
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL---LREKL----YFTTHIVQCIKP   74 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~---~~~~~----~~~~~v~~~~~~   74 (289)
                      |||||| .=||..+++.|.++|++|+++.|+.++...+...+++.+..|..+.+..   .....    ..+|.++++++.
T Consensus         7 vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g~id~lvNnAg~   86 (277)
T PRK05993          7 ILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAEGLEAFYLDYAEPESIAALVAQVLELSGGKLDALFNNGAY   86 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             99925686999999999998799999997999999999848981999726677999999999999808970699966643


Q ss_pred             CCCC---C----EEECCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4433---1----00012210134-------4320-----12334333320102576212345321123431134554455
Q gi|254780595|r   75 SSEG---D----PCIISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        75 ~~~~---~----~~~~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      ....   +    .....+..|+.       +.++     +-.++|++||.+-+-           +.--.+.|+.+|.+.
T Consensus        87 ~~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~~G~IVnisSi~g~~-----------~~p~~~~Y~aSK~Av  155 (277)
T PRK05993         87 GQPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPVMRKQGHGRIVQCSSILGLV-----------PMKYRGAYNASKFAI  155 (277)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCC-----------CCCCCCHHHHHHHHH
T ss_conf             567708886799999998870189999999972331348983899988844488-----------899983899999999


Q ss_pred             HHHHHH---CCCCCCCCCCCCCCCCCC
Q ss_conf             554320---012345676420347777
Q gi|254780595|r  136 EKEWLA---ITKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       136 E~~~~~---~~~~~~~~~~ilR~~~iy  159 (289)
                      |.....   ..+.+|+.++++-|+.|=
T Consensus       156 ~~~~~sLr~El~~~gI~V~~i~PG~v~  182 (277)
T PRK05993        156 EGLSDTLRMELQGSGIHVSLIEPGPIA  182 (277)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             999999999856328689999648887


No 59 
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=98.98  E-value=9.5e-09  Score=69.42  Aligned_cols=198  Identities=14%  Similarity=0.178  Sum_probs=104.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC--HHHHHHHCCCCEEEEEECCCCC
Q ss_conf             93999888-88899999999988988999967944634556449828980678640--2346541156327876124443
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN--NLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~--~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      |+|||||+ +=||..++++|+++|..+....+...........++..+..|..+..  ..+.+....+|.++++++-...
T Consensus         1 mnVLITGas~GIG~aia~~l~~~~~~~~v~~~~~~~~~~~~~~~v~~~~~Dvt~~~~i~~~~~~~~~iD~linnAGi~~~   80 (235)
T PRK09009          1 MNILIVGGSGGIGKAMVKQLLETYPDATVHATYRHHKPDFRHDNVQWHALDVTDEAEIKQLSEQFTQLDWLINCVGMLHT   80 (235)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             97999755639999999999856998099997377654445798389987479999999999870877899976752446


Q ss_pred             ----CCEEEC---------CCCCHHH----------HHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             ----310001---------2210134----------432--012334333320102576212345321123431134554
Q gi|254780595|r   78 ----GDPCII---------SMSKDFY----------KFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        78 ----~~~~~~---------~~~~~~~----------~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                          .+....         ....++.          ..+  ..-.+++++||..  |.     +.. .+..+...|+.+|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~l~~~~~~~iv~isS~~--g~-----i~~-~~~~g~~~Y~aSK  152 (235)
T PRK09009         81 QDKGPEKSLQSLDSDFFLQNITLNTLPSLLLAKHFTPLLKQSESARFAVISAKV--GS-----ISD-NRLGGWYSYRASK  152 (235)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE--CC-----CCC-CCCCCCHHHHHHH
T ss_conf             777764686778999999999886199999999999999860787640122234--15-----778-8888623669999


Q ss_pred             HHHHHHHHHCCCCC-----CCCCCCCCCCCCCCCCCCHHHH-HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC---
Q ss_conf             45555432001234-----5676420347777898503444-31134543222110001024777799999995135---
Q gi|254780595|r  133 FNAEKEWLAITKKL-----NIKLAVLRLSGIYGPKRNPFIK-IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH---  203 (289)
Q Consensus       133 ~~~E~~~~~~~~~~-----~~~~~ilR~~~iyGp~r~~~~~-~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~---  203 (289)
                      .+...+.+.++.+.     ++.+..+.|+.+=-|    +.+ +...    .+.+    -...-+|+|+++++++...   
T Consensus       153 aAl~~lt~~la~E~~~~~~~i~V~~i~PG~v~T~----m~~~~~~~----~p~~----r~~~PeeiA~~i~~L~s~~s~~  220 (235)
T PRK09009        153 AALNMFLKTLSIEWQRSLKHGVVLALHPGTTDTP----LSKPFQQN----VPKG----KLFTPEYVAQCLLGIIANATPA  220 (235)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC----CCCHHHHC----CCCC----CCCCHHHHHHHHHHHHCCCCCC
T ss_conf             9999999999999764269968999814865671----23067857----9988----8829999999999997169723


Q ss_pred             CCCCEECCCCCHHHH
Q ss_conf             578616268433338
Q gi|254780595|r  204 LGGIFNLSDDEPAPP  218 (289)
Q Consensus       204 ~~~iyni~~~~~~s~  218 (289)
                      ..|.+...||.+++|
T Consensus       221 ~tG~~i~vdG~~~pW  235 (235)
T PRK09009        221 QSGSFLAYDGEELPW  235 (235)
T ss_pred             CCCCEEEECCCCCCC
T ss_conf             698889789778769


No 60 
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=98.96  E-value=1.1e-08  Score=69.14  Aligned_cols=193  Identities=15%  Similarity=0.027  Sum_probs=111.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CC--CEEEECCCCCCC---HHHH---HHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345564----49--828980678640---2346---541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KG--ISPFLFADQKIN---NLLR---EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~--~~~~~~~~~~~~---~~~~---~~~~~~~~v   68 (289)
                      .++|||+ |-||..+++.|+++|++|+.+.|++++...+..    .+  +..+..|..+.+   ..+.   .....+|.+
T Consensus         7 v~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iDil   86 (246)
T PRK05653          7 TALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERFGGLDVL   86 (246)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89993897589999999999879999999799999999999999659948999972899999999999999974998699


Q ss_pred             EEEECCCCCC---CEEECCC----CCH----------HHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000122----101----------344320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISM----SKD----------FYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~----~~~----------~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +......    ..+          ....+.  +..++|++||...+-           +......|+
T Consensus        87 vnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~-----------~~~~~~~Y~  155 (246)
T PRK05653         87 VNNAGITRDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNISSVSGVA-----------GNPGQTNYA  155 (246)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCC-----------CCCCCHHHH
T ss_conf             989999999880139999999999986088999999999999984699789983655467-----------899966689


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-C----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             5544555543200123---456764203477778985-0----3444311345432221100010247777999999951
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-N----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .+|.+.+.+.+..+++   +++.+..+.|+.+--|-. .    ....+.+..+.        --+...+|+|+++.+|+.
T Consensus       156 asKaal~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~Pl--------~R~~~p~dia~~v~fL~S  227 (246)
T PRK05653        156 AAKAGVIGLTKALALELASRGITVNAVAPGFIDTDMTRALPEEVKEALLKQIPL--------GRLGTPEEVANAVAFLAS  227 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHHHHC
T ss_conf             999999999999999950439399999638887723111689999999847998--------998399999999999968


Q ss_pred             CC----CCCCEECCCC
Q ss_conf             35----5786162684
Q gi|254780595|r  202 HH----LGGIFNLSDD  213 (289)
Q Consensus       202 ~~----~~~iyni~~~  213 (289)
                      ..    .|+++++-.|
T Consensus       228 ~~s~~itG~~i~vDGG  243 (246)
T PRK05653        228 DAASYITGQVIPVNGG  243 (246)
T ss_pred             CHHCCCCCCEEEECCC
T ss_conf             7112835874887989


No 61 
>PRK05872 short chain dehydrogenase; Provisional
Probab=98.95  E-value=3e-08  Score=66.58  Aligned_cols=192  Identities=13%  Similarity=0.079  Sum_probs=111.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCH---H---HHHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---98289806786402---3---46541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINN---L---LREKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~---~---~~~~~~~~~~v~~~   71 (289)
                      .++|||+ +=||..+++.|.++|++|..+.|+.++...+...   ....+..|..+.+.   .   +.+....+|.++++
T Consensus        11 valITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~lg~~~~~~~~DVtd~~~v~~~v~~i~~~~G~iDiLVnN   90 (296)
T PRK05872         11 VVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAAELGDRVLTVVADVTDLAAMQAAAEEAVERFGGIDVVVAN   90 (296)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             79992710589999999999879989999899999999999838873899982799999999999999971998787655


Q ss_pred             ECCCCCC---C----EEECCCCCHH----------H-HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             1244433---1----0001221013----------4-4320123343333201025762123453211234311345544
Q gi|254780595|r   72 IKPSSEG---D----PCIISMSKDF----------Y-KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        72 ~~~~~~~---~----~~~~~~~~~~----------~-~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      ++-....   +    .....+..|+          . ...++-.++|.+||.+-+...           -..+.|+.+|.
T Consensus        91 AGi~~~~~~~~~~~e~~~~v~dVNl~G~~~~~ra~lp~m~~~~G~IVnisS~ag~~~~-----------p~~~aY~ASKa  159 (296)
T PRK05872         91 AGIASYGSVLQVDPAAFRRVIDVNLLGVFHTVRATLPAVIERRGYVLQVSSLAAFAAA-----------PGMAPYCASKA  159 (296)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCC-----------CCCCHHHHHHH
T ss_conf             6257997642199899725842445999999999999999779989999605432458-----------99807999999


Q ss_pred             HHHHHHHHCC---CCCCCCCCCCCCCCCCCCC-C------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             5555432001---2345676420347777898-5------0344431134543222110001024777799999995135
Q gi|254780595|r  134 NAEKEWLAIT---KKLNIKLAVLRLSGIYGPK-R------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       134 ~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~-r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      ..+.+.+...   ..+|+.+..+-|+.|==|- |      ..+..++...+...      ..-+..+|+|++++..++++
T Consensus       160 av~~~t~sLa~Ela~~GIrVn~V~PG~V~T~m~r~a~~~~~~~~~~~~~~p~p~------~~~~~~~~~a~~i~~~i~r~  233 (296)
T PRK05872        160 GVEAFANALRLEVAHRGVSVGSAYLSWIDTDLVRDADADLPAFRELRARLPWPL------NRTTSVEKCAAAFVDGIERR  233 (296)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCCCCC------CCCCCHHHHHHHHHHHHHCC
T ss_conf             999999999998400193899997088977567476645755678861289987------88659999999999998448


Q ss_pred             CCCCEEC
Q ss_conf             5786162
Q gi|254780595|r  204 LGGIFNL  210 (289)
Q Consensus       204 ~~~iyni  210 (289)
                      ...+|-=
T Consensus       234 ~~~v~~p  240 (296)
T PRK05872        234 ARRVYAP  240 (296)
T ss_pred             CCEEEEC
T ss_conf             8569966


No 62 
>PRK05599 hypothetical protein; Provisional
Probab=98.94  E-value=2.9e-08  Score=66.66  Aligned_cols=183  Identities=14%  Similarity=0.088  Sum_probs=104.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCC---CEEEECCCCCCCH---H---HHHHHCCCC
Q ss_conf             93999888-8889999999998898899996794463455----6449---8289806786402---3---465411563
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKG---ISPFLFADQKINN---L---LREKLYFTT   66 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~---~~~~~~~~~~~~~---~---~~~~~~~~~   66 (289)
                      |.|||||| .=||..++..|. +|++|+...|+.++...+    ...+   +..+.+|..+.+.   .   +......+|
T Consensus         1 MtvlITGASsGIG~a~A~~lA-~G~~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~g~id   79 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLA-HGEDVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELAGEIS   79 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             989998886899999999998-5994999999999999999999862597189972899999999999999998619843


Q ss_pred             EEEEEECCCCCCC-----EE-ECC-CCCHH----------HHHH--H-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             2787612444331-----00-012-21013----------4432--0-12334333320102576212345321123431
Q gi|254780595|r   67 HIVQCIKPSSEGD-----PC-IIS-MSKDF----------YKFM--P-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~~~-----~~-~~~-~~~~~----------~~~~--~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      .++++++-.....     .. ... ...++          ....  . +-.++|.+||.+-+-           +.....
T Consensus        80 ~lv~naGi~~~~~~~~~d~~~~~~~~~vN~~~~~~~~~~~~~~~~~~~~~G~Iv~iSSvag~~-----------~~~~~~  148 (246)
T PRK05599         80 LAVVAFGILGDQERAETDEAHAVEIATVDYTAQVSMLTVLADELRAQTTPSTIVAFSSIAGWR-----------ARRANY  148 (246)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCC-----------CCCCCC
T ss_conf             999877667873201189999999999886999999999999998546994799996767578-----------788885


Q ss_pred             HHHHHHHHHHHHHHH---CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             134554455554320---01234567642034777789850344431134543222110001024777799999995135
Q gi|254780595|r  127 CVATQRFNAEKEWLA---ITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~---~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      .|+.+|.........   ....+|+.+++++|+.|-.|    |+   .+..     +..  -.+--+|+|+.++..++++
T Consensus       149 ~Y~ASKaal~~~~~~L~~el~~~gI~V~~v~PG~V~T~----mt---~~~~-----~~p--~~~spe~~A~~i~~~i~~~  214 (246)
T PRK05599        149 VYGSTKAGLDAFCQGLADSLHGSHVRLIIARPGFVIGS----MT---TGMK-----PAP--MSVYPRDVAAAVVSAITSK  214 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC----CC---CCCC-----CCC--CCCCHHHHHHHHHHHHHHC
T ss_conf             08699999999999999995377968999844988362----00---7999-----898--7589999999999999818


Q ss_pred             CCCCEE
Q ss_conf             578616
Q gi|254780595|r  204 LGGIFN  209 (289)
Q Consensus       204 ~~~iyn  209 (289)
                      ..+.+.
T Consensus       215 k~~~~i  220 (246)
T PRK05599        215 KRSTTL  220 (246)
T ss_pred             CCCEEE
T ss_conf             986699


No 63 
>PRK07454 short chain dehydrogenase; Provisional
Probab=98.92  E-value=2e-08  Score=67.54  Aligned_cols=185  Identities=16%  Similarity=0.141  Sum_probs=103.0

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCC--CEEEECCCCCCCH------HHHHHHCCCC
Q ss_conf             93-999888-8889999999998898899996794463455----6449--8289806786402------3465411563
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKG--ISPFLFADQKINN------LLREKLYFTT   66 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~--~~~~~~~~~~~~~------~~~~~~~~~~   66 (289)
                      || +||||| +=||..+++.|.++|++|..+.|+.+++..+    ...+  +..+..|..+...      .+.+....+|
T Consensus         6 mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   85 (241)
T PRK07454          6 MPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFGCPS   85 (241)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             98899917587899999999998799899998999999999999996599289999518999999999999999759988


Q ss_pred             EEEEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             278761244433---100012----21013----------4432--0123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++-....   +.....    ...|+          ...+  .+-.++|.+||++-+-.           .-....
T Consensus        86 iLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~ag~~~-----------~~~~~~  154 (241)
T PRK07454         86 VLINNAGAAYTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHAARNA-----------FPQWGA  154 (241)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-----------CCCCHH
T ss_conf             999889889999926699999999999986999999999999999739989999835654477-----------899757


Q ss_pred             HHHHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             345544555543200---12345676420347777898503444311345432221100010247777999999951355
Q gi|254780595|r  128 VATQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       128 y~~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      |+.+|.+...+.+..   ...+|+++..+.|+.|=-|    +..  ...   ....-.....+.-+|+|++++++...+.
T Consensus       155 Y~aSK~al~~lt~~la~E~~~~gIrVn~V~PG~v~T~----m~~--~~~---~~~~~~~~~~l~PedVA~~v~flas~p~  225 (241)
T PRK07454        155 YCVSKAALAAFTKCLAEEERSHGIRVCTLTLGAVNTP----LWD--SET---VQADFDRSAMLSPEQVAQTILYLAQLPP  225 (241)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCC----CCC--CCC---CCCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999983845938999973889889----888--633---3355455689999999999999976998


Q ss_pred             C
Q ss_conf             7
Q gi|254780595|r  205 G  205 (289)
Q Consensus       205 ~  205 (289)
                      +
T Consensus       226 ~  226 (241)
T PRK07454        226 S  226 (241)
T ss_pred             C
T ss_conf             5


No 64 
>PRK06483 short chain dehydrogenase; Provisional
Probab=98.91  E-value=7.2e-08  Score=64.41  Aligned_cols=194  Identities=16%  Similarity=0.127  Sum_probs=107.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEEEEC
Q ss_conf             3999888-888999999999889889999679446-3455644982898067864023------4654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-LLTLKHKGISPFLFADQKINNL------LREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~~   73 (289)
                      .|||||+ +=||..++++|.++|++|....|+... ...+...+...+..|..+.+..      +......+|.++++++
T Consensus         4 tVlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~id~lVnNAg   83 (236)
T PRK06483          4 PILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAGATCIQADFSTNAGIMAFIDELKQHTDGLRAIIHNAS   83 (236)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             79997899889999999999889989999598479999998569989992279999999999999998399759997774


Q ss_pred             CCC---CCCEEECC----CCCHH----------HHHHHC----CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             444---33100012----21013----------443201----2334333320102576212345321123431134554
Q gi|254780595|r   74 PSS---EGDPCIIS----MSKDF----------YKFMPH----VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        74 ~~~---~~~~~~~~----~~~~~----------~~~~~~----~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ...   ..+.....    +..++          ...+..    ...+|++||.....   +.        .....|+.+|
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~l~~~~~~~~~Ii~isS~~~~~---g~--------~~~~~Y~asK  152 (236)
T PRK06483         84 DWLAESPGAPLADVLARMMQIHVNAPYLLNLALEDLLRGHGHAASDIIHITDYVVEK---GS--------DKHIAYAASK  152 (236)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHC---CC--------CCCHHHHHHH
T ss_conf             467888343889999999997335899999998999997588866776542265642---48--------8847899999


Q ss_pred             HHHHHHHHHCCCCCC--CCCCCCCCCCCC-CCCCCH--HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CC
Q ss_conf             455554320012345--676420347777-898503--44431134543222110001024777799999995135--57
Q gi|254780595|r  133 FNAEKEWLAITKKLN--IKLAVLRLSGIY-GPKRNP--FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LG  205 (289)
Q Consensus       133 ~~~E~~~~~~~~~~~--~~~~ilR~~~iy-Gp~r~~--~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~  205 (289)
                      ...+.+.+.++.+.+  +.+-.+.|+.|. .++...  ..+.....+...        +-.-+|+++++.+|++..  -|
T Consensus       153 aal~~ltr~lA~ela~~IrVN~V~PG~i~~~~~~~~~~~~~~~~~~~~~r--------~~~p~eia~~v~fL~ss~~iTG  224 (236)
T PRK06483        153 AALDNMTLSFAAKLAPEVKVNSIAPALILFNEGDDAAYRQKALAKSLLKI--------EPGEEEIIQLVDYLLDSCYVTG  224 (236)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECEEECCCCCCHHHHHHHHHHCCCCC--------CCCHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999999997589989999607062189998999999986188889--------9898999999999993899889


Q ss_pred             CCEECCCCC
Q ss_conf             861626843
Q gi|254780595|r  206 GIFNLSDDE  214 (289)
Q Consensus       206 ~iyni~~~~  214 (289)
                      +++++-.|.
T Consensus       225 ~~i~VDGG~  233 (236)
T PRK06483        225 RSLPVDGGR  233 (236)
T ss_pred             CEEEECCCC
T ss_conf             818879461


No 65 
>PRK08219 short chain dehydrogenase; Provisional
Probab=98.91  E-value=1.9e-08  Score=67.77  Aligned_cols=187  Identities=14%  Similarity=0.101  Sum_probs=103.7

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCCH--HHHHHHCCCCEEEEEECCC
Q ss_conf             93-999888-8889999999998898899996794463455644-98289806786402--3465411563278761244
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKINN--LLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~--~~~~~~~~~~~v~~~~~~~   75 (289)
                      || +||||| +=||..+++.|.+. +.|+...|+.++...+... +...+..|..+.+.  .....+..+|.++++++..
T Consensus         3 mKvalITGas~GIG~aia~~la~~-g~vv~~~r~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~~~iD~lVnnAG~~   81 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALART-HTLLLAGRPSERLDAVAARLGATTWPADLTDPEAIAAAVEPLDRLDVLVHNAGVA   81 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHC-CCEEEEECCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             899999284649999999999969-9899998988999999997099378605799999999999659988999899689


Q ss_pred             CCC---CEEE----CCCCCH----------HHH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             433---1000----122101----------344-3201233433332010257621234532112343113455445555
Q gi|254780595|r   76 SEG---DPCI----ISMSKD----------FYK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK  137 (289)
Q Consensus        76 ~~~---~~~~----~~~~~~----------~~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~  137 (289)
                      ...   +...    ..+.-|          +.. ...+-.++|++||.+-+.           +.-....|+.+|.+...
T Consensus        82 ~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~lp~m~~~~G~IV~isS~~g~~-----------~~~~~~~Y~aSKaAl~~  150 (226)
T PRK08219         82 ELGPVAESTVDEWRATLDVNVVAPAELTRLLLPALRAARGHVVFINSGAGLN-----------ASPGWASYAASKFALRA  150 (226)
T ss_pred             CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC-----------CCCCCHHHHHHHHHHHH
T ss_conf             9987376999999999998669999999999999997398499994767648-----------89997479999999999


Q ss_pred             HHHHCCCC--CCCCCCCCCCCCCCCCCCCHHHH-HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             43200123--45676420347777898503444-311345432221100010247777999999951355786
Q gi|254780595|r  138 EWLAITKK--LNIKLAVLRLSGIYGPKRNPFIK-IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI  207 (289)
Q Consensus       138 ~~~~~~~~--~~~~~~ilR~~~iyGp~r~~~~~-~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~i  207 (289)
                      +...+..+  .++.+..+-|+.|--|    |.+ +........ ..+   -+..-+|+|+++.++++.+.+..
T Consensus       151 l~~~L~~e~~~~IrVn~I~PG~v~T~----m~~~~~~~~~~~~-~~~---r~~~PedVA~~v~fll~~p~~~~  215 (226)
T PRK08219        151 LADALREEEAGNVRVTSVHPGRTATD----MQRELVAQEGREY-DPA---RFLRPETVAAAVRFAVDAPRDAH  215 (226)
T ss_pred             HHHHHHHHCCCCEEEEEEEECCCCCC----CCHHHHHHHHCCC-CCC---CCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             99999986699849999970899786----5355676543037-876---79699999999999986998751


No 66 
>PRK07024 short chain dehydrogenase; Provisional
Probab=98.90  E-value=7.6e-08  Score=64.28  Aligned_cols=183  Identities=12%  Similarity=0.085  Sum_probs=104.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CCCEEEECCCCCCCHHH------HHHHCCCCEEEE
Q ss_conf             3999888-888999999999889889999679446345564----49828980678640234------654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KGISPFLFADQKINNLL------REKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~~~~~~~~~~~~~~~~------~~~~~~~~~v~~   70 (289)
                      ||||||| .=||..++++|.++|++|..+.|+.+.+..+..    ..+..+..|..+.+...      .+....+|.+++
T Consensus         4 ~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDilin   83 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDVVIA   83 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89998460299999999999889989999898899999999767997699981179999999999999998399879998


Q ss_pred             EECCCCCC---C-EEEC---C-CCCHHHH-------HH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             61244433---1-0001---2-2101344-------32-----0123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEG---D-PCII---S-MSKDFYK-------FM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~---~-~~~~---~-~~~~~~~-------~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++-....   + ....   . ...|+..       ..     .+..++|.+||.+-+-   +.        -....|+.
T Consensus        84 NAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Iv~isS~ag~~---g~--------p~~~~Y~A  152 (256)
T PRK07024         84 NAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAPMRAARRGTLVGIASVAGVR---GL--------PGAGAYSA  152 (256)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCC---CC--------CCCCHHHH
T ss_conf             88556788644537899999999999999999999876875026893499843545416---89--------99707999


Q ss_pred             HHHHHHHHH---HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             544555543---20012345676420347777898503444311345432221100010247777999999951355786
Q gi|254780595|r  131 QRFNAEKEW---LAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI  207 (289)
Q Consensus       131 ~k~~~E~~~---~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~i  207 (289)
                      +|.+.....   ....+..|+.++.+.|+.|=    ..|.+   +.....  +    -.+..+++|+.++..++++...+
T Consensus       153 SKaal~~~~esL~~el~~~gI~V~~i~PG~v~----T~m~~---~~~~~~--p----~~~~pe~vA~~i~~ai~~~~~~~  219 (256)
T PRK07024        153 SKAAAIKYLESLRVELRPAGVRVVTIAPGYIR----TPMTA---HNPYPM--P----FLMDADRFAARAARAIARGRSFR  219 (256)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCC----CCCCC---CCCCCC--C----CCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999999999865779489999718995----88777---799999--8----76899999999999997599889


Q ss_pred             E
Q ss_conf             1
Q gi|254780595|r  208 F  208 (289)
Q Consensus       208 y  208 (289)
                      |
T Consensus       220 ~  220 (256)
T PRK07024        220 V  220 (256)
T ss_pred             E
T ss_conf             8


No 67 
>PRK08267 short chain dehydrogenase; Provisional
Probab=98.89  E-value=2.9e-08  Score=66.67  Aligned_cols=191  Identities=15%  Similarity=0.046  Sum_probs=104.9

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CCCEEEECCCCCCCH---HHHHH---H-CCCCE
Q ss_conf             93-999888-888999999999889889999679446345564----498289806786402---34654---1-15632
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KGISPFLFADQKINN---LLREK---L-YFTTH   67 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~~~~~~~~~~~~~~---~~~~~---~-~~~~~   67 (289)
                      || +||||| +=||..+++.|.++|++|..+.|+.+....+..    .....+..|..+.+.   .+.+.   . ..+|.
T Consensus         1 MK~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iDi   80 (258)
T PRK08267          1 MKSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRLDV   80 (258)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             99899907226899999999998799999998889999999998369967999911799999999999999995899868


Q ss_pred             EEEEECCCCCC---CEEE----CCCCCHHH-------HHHH-----CCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433---1000----12210134-------4320-----12334333320102-5762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEG---DPCI----ISMSKDFY-------KFMP-----HVKWIGYLSSTSIY-GNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~----~~~~~~~~-------~~~~-----~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++-....   +...    ....-|+.       +..+     +-.++|.+||.+-+ |.            -....
T Consensus        81 LVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~~~~------------p~~~~  148 (258)
T PRK08267         81 LFNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAIYGQ------------PQLAV  148 (258)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCC------------CCCCH
T ss_conf             998887799988244999999999999739999999999999997799279999065446799------------99866


Q ss_pred             HHHHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHH--HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             345544555543200---12345676420347777898503444--3113454322211000102477779999999513
Q gi|254780595|r  128 VATQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIK--IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       128 y~~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~--~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      |+.+|.....+.+..   ...+|+.+..+-|+.|--|-   +..  ...+...   ..  .......++||+.++.++++
T Consensus       149 Y~aSK~av~~lt~sla~El~~~gIrVn~v~PG~v~T~m---~~~~~~~~~~~~---~~--~~~~~~pe~vA~~i~~a~~~  220 (258)
T PRK08267        149 YSATKFAVRGLTEALDLEWRRHGIRVADVMPLFVDTPM---LGSNGVRAGSPK---RL--GVRLTPVEDVAEAVWAAAHG  220 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCC---CCCCCCCCCCCC---CC--CCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999999999843019189999718898766---898877675300---15--89899999999999999727


Q ss_pred             CCCCCEECC
Q ss_conf             557861626
Q gi|254780595|r  203 HLGGIFNLS  211 (289)
Q Consensus       203 ~~~~iyni~  211 (289)
                      +....|-++
T Consensus       221 ~~r~~~~vg  229 (258)
T PRK08267        221 PTRLHWPVG  229 (258)
T ss_pred             CCCEEEECC
T ss_conf             997699688


No 68 
>PRK09072 short chain dehydrogenase; Provisional
Probab=98.88  E-value=3.5e-08  Score=66.17  Aligned_cols=187  Identities=12%  Similarity=0.039  Sum_probs=105.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CCCEEEECCCCCCCHH--H---HHHHCCCCEEEEE
Q ss_conf             3999888-888999999999889889999679446345564----4982898067864023--4---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KGISPFLFADQKINNL--L---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~~~~~~~~~~~~~~~--~---~~~~~~~~~v~~~   71 (289)
                      .+||||| +=||..++++|.++|++|+.+.|+.++...+..    .++..+..|..+.+..  +   ......+|.++++
T Consensus         7 ~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~~~~~~~~~~Dls~~~~~~~~~~~~~~~g~iDiLInN   86 (262)
T PRK09072          7 RVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPYPGRVRWVVADLTSEAGREAVLARAREMGGINVLINN   86 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89994862399999999999879989999898999999999845897699997179999999999999984999899989


Q ss_pred             ECCCCCC---CEEE----CCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433---1000----12210134-------4320-----12334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG---DPCI----ISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~---~~~~----~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++-....   +...    .....|+.       +..+     +-.++|.+||.+-+  .         +.--.+.|+.+|
T Consensus        87 AG~~~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~m~~~~~G~IvnisS~ag~--~---------~~p~~~~Y~ASK  155 (262)
T PRK09072         87 AGVNHFALLDQQDPEAIDRLLALNLTAPMQLTRALLPLLRAQPSAAVVNVGSTFGS--I---------GYPGYASYCASK  155 (262)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH--C---------CCCCCHHHHHHH
T ss_conf             97788986354999999999999568999999999999987699489996686662--5---------789981799999


Q ss_pred             HHHHHHHHH---CCCCCCCCCCCCCCCCCCCCC-CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             455554320---012345676420347777898-5034443113454322211000102477779999999513557861
Q gi|254780595|r  133 FNAEKEWLA---ITKKLNIKLAVLRLSGIYGPK-RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIF  208 (289)
Q Consensus       133 ~~~E~~~~~---~~~~~~~~~~ilR~~~iyGp~-r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iy  208 (289)
                      .+.+.....   .....|+.++.+-|+.+-=|- .........    ..  +.   ....-+|+|++++..++++...+|
T Consensus       156 aal~~~s~sL~~El~~~gI~V~~v~Pg~v~T~~~~~~~~~~~~----~~--~~---~~~~pe~vA~~i~~~i~~~k~~i~  226 (262)
T PRK09072        156 FALRGFSEALRRELADTGVRVLYLAPRATRTAMNSAAVTALNA----AL--GN---AMDSPEDVAAAVLQAIEQERAERY  226 (262)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHH----HH--CC---CCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999999999998462290899997289998888502345455----41--66---789999999999999946998897


No 69 
>PRK06482 short chain dehydrogenase; Provisional
Probab=98.87  E-value=1.3e-08  Score=68.60  Aligned_cols=146  Identities=15%  Similarity=0.080  Sum_probs=89.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCH---HHH---HHHCCCCEEEEEE
Q ss_conf             999888-8889999999998898899996794463455644---98289806786402---346---5411563278761
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINN---LLR---EKLYFTTHIVQCI   72 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~---~~~---~~~~~~~~v~~~~   72 (289)
                      +||||| +=||..+++.|+++|++|+++.|+++++..+...   .+..+..|..+.+.   .+.   .....+|.+++++
T Consensus         5 ~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDvLVNNA   84 (276)
T PRK06482          5 WFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKARYGERLWVLQLDVTDTAAVRAVVDRAFAELGRIDVVVSNA   84 (276)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99915865999999999998899899997898999999986699579999537999999999999999809987887468


Q ss_pred             CCCCCC------CE-EECCCCCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             244433------10-001221013-------44320-----123343333201025762123453211234311345544
Q gi|254780595|r   73 KPSSEG------DP-CIISMSKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        73 ~~~~~~------~~-~~~~~~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      +.....      +. ....+..|+       .+.++     +-.++|.+||.+-+..           .-..+.|+.+|.
T Consensus        85 G~~~~g~~ee~~~~~~~~~~~vN~~g~~~~~ra~lP~mr~~~~G~IinisS~~g~~~-----------~p~~~~Y~AsK~  153 (276)
T PRK06482         85 GYGLFGAAEELSDAQIRRQIDTNLTGSIQVIRAALPHLRRQGGGRIVQVSSEGGQIA-----------YPGFSLYHASKW  153 (276)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCEEEEECCHHHCCC-----------CCCCHHHHHHHH
T ss_conf             777888767677577999988741779999998573557558977999545243468-----------999768999999


Q ss_pred             HHHHHHHHC---CCCCCCCCCCCCCCCCC
Q ss_conf             555543200---12345676420347777
Q gi|254780595|r  134 NAEKEWLAI---TKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       134 ~~E~~~~~~---~~~~~~~~~ilR~~~iy  159 (289)
                      +.|-+...+   ....|+.++++-|+.+-
T Consensus       154 Al~g~tesLa~El~~~gI~V~~V~PG~~~  182 (276)
T PRK06482        154 GIEGFVESVRQEVAPFGIGFTIVEPGPTR  182 (276)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             99999999999844319389999718985


No 70 
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=98.86  E-value=4.7e-08  Score=65.50  Aligned_cols=197  Identities=14%  Similarity=0.017  Sum_probs=111.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCC--CEEEECCCCCCCHH---H---HHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----556449--82898067864023---4---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKG--ISPFLFADQKINNL---L---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~--~~~~~~~~~~~~~~---~---~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|+++|++|+.+.|+.++..    .+...+  +..+..|..+....   +   .+....+|.+
T Consensus         8 ~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~l   87 (253)
T PRK12826          8 VALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERFGRLDIL   87 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994897789999999999879989999898899999999998509958999951799999999999999983998789


Q ss_pred             EEEECCCCCCC---EEEC----CCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---0001----221013----------4432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCII----SMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~----~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......   ....    .+..++          ...+  .+-.++|++||..  |..        .+......|+
T Consensus        88 vnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~--g~~--------~~~~~~~~Y~  157 (253)
T PRK12826         88 VANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLTSSVA--GPR--------VGYPGLAHYA  157 (253)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH--HHC--------CCCCCCHHHH
T ss_conf             989988999981559999999999987566643378746999976997699995256--415--------6899738899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC--------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             5544555543200123---4567642034777789850--------3444311345432221100010247777999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN--------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~--------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      .+|.+.+.+.+.++.+   +|+.+-.+.|+.+-.|.-.        ....+.+..+        .--+...+|+|+++.+
T Consensus       158 asKaal~~ltk~lA~e~~~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~p--------l~R~~~p~eiA~~v~f  229 (253)
T PRK12826        158 ASKAGVVGFTRALALELARRNITVNSVHPGMVDTPMAGNVFLGDASVAEAAAAAIP--------LGRLGEPEDIAAAVLF  229 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHH
T ss_conf             99999999999999985320959999962879672121446687899999983799--------9998599999999999


Q ss_pred             HHCCC----CCCCEECCCCCHH
Q ss_conf             95135----5786162684333
Q gi|254780595|r  199 LMTHH----LGGIFNLSDDEPA  216 (289)
Q Consensus       199 l~~~~----~~~iyni~~~~~~  216 (289)
                      |....    .|++..+-.|-.+
T Consensus       230 L~S~~s~~itG~~i~vDGG~tl  251 (253)
T PRK12826        230 LASDAARYITGQTLPVDGGATL  251 (253)
T ss_pred             HHCCHHCCCCCCEEEECCCCCC
T ss_conf             9686322956873887899608


No 71 
>PRK08251 short chain dehydrogenase; Provisional
Probab=98.86  E-value=4.3e-08  Score=65.67  Aligned_cols=184  Identities=15%  Similarity=0.070  Sum_probs=104.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HC--CC--EEEECCCCCCCHH------HHHHHCCCC
Q ss_conf             3999888-88899999999988988999967944634556----44--98--2898067864023------465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HK--GI--SPFLFADQKINNL------LREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~--~~--~~~~~~~~~~~~~------~~~~~~~~~   66 (289)
                      +|||||| +=||..++++|.++|++|..+.|+.++...+.    ..  +.  ..+..|..+.+..      +.+....+|
T Consensus         4 ~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~~~~~v~~~~~Dvsd~~~v~~~~~~~~~~~g~iD   83 (248)
T PRK08251          4 KILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEELKAELLARYPGIKVAVAALDVNDHDQVFEVFAEFSDELGGLD   83 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89994786399999999999879989999898889999999998737997399997867868999999999999809998


Q ss_pred             EEEEEECCCCCC-------CEEECCCCCHHH----------HHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             278761244433-------100012210134----------432--0123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEG-------DPCIISMSKDFY----------KFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~-------~~~~~~~~~~~~----------~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++-....       +........|+.          ...  .+..++|.+||.+-+-   +      .| .....
T Consensus        84 ~lvnNAGi~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~l~~m~~~~~G~Iv~isS~ag~~---~------~p-~~~~~  153 (248)
T PRK08251         84 RVIVNAGIGKGARLGTGKFWANKATAETNFVAALAQCEAAMEIFREQGSGHLVLISSVSAVR---G------LP-GAKTA  153 (248)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCC---C------CC-CCCHH
T ss_conf             99985765788665559999999999998299999999998765540587299995744426---7------89-97478


Q ss_pred             HHHHHHHHHHHHH---HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             3455445555432---0012345676420347777898503444311345432221100010247777999999951355
Q gi|254780595|r  128 VATQRFNAEKEWL---AITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       128 y~~~k~~~E~~~~---~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      |+.+|........   .....+|+.++.+.|+.|-    ..|..   +...     .  .-.+..+++|+.++..++++.
T Consensus       154 Y~aSKaal~~~~~~L~~El~~~gI~V~~i~PG~v~----T~m~~---~~~~-----~--~~~~~~e~~A~~i~~ai~~~~  219 (248)
T PRK08251        154 YAASKAGLASLGEGLRAEYAKTPIKVSTIEPGYIR----SEMNE---KAKS-----T--PFMVDTETGVKAMVKAIEKEP  219 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCC----CCCCC---CCCC-----C--CCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999999999999846669299999868998----52244---8887-----9--987899999999999998399


Q ss_pred             CCCEE
Q ss_conf             78616
Q gi|254780595|r  205 GGIFN  209 (289)
Q Consensus       205 ~~iyn  209 (289)
                      ..+|-
T Consensus       220 ~~~~~  224 (248)
T PRK08251        220 GRAAV  224 (248)
T ss_pred             CEEEE
T ss_conf             79998


No 72 
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.86  E-value=7.1e-08  Score=64.43  Aligned_cols=193  Identities=13%  Similarity=0.027  Sum_probs=109.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HHH----HHHHCC--CEEEECCCCCCC---HHHH---HHHCCCCE
Q ss_conf             3999888-88899999999988988999967944-634----556449--828980678640---2346---54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NLL----TLKHKG--ISPFLFADQKIN---NLLR---EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~~----~l~~~~--~~~~~~~~~~~~---~~~~---~~~~~~~~   67 (289)
                      .++|||+ +=||..++++|+++|++|+.+.|+.. ...    .+...+  +..+..|..+.+   ..+.   +....+|.
T Consensus         9 ~~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iDi   88 (250)
T PRK12825          9 VALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRRAQAVQADVTDAAALEAAVEELVERFGAIDI   88 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89993895589999999999879989999798878999999999853994899994189999999999999997699989


Q ss_pred             EEEEECCCCCCC---EEECC----CCCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             787612444331---00012----2101----------34432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEGD---PCIIS----MSKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~~---~~~~~----~~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++......   .....    ...+          +...+  .+-.++|++||.+.+-..           .....|
T Consensus        89 lInnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~-----------~~~~~Y  157 (250)
T PRK12825         89 LVNNAGITGDGRLWEMSDDEWERVIDVNLTGVFNVLRAVVPPMIEAGGGRIVNISSVAGLKGN-----------PGQVNY  157 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCC-----------CCCHHH
T ss_conf             998998899989023999999999998518999999998999997499739999145555789-----------996778


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-CH----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             45544555543200123---456764203477778985-03----44431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-NP----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|.+.+.+.+.++.+   +|+.+..+.|+.+-.|-. ..    ...+....+        .--+...+|+|+++.+|+
T Consensus       158 ~~sK~Al~~l~~~la~e~~~~gIrvN~I~PG~v~T~~~~~~~~~~~~~~~~~~p--------~~R~~~pedva~~v~fL~  229 (250)
T PRK12825        158 AAAKAGLVGLTKALARELAERGIRVNAVAPGAIDTEMIEATIEEAREAILKLIP--------LGRLGTPEEIADAVAFLA  229 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHHHH
T ss_conf             999999999999999986042929999972888770321258889999982699--------899839999999999996


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++.+-.|
T Consensus       230 s~~s~~itG~~i~vDGG  246 (250)
T PRK12825        230 SDAAGYITGQVIAVDGG  246 (250)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             86222824886898968


No 73 
>PRK05650 short chain dehydrogenase; Provisional
Probab=98.86  E-value=2.6e-08  Score=66.91  Aligned_cols=189  Identities=15%  Similarity=0.007  Sum_probs=102.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCEE--EECCCCCCCHHH-------HHHHCCCCE
Q ss_conf             3999888-8889999999998898899996794463455----6449828--980678640234-------654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGISP--FLFADQKINNLL-------REKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~~~--~~~~~~~~~~~~-------~~~~~~~~~   67 (289)
                      ||||||| .=||..++..|.++|++|..+.|+.++...+    ...+.+.  +..|..+ .+.+       .+....+|.
T Consensus         2 rVlITGassGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~-~~~~~~~~~~v~~~~g~iDi   80 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDGFYQRCDVRD-YSQLTALAQACEEKWGGIDV   80 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHHHHCCCCE
T ss_conf             79998876499999999999889989999798899999999998449928999845899-99999999999998399778


Q ss_pred             EEEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78761244433---100012----21013----------4432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++-....   +.....    +..++          .-.+  .+-.++|.+||.+-+-..           --.+.|
T Consensus        81 LVNNAGi~~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~~~-----------p~~~~Y  149 (270)
T PRK05650         81 IVNNAGVASGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNIASMAGLMQG-----------PAMSSY  149 (270)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC-----------CCCHHH
T ss_conf             962476679986201999999999999659999999999976755699589998585552899-----------996679


Q ss_pred             HHHHHHHHHHH---HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCC--EECCHHHHHHHHHHHHHHCCC
Q ss_conf             45544555543---2001234567642034777789850344431134543222110--001024777799999995135
Q gi|254780595|r  129 ATQRFNAEKEW---LAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ--VFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       129 ~~~k~~~E~~~---~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~--~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      +.+|.+.....   ....+.+|+.++++-|+.|--|   .+...+...+..-.....  ..+.+..+|+|+.++..++++
T Consensus       150 ~asK~av~~~tesL~~El~~~gI~V~~v~PG~v~T~---~~~~~~~~~~~~~~~~~~~~~~~~~~~e~vA~~i~~~i~~~  226 (270)
T PRK05650        150 NVAKAGVVALSETLLVELADDEIGVHVVCPSFFQTN---LLDSFRGPNPAMKAQVGKLLEKSPITAADIADYIYQQVAKG  226 (270)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC---CCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCC
T ss_conf             999999999999999985321968999973889866---56577888804678887664148999999999999999759


Q ss_pred             CC
Q ss_conf             57
Q gi|254780595|r  204 LG  205 (289)
Q Consensus       204 ~~  205 (289)
                      ..
T Consensus       227 ~~  228 (270)
T PRK05650        227 EF  228 (270)
T ss_pred             CE
T ss_conf             95


No 74 
>PRK06182 short chain dehydrogenase; Validated
Probab=98.83  E-value=2e-08  Score=67.57  Aligned_cols=146  Identities=19%  Similarity=0.152  Sum_probs=92.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHH------HHHHCCCCEEEEEECCC
Q ss_conf             999888-88899999999988988999967944634556449828980678640234------65411563278761244
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL------REKLYFTTHIVQCIKPS   75 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~------~~~~~~~~~v~~~~~~~   75 (289)
                      +||||| +=||..++++|.++|++|++..|+.++...+...++..+..|..+.+..-      ......+|.++++++-.
T Consensus         6 ~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~~~~~~~Dvt~~~~v~~~~~~i~~~~g~iDiLVNNAG~~   85 (273)
T PRK06182          6 ALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLGIHPLALDVTDEASMKAAVATILAEEGRIDVLVNNAGYG   85 (273)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99906320999999999998799899997989999999967997999858999999999999999839988775058677


Q ss_pred             CCC---CEEE----CCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             433---1000----12210134-------4320-----123343333201025762123453211234311345544555
Q gi|254780595|r   76 SEG---DPCI----ISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        76 ~~~---~~~~----~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      ...   +...    ..+..|+.       +..+     +-.++|.+||.+-+-   +      .|  -...|+.+|.+.+
T Consensus        86 ~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~---~------~p--~~~~Y~asK~av~  154 (273)
T PRK06182         86 SYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINITSMGGKI---Y------TP--LGAWYHATKFALE  154 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCC---C------CC--CCCHHHHHHHHHH
T ss_conf             78748873199999999988699999999853342148995899986844407---7------99--9757999999999


Q ss_pred             HHHHH---CCCCCCCCCCCCCCCCCC
Q ss_conf             54320---012345676420347777
Q gi|254780595|r  137 KEWLA---ITKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       137 ~~~~~---~~~~~~~~~~ilR~~~iy  159 (289)
                      .+...   ....+|+.+..+-|+.|-
T Consensus       155 ~~t~~La~El~~~gI~V~~v~PG~v~  180 (273)
T PRK06182        155 GLSDALRLEVAPFGIDVVVIEPGGIK  180 (273)
T ss_pred             HHHHHHHHHHCHHCCEEEEEECCCCC
T ss_conf             99999999844038789999738986


No 75 
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.83  E-value=9.1e-08  Score=63.84  Aligned_cols=191  Identities=12%  Similarity=0.111  Sum_probs=106.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|++|....|+.++...    +...+.  ..+..|..+.+..      .......+|.+
T Consensus         7 ~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iD~l   86 (253)
T PRK08217          7 VIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDFGQLNGL   86 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994887789999999999879989999799999999999999659948999824799999999999999983998599


Q ss_pred             EEEECCCC--------CCCE----EECCC----CCHH----------HHH-HH--CCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             87612444--------3310----00122----1013----------443-20--1233433332010257621234532
Q gi|254780595|r   69 VQCIKPSS--------EGDP----CIISM----SKDF----------YKF-MP--HVKWIGYLSSTSIYGNREGQWVDEH  119 (289)
Q Consensus        69 ~~~~~~~~--------~~~~----~~~~~----~~~~----------~~~-~~--~~~~~i~~SS~~VYg~~~g~~i~E~  119 (289)
                      +++++...        +...    .....    ..++          ... .+  .-..+|.+||.+.+|..        
T Consensus        87 VnNAGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~g~Ii~isS~~~~~~~--------  158 (253)
T PRK08217         87 INNAGILRDGLLVKAKDGKVTSKMSLEQFQSVIDVNLTGVFLCGREAAAKMIESGSKGVIINISSIARAGNM--------  158 (253)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHCCCCC--------
T ss_conf             985743677664446666520119999999999998178999999999999984897279996331113888--------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-----CHHHHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             11234311345544555543200123---456764203477778985-----0344431134543222110001024777
Q gi|254780595|r  120 SFVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-----NPFIKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       120 ~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-----~~~~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
                          +...|+.+|.+.+.+.+.++++   +++.+..+.|+.|--|--     ....++.+..+..        -+...+|
T Consensus       159 ----~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~pl~--------R~g~p~d  226 (253)
T PRK08217        159 ----GQTNYSASKAGVAAMTVTWAKELARYGIRVAAIAPGVIETEMTAAMKPEALERLEKMIPVG--------RLGEPEE  226 (253)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHH
T ss_conf             ----8616899999999999999999532195999997388987331117999999998579999--------9849999


Q ss_pred             HHHHHHHHHCCC--CCCCEECCC
Q ss_conf             799999995135--578616268
Q gi|254780595|r  192 VARCVIFLMTHH--LGGIFNLSD  212 (289)
Q Consensus       192 va~~i~~l~~~~--~~~iyni~~  212 (289)
                      +|+++.+|++..  -|++..+-.
T Consensus       227 va~~v~fL~s~~~iTG~~i~VDG  249 (253)
T PRK08217        227 IAHTVRFIIENDYVTGRVLEIDG  249 (253)
T ss_pred             HHHHHHHHHHCCCCCCCEEEECC
T ss_conf             99999999958998899678696


No 76 
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.83  E-value=7.6e-08  Score=64.28  Aligned_cols=193  Identities=12%  Similarity=-0.013  Sum_probs=108.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCEEEECCCCCCCH---HHH---HHHCCCCEEEE
Q ss_conf             3999888-88899999999988988999967944634556----4498289806786402---346---54115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKGISPFLFADQKINN---LLR---EKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~~~~~~~~~~~~~~---~~~---~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.++|++|..+.|+.++...+.    ......+..|..+.+.   .+.   .....+|.+++
T Consensus         8 ~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iD~lIn   87 (250)
T PRK07231          8 VAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVAAEIRGGRAIAVAADVSDEADVRAAVEAALERFGSVDILVN   87 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89993888689999999999879999999798899999999844996799993079999999999999998199719998


Q ss_pred             EECCCCCCCE----EECCCC----CHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6124443310----001221----013----------4432--0123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGDP----CIISMS----KDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~~----~~~~~~----~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++......+    ......    .++          ...+  .+-.++|++||.+.+-           +......|+.
T Consensus        88 nAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IinisS~~~~~-----------~~~~~~~Y~a  156 (250)
T PRK07231         88 NAGTTHRNGPLLDVDEAEFDRVYAVNVKSIYLWAQAAVPAWRGEGGGAIVNVASTAGIR-----------PRPGLGWYNA  156 (250)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC-----------CCCCCHHHHH
T ss_conf             88337899892769999999999999899999999999999983996499994477658-----------8999627999


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH---------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             544555543200123---45676420347777898503---------444311345432221100010247777999999
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP---------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~---------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +|...+.+.+.++.+   +|+.+..+.|+.+-.|-...         ..++....+.        --+..-+|+|+++.+
T Consensus       157 sKaal~~lt~~lA~el~~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~~~~Pl--------~R~~~p~dia~~v~f  228 (250)
T PRK07231        157 SKGAVITATKSLAVELAPDNIRVNAVNPVVGETGLLEAFMGEPTPENRAKFLATIPL--------GRLGTPEDIANAAAF  228 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHH
T ss_conf             999999999999999534095999996387986377775238989999999837999--------998199999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |....    -|++..+-.|
T Consensus       229 L~S~~s~~itG~~i~VDGG  247 (250)
T PRK07231        229 LASDEASFITGVALEVDGG  247 (250)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9685332946871884888


No 77 
>PRK06180 short chain dehydrogenase; Provisional
Probab=98.82  E-value=2.4e-08  Score=67.14  Aligned_cols=148  Identities=16%  Similarity=0.149  Sum_probs=87.4

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC---CEEEECCCCCCCH---HHH---HHHCCCCEEE
Q ss_conf             93-999888-88899999999988988999967944634556449---8289806786402---346---5411563278
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG---ISPFLFADQKINN---LLR---EKLYFTTHIV   69 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~---~~~~~~~~~~~~~---~~~---~~~~~~~~v~   69 (289)
                      || +||||| .=||..+++.|+++|++|+++.|+.++...+....   ...+..|..+.+.   .+.   .....+|.++
T Consensus         4 ~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDvLV   83 (277)
T PRK06180          4 MKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEALHPGRALARVLDVTDFDAIDGVVADAEATVGPIDVLV   83 (277)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             98899917873999999999998799999998999999999986799579999837999999999999999819986999


Q ss_pred             EEECCCCCC---C----EEECCCCCHHH-------HH---H--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             761244433---1----00012210134-------43---2--0123343333201025762123453211234311345
Q gi|254780595|r   70 QCIKPSSEG---D----PCIISMSKDFY-------KF---M--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        70 ~~~~~~~~~---~----~~~~~~~~~~~-------~~---~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++++.....   +    .....+..|+.       +.   +  .+..++|.+||.+-+-           +.-....|+.
T Consensus        84 NNAG~~~~~~~e~~~~~~~~~~~~vN~~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~~-----------~~p~~~~Y~a  152 (277)
T PRK06180         84 NNAGYGHEGAIEESPLAEMRRQFEVNVFGAVAMIKAVLPGMRARRRGHIVNITSMGGLI-----------TMPGIAYYCG  152 (277)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHHHH
T ss_conf             89977888863339999999999885377654420048888965896577535466525-----------7999827999


Q ss_pred             HHHHHHHHHHHCC---CCCCCCCCCCCCCCCC
Q ss_conf             5445555432001---2345676420347777
Q gi|254780595|r  131 QRFNAEKEWLAIT---KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       131 ~k~~~E~~~~~~~---~~~~~~~~ilR~~~iy  159 (289)
                      +|.+.+.+...++   ..+|+.+..+-|+.|-
T Consensus       153 SK~Al~~lt~sLa~El~~~gIrVn~V~PG~v~  184 (277)
T PRK06180        153 SKFALEGISEALAKEVAPFGIHVTAVEPGSFR  184 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             99999999999999843238689999707872


No 78 
>PRK07326 short chain dehydrogenase; Provisional
Probab=98.82  E-value=6.4e-08  Score=64.69  Aligned_cols=183  Identities=13%  Similarity=0.070  Sum_probs=105.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCEEEECCCCCCCHHH------HHHHCCCCEEEE
Q ss_conf             3999888-88899999999988988999967944634556----449828980678640234------654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKGISPFLFADQKINNLL------REKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~~~~~~~~~~~~~~~~------~~~~~~~~~v~~   70 (289)
                      .+||||| +=||..+++.|.++|++|....|+.++...+.    ..++..+..|..+.+...      .+....+|.+++
T Consensus         7 valITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDiLVN   86 (235)
T PRK07326          7 AALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKRNVLGLACDVRDEADVRQAVDAHVEAFGGLDILVN   86 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99993826799999999999879999999898899999999842398699996389999999999999998299669998


Q ss_pred             EECCCCCC---CEEECC----CCCHHH-------HHH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             61244433---100012----210134-------432-----01233433332010257621234532112343113455
Q gi|254780595|r   71 CIKPSSEG---DPCIIS----MSKDFY-------KFM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQ  131 (289)
Q Consensus        71 ~~~~~~~~---~~~~~~----~~~~~~-------~~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~  131 (289)
                      +++-....   +.....    ..-|+.       +..     .+-.++|.+||.+-+.           +......|+.+
T Consensus        87 NAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~ag~~-----------~~~~~~~Y~as  155 (235)
T PRK07326         87 NAGVGHFAPVEELTLEEWRLVIDTNLTGAFYTIKAAVPALLKRGGGYIVNISSLAGKN-----------PFAGGAAYNAS  155 (235)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC-----------CCCCCHHHHHH
T ss_conf             8877899882659999999999998799999999999999971998899983655507-----------58998369999


Q ss_pred             HHHHHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             445555432001---2345676420347777898503444311345432221100010247777999999951355786
Q gi|254780595|r  132 RFNAEKEWLAIT---KKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI  207 (289)
Q Consensus       132 k~~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~i  207 (289)
                      |...+.+.+..+   ..+|+.+..+-|+.|-=    .|..   .    ....+. ...+.-+|+|+++.++++.+..-.
T Consensus       156 K~al~~lt~~la~El~~~gIrVn~v~PG~v~T----~~~~---~----~~~~~~-~~~l~PedVA~av~flls~P~~v~  222 (235)
T PRK07326        156 KFGLLGLSEALMLDLRDYDVRVSTIMPGSVAT----HFNG---H----PPGEDD-AWKIQPEDVAQAVLDLLRMPPRTL  222 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEEECCEEC----CCCC---C----CCCCCC-CCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             99999999999998474694999998058907----8889---9----986221-137999999999999984989971


No 79 
>PRK06924 short chain dehydrogenase; Provisional
Probab=98.82  E-value=9.8e-08  Score=63.65  Aligned_cols=196  Identities=14%  Similarity=0.112  Sum_probs=95.6

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCCEEEECCCCCC---CHHHHHH---HC----C
Q ss_conf             93-999888-88899999999988988999967944634----55644982898067864---0234654---11----5
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGISPFLFADQKI---NNLLREK---LY----F   64 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~~~~~~~~~~~---~~~~~~~---~~----~   64 (289)
                      || +||||| +=||..++++|.++|++|+++.|+..+..    .....+...+..|..+.   +..+...   ..    .
T Consensus         1 MK~alITGas~GIG~aiA~~la~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~~~~~~~   80 (251)
T PRK06924          1 MRYVIITGTSKGLGEAIATQLLEKGTSVISISRRENKELTKLAEQYNSNLTFHSLDLQDLHNLETNFNEILSSIQEDDVS   80 (251)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999929874999999999998799999997982278999998746893699997058999999999999986431568


Q ss_pred             CCEEEEEECCCC---CC-C----EEECCCCCHH----------HHHHH---CCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             632787612444---33-1----0001221013----------44320---12334333320102576212345321123
Q gi|254780595|r   65 TTHIVQCIKPSS---EG-D----PCIISMSKDF----------YKFMP---HVKWIGYLSSTSIYGNREGQWVDEHSFVH  123 (289)
Q Consensus        65 ~~~v~~~~~~~~---~~-~----~~~~~~~~~~----------~~~~~---~~~~~i~~SS~~VYg~~~g~~i~E~~~~~  123 (289)
                      .++++++++-..   .. +    .....+..|+          .....   ...++|.+||....           .|..
T Consensus        81 ~i~LVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~~~~~~~~~~g~IvnisS~a~~-----------~~~~  149 (251)
T PRK06924         81 SIHLINNAGMVAPIKPAEKAESEQLITHVHINLLAPMILTSTFMKHTKDWKVDKRVINISSGAAK-----------NPYF  149 (251)
T ss_pred             CEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHC-----------CCCC
T ss_conf             64899548764556862119999999999876099999999999999984799854999724325-----------8999


Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCC-----CCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCC-----CCCEE-CCHHHHHH
Q ss_conf             43113455445555432001234-----567642034777789850344431134543222-----11000-10247777
Q gi|254780595|r  124 PISCVATQRFNAEKEWLAITKKL-----NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK-----KNQVF-NRIRVEDV  192 (289)
Q Consensus       124 P~~~y~~~k~~~E~~~~~~~~~~-----~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~-----~~~~~-~~ihv~Dv  192 (289)
                      ....|+.+|.+.+.+.+..+.+.     ++.+..+-|+.|--|   ....++.........     +-... -+..-+|+
T Consensus       150 ~~~~Y~aSKaal~~ltk~lA~E~~~~~~~I~v~av~PG~v~T~---m~~~~~~~~~~~~~~~~~~~~~~~~gr~~~Peev  226 (251)
T PRK06924        150 GWSAYCSSKAGLNMFTQTVATEQEEEEYPVKIIAFSPGVMDTN---MQAQIRSSSKEDFTNLDRFITLKEEGKLLSPEYV  226 (251)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCH---HHHHHHHHCHHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             9769999999999999999998371599989999840788474---5677743024439999987647878999799999


Q ss_pred             HHHHHHHHCCC---CCCCEEC
Q ss_conf             99999995135---5786162
Q gi|254780595|r  193 ARCVIFLMTHH---LGGIFNL  210 (289)
Q Consensus       193 a~~i~~l~~~~---~~~iyni  210 (289)
                      |+++.+|+...   -|+++.+
T Consensus       227 A~~v~fL~s~~~fitG~vi~v  247 (251)
T PRK06924        227 AGALRNLLETEDFPNGEVYDI  247 (251)
T ss_pred             HHHHHHHHCCCCCCCCCEEEE
T ss_conf             999999977899999877751


No 80 
>PRK07578 short chain dehydrogenase; Provisional
Probab=98.82  E-value=5.6e-08  Score=65.04  Aligned_cols=178  Identities=15%  Similarity=0.113  Sum_probs=97.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCC-
Q ss_conf             93999888-8889999999998898899996794463455644982898067864023465411563278761244433-
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG-   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~-   78 (289)
                      |||||||+ +=||+.+++.|.+ +++|+...|+...        +..++.|.... +.+.+....+|+++++++..... 
T Consensus         1 MrVlVTGas~GIG~aia~~la~-~~~vv~~~r~~~~--------~~~Dvtd~~~v-~~~~~~~G~iD~lVnnAG~~~~~~   70 (199)
T PRK07578          1 MKILVIGASGTIGRAVVAELSA-RHEVITAGRSSGD--------VQVDITDPASI-RALFEKVGKVDAVVSAAGKVHFAP   70 (199)
T ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCCEEEEECCCCC--------EEEECCCHHHH-HHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             9799999874899999999967-9998998368677--------56858899999-999996299989998872267989


Q ss_pred             ------CEEECCCCCHH----------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             ------10001221013----------44320123343333201025762123453211234311345544555543200
Q gi|254780595|r   79 ------DPCIISMSKDF----------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAI  142 (289)
Q Consensus        79 ------~~~~~~~~~~~----------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~  142 (289)
                            +.....+..++          ...+..-..++++||....           .|......|+.+|...+.+.+.+
T Consensus        71 ~~~~~~e~~~~~~~~nl~g~~~l~~~~~~~l~~gGsIv~isS~~~~-----------~~~~~~~~Y~asKaal~~ltr~l  139 (199)
T PRK07578         71 LTEMTDEDFQLGLQSKLMGQINLVLIGQEYLNDGGSFTLTSGILSE-----------EPIPGGASAATVNGALEGFVKAA  139 (199)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHEE-----------CCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             4879998977787200138999999999987608985688313000-----------76888189999999999999999


Q ss_pred             CCCC--CCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEECC
Q ss_conf             1234--567642034777789850344431134543222110001024777799999995135-57861626
Q gi|254780595|r  143 TKKL--NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLS  211 (289)
Q Consensus       143 ~~~~--~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni~  211 (289)
                      +.+.  ++++..+-|+.|    +.+|.+.....+  .      ......+|+|.+++...+.. .|++++++
T Consensus       140 A~El~~gIRVN~VaPG~V----~T~m~~~~~~~~--~------~~~~~~~~~A~a~l~~~~~~~tgqv~~v~  199 (199)
T PRK07578        140 ALELPRGIRINVVSPTVL----TESLDKYGPFFP--G------FEPVPAADVALAYLRSVEGAQTGEVYKVG  199 (199)
T ss_pred             HHHCCCCCEEEEEECCCC----CCHHHHCCCCCC--C------CCCCCHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             997487979999856865----565665555489--9------99879999999999742255774378559


No 81 
>PRK08703 short chain dehydrogenase; Provisional
Probab=98.81  E-value=1.8e-07  Score=62.15  Aligned_cols=187  Identities=16%  Similarity=0.124  Sum_probs=102.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCC-CE--EEECCCCCCC-----HHHH---HHH-CC
Q ss_conf             3999888-8889999999998898899996794463455----6449-82--8980678640-----2346---541-15
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKG-IS--PFLFADQKIN-----NLLR---EKL-YF   64 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~-~~--~~~~~~~~~~-----~~~~---~~~-~~   64 (289)
                      .+||||| +=||..+++.|.++|++|+.+.|+.++....    ...+ ..  .+..|..+.+     +...   +.. ..
T Consensus         8 ~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~G~   87 (239)
T PRK08703          8 TILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIAEATQGK   87 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             89994886289999999999879989999798889999999999737995499998505630789999999999983799


Q ss_pred             CCEEEEEECCCCCCCEE----ECC----CCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             63278761244433100----012----210134-------4320-----123343333201025762123453211234
Q gi|254780595|r   65 TTHIVQCIKPSSEGDPC----IIS----MSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        65 ~~~v~~~~~~~~~~~~~----~~~----~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      +|.++++++......+.    ...    +.-++.       +..+     .-.++|++||.+.+-           |...
T Consensus        88 lD~lvnnAG~~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~p~m~~~~~g~Ii~isS~~~~~-----------~~~~  156 (239)
T PRK08703         88 LDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGET-----------PKAY  156 (239)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHCC-----------CCCC
T ss_conf             76899666545788953328999999999888089999999999999877990899981445477-----------8988


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CC-CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             311345544555543200123---45-67642034777789850344431134543222110001024777799999995
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LN-IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~-~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      ...|+.+|...+.+.+.++.+   +| +++..+-|+.|--|.+   .+...+.        ....+...+|++.++++|.
T Consensus       157 ~~~Y~asKaal~~ltk~lA~E~~~~g~IrVN~i~PG~i~T~~~---~~~~~~~--------~~~~~~~~~dia~a~~~La  225 (239)
T PRK08703        157 WGGFGASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQR---IKSHPGE--------AKSERKSYGDVLPAFVWWA  225 (239)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCH---HHHCCCC--------CHHCCCCHHHHHHHHHHHH
T ss_conf             6689999999999999999984789898999998488979681---5458697--------6010599999999999983


Q ss_pred             CCC----CCCCEEC
Q ss_conf             135----5786162
Q gi|254780595|r  201 THH----LGGIFNL  210 (289)
Q Consensus       201 ~~~----~~~iyni  210 (289)
                      ...    .|++.++
T Consensus       226 S~~s~~itGq~i~v  239 (239)
T PRK08703        226 SAESKGRSGEIVYL  239 (239)
T ss_pred             CHHHCCCCEEEEEC
T ss_conf             88777995206769


No 82 
>PRK06914 short chain dehydrogenase; Provisional
Probab=98.80  E-value=8.9e-08  Score=63.89  Aligned_cols=145  Identities=15%  Similarity=0.103  Sum_probs=85.0

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC--------CCEEEECCCCCCCHH--HH---HHHCCCCEE
Q ss_conf             999888-8889999999998898899996794463455644--------982898067864023--46---541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK--------GISPFLFADQKINNL--LR---EKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~--------~~~~~~~~~~~~~~~--~~---~~~~~~~~v   68 (289)
                      +||||| +=||..++.+|.++|++|++..|+.++...+...        .+..+..|..+.+..  +.   .....+|.+
T Consensus         6 alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~g~iDvL   85 (280)
T PRK06914          6 AIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLNLSQNIKVQQLDVTDQNSIHNFQLFLKEYGRIDLL   85 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             99907344999999999998799899998988999999999996499976699968899999999999999982998789


Q ss_pred             EEEECCCCCC---CEEE----CCCCCHHH-------HH---H--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000----12210134-------43---2--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCI----ISMSKDFY-------KF---M--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~----~~~~~~~~-------~~---~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +...    ..+..|+.       +.   +  .+-.++|.+||.+-+  .         +.--.+.|+
T Consensus        86 VNNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~--~---------~~p~~~~Y~  154 (280)
T PRK06914         86 VNNAGYANGGFVEEIPVEEYRKQFETNVFGAISVTQAVLPYMRKQKSGKIINISSISGQ--V---------GFPALSPYV  154 (280)
T ss_pred             EECCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--C---------CCCCCHHHH
T ss_conf             97886677874211779999999987128999899999787775699589998341332--6---------899873799


Q ss_pred             HHHHHHHHHHHHC---CCCCCCCCCCCCCCCC
Q ss_conf             5544555543200---1234567642034777
Q gi|254780595|r  130 TQRFNAEKEWLAI---TKKLNIKLAVLRLSGI  158 (289)
Q Consensus       130 ~~k~~~E~~~~~~---~~~~~~~~~ilR~~~i  158 (289)
                      .+|.+.+......   ....|+.+..+-|+.|
T Consensus       155 aSK~Al~~~t~sL~~El~~~gI~V~~V~PG~i  186 (280)
T PRK06914        155 SSKYALEGWSESLRLEVKPFGIDVALIEPGSY  186 (280)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             99999999999999984310938999972898


No 83 
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.80  E-value=4.8e-08  Score=65.41  Aligned_cols=193  Identities=17%  Similarity=0.083  Sum_probs=106.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEE-CCHHHHH----HHHHCCC--EEEECCCCCCC---HHHH---HHHCCCCE
Q ss_conf             3999888-8889999999998898899996-7944634----5564498--28980678640---2346---54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTT-RSVSNLL----TLKHKGI--SPFLFADQKIN---NLLR---EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~-r~~~~~~----~l~~~~~--~~~~~~~~~~~---~~~~---~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|++|+... |+.++..    .+...+.  ..+..|..+.+   ..+.   +....+|.
T Consensus         7 ~vlITGgs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~   86 (247)
T PRK05565          7 VAIVTGASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEKFGKIDI   86 (247)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89993784589999999999879989998179989999999999963990899983589999999999999998099849


Q ss_pred             EEEEECCCCCCC---EEEC----CCCCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             787612444331---0001----22101----------34432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEGD---PCII----SMSKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~~---~~~~----~~~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++......   ....    .+..+          ....+  .+..++|++||.+.+-.           ......|
T Consensus        87 lVnnAg~~~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~-----------~~~~~~Y  155 (247)
T PRK05565         87 LVNNAGISKFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIMIKRGSGVIVNISSIWGLIG-----------ASCEVLY  155 (247)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-----------CCCCHHH
T ss_conf             99899878999915599999999999854789999998579887569975999735122578-----------9983388


Q ss_pred             HHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHH-----HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             4554455554320012---3456764203477778985034-----4431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPF-----IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~-----~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|...+.+.+.++.   .+++.+..+.|+.+--|....+     ..+.+..    +.+    -+...+|+|+++.+|+
T Consensus       156 ~asKaal~~ltr~lA~e~~~~gIrvN~V~PG~~~T~~~~~~~~~~~~~~~~~~----p~~----R~~~p~dva~~v~fL~  227 (247)
T PRK05565        156 SASKGAVNAFTKALAKELAPSGIRVNAIAPGAIETEMNSSFSEEDKEGLAEEI----PLG----RLGEPEEIAKVVLFLA  227 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCC----CCC----CCCCHHHHHHHHHHHH
T ss_conf             99999999999999999543094999996098957421004977899998559----988----9939999999999996


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|++.++-.|
T Consensus       228 s~~s~~itG~~i~VDGG  244 (247)
T PRK05565        228 SDDASYITGQIITVDGG  244 (247)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             86221856864874849


No 84 
>PRK05875 short chain dehydrogenase; Provisional
Probab=98.78  E-value=2.8e-07  Score=61.09  Aligned_cols=195  Identities=13%  Similarity=0.062  Sum_probs=109.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHC-----CCEEEECCCCCCCHH---H---HHHHCCC
Q ss_conf             3999888-888999999999889889999679446345----5644-----982898067864023---4---6541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHK-----GISPFLFADQKINNL---L---REKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~-----~~~~~~~~~~~~~~~---~---~~~~~~~   65 (289)
                      .+||||+ +=||..++++|.++|.+|....|+.++...    +...     .+..+..|..+.++.   +   .+....+
T Consensus         9 ~alVTGas~GIG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~~~~Dvs~~~~v~~~v~~~~~~~g~i   88 (277)
T PRK05875          9 TYLVTGGGSGIGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAGGAGAVRYEPADVTNEDEVARAVDAATAWHGRL   88 (277)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89994887499999999999879989999798899999999999612788628999578999999999999999984995


Q ss_pred             CEEEEEECCCCCCCEEE----CC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             32787612444331000----12----21013----------4432--01233433332010257621234532112343
Q gi|254780595|r   66 THIVQCIKPSSEGDPCI----IS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        66 ~~v~~~~~~~~~~~~~~----~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      |.++++++......+..    ..    +..++          ....  .+-.++|.+||.+...           +....
T Consensus        89 D~LVnnAg~~~~~~~~~~~~~e~w~~~~~iNl~g~~~~~~~~~~~m~~~~~GsIVnisS~~~~~-----------~~~~~  157 (277)
T PRK05875         89 HGVVHCAGGSETIGPITQIDSEAWRRTVDLNVNGTMYVLKHAARELVRGGGGSFVGISSIASSN-----------THRWF  157 (277)
T ss_pred             EEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCC-----------CCCCC
T ss_conf             3999878136787972559999999999997388999999999999874897241475304336-----------78751


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHH
Q ss_conf             11345544555543200123---4567642034777789850-------3444311345432221100010247777999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~  195 (289)
                      ..|+.+|...+.+.+.++.+   +++.+-.+-|+.+.-|...       ....+.+..+..        -+-..+|+|++
T Consensus       158 ~~Y~asKaal~~ltk~lA~Ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pediA~~  229 (277)
T PRK05875        158 GAYGVSKAAVDHLMKLAADELGPSWVRVNSIRPGLIRTDLVAPITESPEVSADYAACTPLP--------RVGEVEDIANL  229 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHH
T ss_conf             6679999999999999999971069699998638898653542147999999999579999--------98689999999


Q ss_pred             HHHHHCCC----CCCCEECCCCCH
Q ss_conf             99995135----578616268433
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDDEP  215 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~~~  215 (289)
                      +.+|....    -|+++.+-.|..
T Consensus       230 v~FL~Sd~s~~iTGq~i~VDGG~~  253 (277)
T PRK05875        230 AMFLLSDAASWITGQVINVDGGHM  253 (277)
T ss_pred             HHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             999958831686588179980566


No 85 
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=98.78  E-value=6.4e-08  Score=64.69  Aligned_cols=199  Identities=10%  Similarity=0.016  Sum_probs=107.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEEEECC
Q ss_conf             3999888-8889999999998898899996794463455644982898067864023------46541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL------LREKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~~~   74 (289)
                      ++||||+ +=||..++++|.++|++|.++.|+.++...  ...+..+..|..+.+..      +......+|.++++++.
T Consensus        10 ~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l~~--~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDilVnnAG~   87 (253)
T PRK08220         10 TVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQLNE--QYPFATFVLDVADAAAVAQVCQRLLAETGPLDVLVNVAGV   87 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHC--CCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             89995885689999999999879999999788778748--9977999973799999999999999973998889989987


Q ss_pred             CCCC---CEE---E-CCCCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4433---100---0-1221013----------44320--12334333320102576212345321123431134554455
Q gi|254780595|r   75 SSEG---DPC---I-ISMSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        75 ~~~~---~~~---~-~~~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      ....   +..   + ..+..++          ...+.  +-.++|++||.+..           .|......|+.+|.+.
T Consensus        88 ~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IV~isS~~~~-----------~~~~~~~~Y~asKaal  156 (253)
T PRK08220         88 LRMGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQFRRQRGGAIVTVGSNAAH-----------TPRIGMAAYGASKAAL  156 (253)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHH-----------CCCCCCHHHHHHHHHH
T ss_conf             89998044999999999999746389999999987777389659999747871-----------8689838899999999


Q ss_pred             HHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--
Q ss_conf             554320012---3456764203477778985034-------4431134543222110001024777799999995135--
Q gi|254780595|r  136 EKEWLAITK---KLNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       136 E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--  203 (289)
                      +.+.+.++.   .+|+.+-.+-|+.|--|-...+       .+...+.......+-..--+...+|+|+++.+|....  
T Consensus       157 ~~lt~~lA~el~~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~iPl~R~~~p~diA~~v~fL~S~~s~  236 (253)
T PRK08220        157 TSLTKCVGLELAPYGVRCNVVSPGSTDTDMQRTLWVDEDGEQQRIAGFPEQFKLGIPLGKIARPQEIANAVLFLASDLAS  236 (253)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999995430959999960889874455432481478999986599885589988981999999999999585433


Q ss_pred             --CCCCEECCCC
Q ss_conf             --5786162684
Q gi|254780595|r  204 --LGGIFNLSDD  213 (289)
Q Consensus       204 --~~~iyni~~~  213 (289)
                        -|++..+-.|
T Consensus       237 ~itGq~i~vDGG  248 (253)
T PRK08220        237 HITMQDIVVDGG  248 (253)
T ss_pred             CCCCCEEEECCC
T ss_conf             924832889937


No 86 
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=98.78  E-value=1.1e-07  Score=63.47  Aligned_cols=193  Identities=11%  Similarity=-0.029  Sum_probs=106.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH-----HHHHC--CCEEEECCCCCCCHH---HH---HHHCCCCE
Q ss_conf             3999888-88899999999988988999967944634-----55644--982898067864023---46---54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL-----TLKHK--GISPFLFADQKINNL---LR---EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~-----~l~~~--~~~~~~~~~~~~~~~---~~---~~~~~~~~   67 (289)
                      .+||||+ +=||..++++|.++|++|+...|+.++..     .+...  .+..+..|..+....   +.   .....+|.
T Consensus         7 ~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~~g~iD~   86 (248)
T PRK05557          7 VALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKALAVQGDVADAESIERAVDEAKAEFGGVDI   86 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89994897689999999999879989999698565899999999963995899990389999999999999998299719


Q ss_pred             EEEEECCCCCCC---EEECCC----CCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             787612444331---000122----101----------34432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEGD---PCIISM----SKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~~---~~~~~~----~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++......   ......    ..+          +...+  .+-.++|++||.+..           .+......|
T Consensus        87 linnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~~G~IVnisS~~~~-----------~~~~~~~~Y  155 (248)
T PRK05557         87 LVNNAGITRDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPMMKQRSGRIINISSVVGL-----------MGNPGQANY  155 (248)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC-----------CCCCCCHHH
T ss_conf             998997799999155999999999987830499999999999997069718998046656-----------789995556


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-C----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             45544555543200123---456764203477778985-0----344431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-N----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|.+.+.+.+..+.+   +++++..+.|+.+--|-- .    ...++.+..+        .--+...+|+|.++.+|+
T Consensus       156 ~asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~p--------l~R~~~p~dva~~v~fL~  227 (248)
T PRK05557        156 AASKAGVIGFTKSLARELASRGITVNAVAPGFIETDMTDALPEDVKEAILAQIP--------LGRLGQPEEIASAVAFLA  227 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHHHH
T ss_conf             999999999999999985331949999974888775421179999999985799--------999809999999999996


Q ss_pred             CCCC----CCCEECCCC
Q ss_conf             1355----786162684
Q gi|254780595|r  201 THHL----GGIFNLSDD  213 (289)
Q Consensus       201 ~~~~----~~iyni~~~  213 (289)
                      ....    |+...+-.|
T Consensus       228 S~~s~~iTG~~i~VDGG  244 (248)
T PRK05557        228 SDEAAYITGQTLHVNGG  244 (248)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             87222835872887967


No 87 
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=98.78  E-value=1.8e-07  Score=62.11  Aligned_cols=187  Identities=15%  Similarity=0.048  Sum_probs=105.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----C-CC--EEEECCCCCCCHHHH---H---HHCCCC
Q ss_conf             93999888-888999999999889889999679446345564----4-98--289806786402346---5---411563
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----K-GI--SPFLFADQKINNLLR---E---KLYFTT   66 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~-~~--~~~~~~~~~~~~~~~---~---~~~~~~   66 (289)
                      ++++|||| +=||..+++.|.++|++|+.+.|+.+++..+..    . ++  ..+..|..+.+....   +   ....+|
T Consensus         7 ~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~~~~Id   86 (265)
T COG0300           7 KTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKERGGPID   86 (265)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             67999778864899999999977997999967699999999999873086279997767883679999999982488523


Q ss_pred             EEEEEECCCCCCCE---EECC----CCCHHHH----------HH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             27876124443310---0012----2101344----------32--0123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEGDP---CIIS----MSKDFYK----------FM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~~~---~~~~----~~~~~~~----------~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++.......   ....    ..-|+.+          ..  .+..++|-++|.+-|=  .       .|  -..-
T Consensus        87 vLVNNAG~g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~~~G~IiNI~S~ag~~--p-------~p--~~av  155 (265)
T COG0300          87 VLVNNAGFGTFGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVERGAGHIINIGSAAGLI--P-------TP--YMAV  155 (265)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC--C-------CC--CHHH
T ss_conf             89977874776654218858999999999999999999999999865896699984345328--8-------86--3279


Q ss_pred             HHHHHHHH----HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             34554455----55432001234567642034777789850344431134543222110001024777799999995135
Q gi|254780595|r  128 VATQRFNA----EKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       128 y~~~k~~~----E~~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      |+.+|...    |.+ +...+..|+.++.+-|+.+.    ..|.. ..+........+  ..+.-.+|+|+..+..+++.
T Consensus       156 Y~ATKa~v~~fSeaL-~~EL~~~gV~V~~v~PG~~~----T~f~~-~~~~~~~~~~~~--~~~~~~~~va~~~~~~l~~~  227 (265)
T COG0300         156 YSATKAFVLSFSEAL-REELKGTGVKVTAVCPGPTR----TEFFD-AKGSDVYLLSPG--ELVLSPEDVAEAALKALEKG  227 (265)
T ss_pred             HHHHHHHHHHHHHHH-HHHHCCCCEEEEEEECCCCC----CCCCC-CCCCCCCCCCCH--HHCCCHHHHHHHHHHHHHCC
T ss_conf             999999999999999-99835898499999657333----55333-444432112321--23069999999999998509


Q ss_pred             CCC
Q ss_conf             578
Q gi|254780595|r  204 LGG  206 (289)
Q Consensus       204 ~~~  206 (289)
                      ...
T Consensus       228 k~~  230 (265)
T COG0300         228 KRE  230 (265)
T ss_pred             CCE
T ss_conf             836


No 88 
>PRK07890 short chain dehydrogenase; Provisional
Probab=98.77  E-value=3.9e-07  Score=60.23  Aligned_cols=202  Identities=12%  Similarity=0.065  Sum_probs=110.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCC--EEEECCCCCCCH------HHHHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----64498--289806786402------346541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGI--SPFLFADQKINN------LLREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~--~~~~~~~~~~~~------~~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++....    ...+.  ..+..|..+...      ...+....+|.+
T Consensus         7 ~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~fG~iDiL   86 (258)
T PRK07890          7 VVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRRALAVVTDITDEAQVANLVDAALERFGRVDVL   86 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89996856589999999999879989999798999999999999649958999816999999999999999984999899


Q ss_pred             EEEECCCCCCCEE----ECCC----CCHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433100----0122----1013----------44-32012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGDPC----IISM----SKDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~~~----~~~~----~~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......+.    ....    ..++          .. ..++-.++|++||...+..           ......|+
T Consensus        87 VnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m~~~~G~IVnisS~~~~~~-----------~~~~~~Y~  155 (258)
T PRK07890         87 VNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPALAESGGSVVMINSMVLRHS-----------QPKYGAYK  155 (258)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCC-----------CCCCHHHH
T ss_conf             9868667899980029999999999987599999999889999976985999825654888-----------99977899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-CHHHHHHCCCCCCC---C---CCCCEE-CCHHHHHHHHHHHH
Q ss_conf             5544555543200123---456764203477778985-03444311345432---2---211000-10247777999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-NPFIKIRQKNSLRL---V---KKNQVF-NRIRVEDVARCVIF  198 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~~~~~~~~g~~~~~---~---~~~~~~-~~ihv~Dva~~i~~  198 (289)
                      .+|.+.+.+.+.++.+   +|+.+-.+-|+.|..|.- ..+...........   .   ...... -+.--+|+|+++.+
T Consensus       156 ~sKaal~~ltk~lA~ela~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~R~g~p~diA~~v~f  235 (258)
T PRK07890        156 MAKGALLAASQSLATELGPQGIRVNSVAPGYIWGDPLQGYFDHQAGKYGTTVEEIYAATAANSDLKRLPTDDEVASAVLF  235 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999997140959999951878875256688766654299989999999707999999799999999999


Q ss_pred             HHCCC----CCCCEECCCCC
Q ss_conf             95135----57861626843
Q gi|254780595|r  199 LMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       199 l~~~~----~~~iyni~~~~  214 (289)
                      |....    .|++..+-.|+
T Consensus       236 L~Sd~a~~iTG~~i~VDGG~  255 (258)
T PRK07890        236 LASDLASAITGQTLDVNCGE  255 (258)
T ss_pred             HHCCHHCCCCCCEEEECCCC
T ss_conf             95853239438747866890


No 89 
>PRK07832 short chain dehydrogenase; Provisional
Probab=98.77  E-value=8.6e-08  Score=63.97  Aligned_cols=193  Identities=11%  Similarity=0.005  Sum_probs=106.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEE---EECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----56449828---9806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISP---FLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~---~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      +++|||| +=||..++.+|.++|++|..+.|+.++...    +...+...   +..|..+. +.+.       +....+|
T Consensus         2 ~alITGassGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~-~~v~~~~~~~~~~~g~iD   80 (272)
T PRK07832          2 RCFVTGAASGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGTVPEHRALDISDY-DAVAAFAADIHAAHPSMD   80 (272)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCH-HHHHHHHHHHHHHCCCCC
T ss_conf             7999472019999999999988998999989889999999999845897147885668999-999999999999729988


Q ss_pred             EEEEEECCCCCCC------EEEC-CCCCH----------HHH-HHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             2787612444331------0001-22101----------344-320--12334333320102576212345321123431
Q gi|254780595|r   67 HIVQCIKPSSEGD------PCII-SMSKD----------FYK-FMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~~~------~~~~-~~~~~----------~~~-~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      .++++++-.....      ..+. .+.-|          +.. ..+  +..++|.+||.+-+-           +.-..+
T Consensus        81 iLiNNAGi~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~~G~IVnisS~ag~~-----------~~p~~~  149 (272)
T PRK07832         81 VVMNIAGISAWGTVDRLTHEQWRRMVDINLMGPIHVIETFVPPMVAAGRGGHLVNVSSAAGLV-----------GLPWHA  149 (272)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCC
T ss_conf             899878768888734589999999999872899999999999999838996899975777556-----------899980


Q ss_pred             HHHHHHHHHHHHHHH---CCCCCCCCCCCCCCCCCCCCCCCHHHHHH-CCC---CCCCCCC-CC-EECCHHHHHHHHHHH
Q ss_conf             134554455554320---01234567642034777789850344431-134---5432221-10-001024777799999
Q gi|254780595|r  127 CVATQRFNAEKEWLA---ITKKLNIKLAVLRLSGIYGPKRNPFIKIR-QKN---SLRLVKK-NQ-VFNRIRVEDVARCVI  197 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~---~~~~~~~~~~ilR~~~iyGp~r~~~~~~~-~g~---~~~~~~~-~~-~~~~ihv~Dva~~i~  197 (289)
                      .|+.+|.+.......   ....+|+.++++-|+.|=-|   .+...+ .+.   .+..... .. ....+.-+++|+.++
T Consensus       150 ~Y~ASK~av~g~~esL~~El~~~gI~V~~v~PG~v~T~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~spe~vA~~i~  226 (272)
T PRK07832        150 AYSASKYGLRGLSEVLRFDLARHGIGVSVVVPGAVKTP---LVNTVEIAGVDRDDPRVQKWVDRFRGHAVTPEKAADKIL  226 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC---CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             29999999999999999985210978999974889888---788856346676644578887640256999999999999


Q ss_pred             HHHCCCCCCCEE
Q ss_conf             995135578616
Q gi|254780595|r  198 FLMTHHLGGIFN  209 (289)
Q Consensus       198 ~l~~~~~~~iyn  209 (289)
                      ..++++...+|-
T Consensus       227 ~ai~~~k~~i~~  238 (272)
T PRK07832        227 AGVERNRYLVYT  238 (272)
T ss_pred             HHHHCCCCEEEC
T ss_conf             999659979971


No 90 
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.76  E-value=1.3e-07  Score=63.01  Aligned_cols=185  Identities=18%  Similarity=0.131  Sum_probs=103.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCC--EEEECCCCCCCH---HH---HHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----64498--289806786402---34---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGI--SPFLFADQKINN---LL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~--~~~~~~~~~~~~---~~---~~~~~~~~~v   68 (289)
                      .++|||+ +=||..++..|.++|++|..+.|+.++...+    ...+.  ..+..|..+.+.   .+   .+....+|.+
T Consensus         8 valITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL   87 (238)
T PRK07666          8 NALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGLGSIDIL   87 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89991637789999999999879989999899999999999999559927999930799999999999999981998789


Q ss_pred             EEEECCCCCC---CEEECC----CCCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---100012----2101----------34432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIIS----MSKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~----~~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-....   +.....    +.-+          ....+  .+-.++|.+||.+-+-   +        ......|+
T Consensus        88 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IInisS~ag~~---~--------~~~~~~Y~  156 (238)
T PRK07666         88 INNAGISKFGKFLELDVAEWEKIIQVNLMGVYYVTRAVLPSMIEQQSGDIINISSTAGQK---G--------APVTSAYS  156 (238)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHC---C--------CCCCCHHH
T ss_conf             984745799982339999999999896299999999999999974995899987777706---7--------99980699


Q ss_pred             HHHHHHHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             55445555432001---234567642034777789850344431134543222110001024777799999995135578
Q gi|254780595|r  130 TQRFNAEKEWLAIT---KKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG  206 (289)
Q Consensus       130 ~~k~~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~  206 (289)
                      .+|.....+.+..+   ..+++.+..+-|+.|-=|    |.+   +.......++   ...--+|+|++++++++.++..
T Consensus       157 aSK~av~glt~~la~El~~~gIrVn~v~PG~v~T~----m~~---~~~~~~~~~~---~~~~PedVA~~vv~~l~~~~~~  226 (238)
T PRK07666        157 ASKFAVLGLTESLMMEVRKHNIRVTALTPSTVATD----MAV---DLGLTDGNPD---KVMQPEDLAEFIVAQLKLNPRT  226 (238)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----CCC---CCCCCCCCCC---CCCCHHHHHHHHHHHHCCCCCE
T ss_conf             99999999999999985413969999985889862----467---8777878830---2579999999999998399863


Q ss_pred             C
Q ss_conf             6
Q gi|254780595|r  207 I  207 (289)
Q Consensus       207 i  207 (289)
                      .
T Consensus       227 ~  227 (238)
T PRK07666        227 F  227 (238)
T ss_pred             E
T ss_conf             7


No 91 
>PRK07479 consensus
Probab=98.75  E-value=3e-07  Score=60.89  Aligned_cols=198  Identities=12%  Similarity=0.040  Sum_probs=106.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCC--CEEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-8889999999998898899996794463455----6449--8289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKG--ISPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~--~~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|++|....|+.++...+    ...+  ...+..|..+.+ .+.       +....+|.
T Consensus         7 ~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~-~~~~~~~~~~~~~G~iD~   85 (252)
T PRK07479          7 VAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAGGNAIAVAADVSRGA-DVEALVEAALEAFGRVDI   85 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHH-HHHHHHHHHHHHHCCCCE
T ss_conf             8999388768999999999987999999979899999999999853997899992589999-999999999998199859


Q ss_pred             EEEEECCCCCCCEE----ECC----CCCH----------HHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433100----012----2101----------344320--123343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEGDPC----IIS----MSKD----------FYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~~~~----~~~----~~~~----------~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++......+.    ...    +..+          ....+.  +-.++|.+||.+.+-.           ......
T Consensus        86 lVnnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~~~-----------~~~~~~  154 (252)
T PRK07479         86 VVNNAGTTHRNKPMLDVTEAEFDRVYAVNVKSIYLSTRHFVPHFRAQGGGVIINIASTAGVRP-----------RPGLTW  154 (252)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-----------CCCCCH
T ss_conf             998997668998827699999999999986310565444049898679972999804876689-----------999717


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCC-C----CCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             345544555543200123---45676420347777898503444311345-4----322211000102477779999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNS-L----RLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~-~----~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      |+.+|...+.+.+.++.+   +++.+-.+.|+.+-.|-   +..+..... .    .+.+.-..--+...+|+++++.+|
T Consensus       155 Y~asKaal~~ltr~lA~el~~~gIrVN~I~Pg~~~T~~---~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL  231 (252)
T PRK07479        155 YNASKGAVITATKAMAAELAPDNIRVNCLNPVAGETGL---LTEFMGVEDTPENRAKFLATIPLGRFSTPQDVANAALYL  231 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHH---HHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999999999951409699999669787657---887613799899999997079989980999999999999


Q ss_pred             HCCC----CCCCEECCCCC
Q ss_conf             5135----57861626843
Q gi|254780595|r  200 MTHH----LGGIFNLSDDE  214 (289)
Q Consensus       200 ~~~~----~~~iyni~~~~  214 (289)
                      ....    -|++.++-.|.
T Consensus       232 ~S~~s~~iTGq~i~VDGG~  250 (252)
T PRK07479        232 ASDEASFITGVCLEVDGGR  250 (252)
T ss_pred             HCCHHCCCCCCEEEECCCC
T ss_conf             6844329468818859896


No 92 
>PRK07023 short chain dehydrogenase; Provisional
Probab=98.75  E-value=2.4e-07  Score=61.47  Aligned_cols=147  Identities=12%  Similarity=0.073  Sum_probs=79.9

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHHCCCEEEECCCCCCCHH---HHH----H-H--CCCCEE
Q ss_conf             93999888-88899999999988988999967944634-55644982898067864023---465----4-1--156327
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL-TLKHKGISPFLFADQKINNL---LRE----K-L--YFTTHI   68 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~-~l~~~~~~~~~~~~~~~~~~---~~~----~-~--~~~~~v   68 (289)
                      ||.||||| .=||..++++|.++|++|+++.|+..... .........+..|..+....   +..    . .  ...+.+
T Consensus         2 ~rAlITGas~GIG~aiA~~la~~G~~Vi~~~r~~~~~l~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~~~~~~~~~~~il   81 (243)
T PRK07023          2 VRAIVTGHSRGLGAALAEQLLQPGIAVLGVSRSRHPSLAARAGERLAEVELDLSDPAAAAAWLAGDTLRAFVDGASRVLL   81 (243)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999287629999999999987999999979978999986799757999505778999999999999975413775899


Q ss_pred             EEEECCC---CCCCEE----E-CCCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8761244---433100----0-1221013----------4432--01233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPS---SEGDPC----I-ISMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~---~~~~~~----~-~~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++-.   ...+..    + ..+..|+          ....  ..-.++|++||.+.+-           +.-....|
T Consensus        82 inNAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~~~~~~~~~~g~IInisS~a~~~-----------~~~~~~~Y  150 (243)
T PRK07023         82 INNAGTVEPIGPLDTQDAAAIARAVGLNVAAPLMLTAALAQAASDAAERRILHISSGAARN-----------AYAGWSVY  150 (243)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHCC-----------CCCCCHHH
T ss_conf             9779878888751009999999999997599999999999999972798605783311167-----------89996689


Q ss_pred             HHHHHHHHHHHHHCCCC--CCCCCCCCCCCCC
Q ss_conf             45544555543200123--4567642034777
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK--LNIKLAVLRLSGI  158 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~--~~~~~~ilR~~~i  158 (289)
                      +.+|.+.+.+.+.++.+  .++.+..+-|+.|
T Consensus       151 ~aSKaal~~~t~sla~E~~~~IrVn~V~PG~v  182 (243)
T PRK07023        151 CATKAALDHHARAVALEANRALRIVSLAPGVV  182 (243)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             99999999999999986799988999963779


No 93 
>PRK07060 short chain dehydrogenase; Provisional
Probab=98.74  E-value=3.6e-07  Score=60.45  Aligned_cols=193  Identities=16%  Similarity=0.110  Sum_probs=108.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCC--HHHHHHHCCCCEEEEEECCCCC
Q ss_conf             3999888-8889999999998898899996794463455644-9828980678640--2346541156327876124443
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKIN--NLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~--~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      +++|||+ +=||..+++.|.+.|++|+...|+.+....+... +...+..|..+..  .........+|.++++++....
T Consensus        11 ~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~iDilVnnAG~~~~   90 (245)
T PRK07060         11 SVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGETGCEPLRLDVGDDAAIRAALAGAGAFDGLVNCAGIASL   90 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89994777689999999999879999999799899999998639879998079999999999965999899989887999


Q ss_pred             CC---EEECC----CCCH----------HHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             31---00012----2101----------34432-0--1233433332010257621234532112343113455445555
Q gi|254780595|r   78 GD---PCIIS----MSKD----------FYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK  137 (289)
Q Consensus        78 ~~---~~~~~----~~~~----------~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~  137 (289)
                      ..   .....    +..+          ..... +  +...+|++||.+-+-   +        ......|+.+|.+.+.
T Consensus        91 ~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~m~~~~~~G~IInisS~~~~~---~--------~~~~~~Y~asKaav~~  159 (245)
T PRK07060         91 ESAIDMTAAGFDRVMAVNARGALLVARHVARAMIRAGRGGSIVNVSSQAALV---G--------LPDHLAYCASKAALDA  159 (245)
T ss_pred             CCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC---C--------CCCCHHHHHHHHHHHH
T ss_conf             9901399999999999970999999999999999808980799986643257---8--------9974789999999999


Q ss_pred             HHHHCCCC---CCCCCCCCCCCCCCCCCC-C------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC---
Q ss_conf             43200123---456764203477778985-0------3444311345432221100010247777999999951355---
Q gi|254780595|r  138 EWLAITKK---LNIKLAVLRLSGIYGPKR-N------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL---  204 (289)
Q Consensus       138 ~~~~~~~~---~~~~~~ilR~~~iyGp~r-~------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~---  204 (289)
                      +.+..+.+   +++++-.+=|+.+.-|-. .      ....+....+  +      --+..-+|+|+++.+|.....   
T Consensus       160 ltkslA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~p--l------~R~g~peeiA~~v~fL~S~~ss~i  231 (245)
T PRK07060        160 ATRVLCVELGPHGIRVNSVNPTVTLTPMAEFAWSDPQKSEPMLAAIP--L------GRFAEVDDVAAPILFLLSDAASMV  231 (245)
T ss_pred             HHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCC--C------CCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999610192999997698987667642489999999995599--9------997889999999999958642581


Q ss_pred             -CCCEECCCC
Q ss_conf             -786162684
Q gi|254780595|r  205 -GGIFNLSDD  213 (289)
Q Consensus       205 -~~iyni~~~  213 (289)
                       |+++.+-.+
T Consensus       232 TG~~i~VDGG  241 (245)
T PRK07060        232 SGVSLPVDGG  241 (245)
T ss_pred             CCCEEEECCC
T ss_conf             4842886956


No 94 
>PRK08945 short chain dehydrogenase; Provisional
Probab=98.74  E-value=2.5e-07  Score=61.29  Aligned_cols=185  Identities=13%  Similarity=0.094  Sum_probs=102.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC---EEEECCC--CCCC------HHHHHHHCCC
Q ss_conf             3999888-888999999999889889999679446345----564498---2898067--8640------2346541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI---SPFLFAD--QKIN------NLLREKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~---~~~~~~~--~~~~------~~~~~~~~~~   65 (289)
                      .+||||+ +=||..+++.|.++|++|+.+.|+.+++..    +...+.   ..+..|.  .+..      ..+.+....+
T Consensus        15 ~~lITGas~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~~~g~i   94 (245)
T PRK08945         15 IILVTGAGDGIGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGGPQPAIIPLDLLGATEQNYQDLADTIEEQFGRL   94 (245)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89994886189999999999879989999698899999999999747984489994467599999999999999980998


Q ss_pred             CEEEEEECCCCCCCEE--------ECCCCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             3278761244433100--------01221013----------44320--1233433332010257621234532112343
Q gi|254780595|r   66 THIVQCIKPSSEGDPC--------IISMSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        66 ~~v~~~~~~~~~~~~~--------~~~~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      |.++++++......+.        ...+..++          ...+.  +-.++|++||..-+  ..         ....
T Consensus        95 D~lVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~Ii~isS~~g~--~~---------~~~~  163 (245)
T PRK08945         95 DGVLHNAGLLGELGPMEQQDPEVWQDVMQVNVNATFMLTQALLPLLLKSPAASLVFTSSSVGR--QG---------RAFW  163 (245)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--CC---------CCCC
T ss_conf             799988875578988266999999998756759999999999999987799789997862106--78---------8886


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHH-HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             11345544555543200123---45676420347777898503444-311345432221100010247777999999951
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIK-IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~-~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      ..|+.+|.+.+.+.+.++.+   +++.+..+-|+.+--+    +.. ...+.        ....+-.-+|+++++.+|..
T Consensus       164 ~~Y~asKaal~~lt~~la~El~~~gIrVN~I~PG~v~T~----m~~~~~~~~--------~~~~~~~pedIa~~v~fL~S  231 (245)
T PRK08945        164 GAYAVSKFATEGMMQVLADEYQGTNLRVNCINPGATRTA----MRASAYPGE--------DPQKLKTPEDIMPLYLYLMG  231 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCH----HHHHCCCCC--------CHHHCCCHHHHHHHHHHHHC
T ss_conf             689999999999999999985756849999972888774----145318976--------63326999999999999948


Q ss_pred             CCC----CCCEE
Q ss_conf             355----78616
Q gi|254780595|r  202 HHL----GGIFN  209 (289)
Q Consensus       202 ~~~----~~iyn  209 (289)
                      ...    |++++
T Consensus       232 d~s~~itGq~i~  243 (245)
T PRK08945        232 DDSRRVNGQSFD  243 (245)
T ss_pred             CHHCCCCCCEEE
T ss_conf             301791222685


No 95 
>PRK09186 flagellin modification protein A; Provisional
Probab=98.73  E-value=3.2e-07  Score=60.70  Aligned_cols=201  Identities=17%  Similarity=0.185  Sum_probs=111.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCC---CEEEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----56449---8289806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKG---ISPFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~---~~~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      .++|||+ |=||..+++.|.++|.+|....|+.++...    +...+   +..+..|..+. ..+.       .....+|
T Consensus         6 ~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~~~~~v~~~~~Dvt~~-~~v~~~~~~~~~~~g~id   84 (255)
T PRK09186          6 TILITGAGGLIGSALVKAILEAGGIVIAADINKEALNKLLESLGTIEKTKLTLVELDITDQ-ESLEEFLSKSQERYGKID   84 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCC
T ss_conf             8999795868999999999987999999969889999999999870598079998468999-999999999999819977


Q ss_pred             EEEEEECCCCCC------CEEECCC----CCHH----------HHHH--HCCCCCCCCCCEEECCCCCCC-CCCCCCCCC
Q ss_conf             278761244433------1000122----1013----------4432--012334333320102576212-345321123
Q gi|254780595|r   67 HIVQCIKPSSEG------DPCIISM----SKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQ-WVDEHSFVH  123 (289)
Q Consensus        67 ~v~~~~~~~~~~------~~~~~~~----~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~-~i~E~~~~~  123 (289)
                      .+++++.+....      +......    ..++          ...+  .+-.++|.+||.  +|-.... ...+.++..
T Consensus        85 ~lVnnA~~~~~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~~~m~~~~~G~IVnisSi--~g~~~~~~~~~~g~~~~  162 (255)
T PRK09186         85 GAVNCAYPRNKQYGKKFFDVSLDDFNENLSLHLGSSFLFSQQFAKYFKKQGGGSLVNISSI--YGVVAPKFEIYEGTSMT  162 (255)
T ss_pred             EEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH--HHHCCCCCCCCCCCCCC
T ss_conf             8997576678767777010999999999999839999999999998874289738995667--87347642112687654


Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH-HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             4311345544555543200123---45676420347777898503-4443113454322211000102477779999999
Q gi|254780595|r  124 PISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP-FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       124 P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~-~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      ....|+.+|.+.+.+.+..+.+   +++++-.+-|+.|..+.... ....+...+.        ..+..-+|++.++.+|
T Consensus       163 ~~~~Y~asKaal~~ltr~lA~e~a~~gIrVN~VaPG~i~~~~~~~~~~~~~~~~~~--------~~~~~p~dia~~v~fL  234 (255)
T PRK09186        163 SPVEYAAIKSGIIHLTKYLAKYFKDSNIRVNCVSPGGILDNQPEAFLNAYKKSCNG--------KGMLDPEDICGSLVFL  234 (255)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCHHHHHHHHHHCCC--------CCCCCHHHHHHHHHHH
T ss_conf             46767998899999999999996758989999855768899989999999863557--------7998999999999999


Q ss_pred             HCCC----CCCCEECCCC
Q ss_conf             5135----5786162684
Q gi|254780595|r  200 MTHH----LGGIFNLSDD  213 (289)
Q Consensus       200 ~~~~----~~~iyni~~~  213 (289)
                      +...    -|+..++-.|
T Consensus       235 ~Sd~s~~iTGq~i~VDGG  252 (255)
T PRK09186        235 LSDQSKYITGQNIIVDDG  252 (255)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             570536801852883858


No 96 
>PRK07825 short chain dehydrogenase; Provisional
Probab=98.73  E-value=2.2e-07  Score=61.66  Aligned_cols=184  Identities=11%  Similarity=-0.013  Sum_probs=103.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC--CCEEEECCCCCCCHH------HHHHHCCCCEEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644--982898067864023------465411563278761
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK--GISPFLFADQKINNL------LREKLYFTTHIVQCI   72 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~--~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~   72 (289)
                      .++|||| +=||..+++.|.++|++|....|+.+........  ....+..|..+.+..      .......+|.+++++
T Consensus         7 vvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~DVtd~~~v~~~~~~~~~~~G~iDiLVNNA   86 (273)
T PRK07825          7 VIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAAELGLVVGGPLDVTDPASFAAFLDAVEADLGPIDVLVNNA   86 (273)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             89992623399999999999879989999799999999998607855999147999999999999999709977899878


Q ss_pred             CCCCCC---CE---EE-CCCCCHH----------HHH-H-HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             244433---10---00-1221013----------443-2-0123343333201025762123453211234311345544
Q gi|254780595|r   73 KPSSEG---DP---CI-ISMSKDF----------YKF-M-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        73 ~~~~~~---~~---~~-~~~~~~~----------~~~-~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      +-....   +.   .+ ..+.-|+          ... . .+-.++|.+||.+-+-           +.-....|+.+|.
T Consensus        87 Gi~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVnisS~ag~~-----------~~p~~~~Y~ASK~  155 (273)
T PRK07825         87 GIMPVGPFLDEPDRATRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNVASLAGKI-----------AVPGMATYCASKH  155 (273)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC-----------CCCCCCHHHHHHH
T ss_conf             77899873439999999998860399999999999999973994799984767647-----------7999835999999


Q ss_pred             HHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             555543200---123456764203477778985034443113454322211000102477779999999513557861
Q gi|254780595|r  134 NAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIF  208 (289)
Q Consensus       134 ~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~iy  208 (289)
                      +...+.+..   ...+|+.+..+-|+.|=    ..|.   .|...     ......+--+|+|++++..++++..+++
T Consensus       156 av~g~t~sLa~El~~~gIrVn~V~PG~v~----T~m~---~g~~~-----~~~~~~~~pe~vA~~iv~~i~~~~~~v~  221 (273)
T PRK07825        156 AVVGLTDALRLELRPTGVHVSVVLPTFVN----TELI---AGTKG-----AKGLKNAEPEDVAAAIVALVAKPRPEVR  221 (273)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCC----CCCC---CCCCC-----CCCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             99999999999852309599999709998----5657---99987-----6688999999999999999968998899


No 97 
>PRK06953 short chain dehydrogenase; Provisional
Probab=98.72  E-value=2.3e-07  Score=61.50  Aligned_cols=191  Identities=12%  Similarity=0.014  Sum_probs=104.6

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH--HHHHH--CCCCEEEEEECC
Q ss_conf             93-999888-8889999999998898899996794463455644982898067864023--46541--156327876124
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL--LREKL--YFTTHIVQCIKP   74 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~v~~~~~~   74 (289)
                      || +||||| .=||..++++|.++|++|+++.|+.+....+...+.+.+..|..+....  +...+  ...|.++++++-
T Consensus         1 MK~~LVTGas~GIG~a~a~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~~~~~~~~~ldili~nAGi   80 (222)
T PRK06953          1 MKTVLIVGASRGIGLEFVRQYRADGWRVIATARDAAGLAALRALGAEALALDVADPESIAGLGWKLDGEALDAAVYVAGV   80 (222)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             99999947572999999999998889999996888889998842151777405899999999986236776789981665


Q ss_pred             CCCCCEE-----ECCC----CCHH----------HHH-HHCCCCCCCCCCE-EECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             4433100-----0122----1013----------443-2012334333320-1025762123453211234311345544
Q gi|254780595|r   75 SSEGDPC-----IISM----SKDF----------YKF-MPHVKWIGYLSST-SIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        75 ~~~~~~~-----~~~~----~~~~----------~~~-~~~~~~~i~~SS~-~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      .......     ...+    ..|+          .-. ...-.++|.+||. +..+...         ......|+.+|.
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~lP~l~~~~g~ii~iSS~~gs~~~~~---------~~~~~~Y~aSKa  151 (222)
T PRK06953         81 YGPRTEGVEPITREDFDAVMHTNVLGPMQLLPILLPLVEAAGGVLAVLSSRMGSIGEAT---------GTTGWLYRASKA  151 (222)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCEEEECCCC---------CCCHHHHHHHHH
T ss_conf             56787654668999999999871199999999999999857998524567764313788---------863287899999


Q ss_pred             HHHHHHHHCCCCC-CCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC---CCCCCEE
Q ss_conf             5555432001234-56764203477778985034443113454322211000102477779999999513---5578616
Q gi|254780595|r  134 NAEKEWLAITKKL-NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH---HLGGIFN  209 (289)
Q Consensus       134 ~~E~~~~~~~~~~-~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~---~~~~iyn  209 (289)
                      +.+.+.+....+. ++.+..+-|+.|-    ..|.           +.+.   .+-.+..|+.++.+++.   ..+|.|-
T Consensus       152 Al~~~~~~la~e~~~i~v~ai~PG~v~----T~m~-----------~~~a---~~~~e~~a~~~~~~~~~~~~~~~G~f~  213 (222)
T PRK06953        152 ALNDALRIASLQARHAACIALHPGWVR----TDMG-----------GAQA---ALDPQQSVAGMRRVIAGDTRRDNGRFF  213 (222)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCC----CCCC-----------CCCC---CCCHHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             999999999865479889999467825----7999-----------9998---949999999999999639989995499


Q ss_pred             CCCCCHHHH
Q ss_conf             268433338
Q gi|254780595|r  210 LSDDEPAPP  218 (289)
Q Consensus       210 i~~~~~~s~  218 (289)
                      =-++++++|
T Consensus       214 ~~~g~~ipW  222 (222)
T PRK06953        214 QYDGVELSW  222 (222)
T ss_pred             CCCCCCCCC
T ss_conf             999987859


No 98 
>PRK09291 short chain dehydrogenase; Provisional
Probab=98.72  E-value=7.4e-08  Score=64.35  Aligned_cols=147  Identities=12%  Similarity=0.049  Sum_probs=87.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCEE--EECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             3999888-88899999999988988999967944634556----449828--9806786402346541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKGISP--FLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~~~~--~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      ++||||| .=||..++..|.++||+|++..|+..+...+.    ..+...  ...|..+...........+|.++++++.
T Consensus         4 ~vLITGAssGIGraiA~~la~~G~~Vi~~~r~~~~l~~l~~~~~~~g~~~~~~~lDv~~~~~~~~~~~~~iDvLVNNAGi   83 (257)
T PRK09291          4 TILITGAGSGFGREVALRLARKGHRVIAGVQIAPQVTELRAEAARRGLALRVEKLDLTDAIDRARAAEWDVDVLLNNAGI   83 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCCEEEECCCC
T ss_conf             89996898589999999999879989999687899999999998529955999898899999999808999999989856


Q ss_pred             CCCC-------CEEECCCCCHH----------HHH--HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4433-------10001221013----------443--2012334333320102576212345321123431134554455
Q gi|254780595|r   75 SSEG-------DPCIISMSKDF----------YKF--MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        75 ~~~~-------~~~~~~~~~~~----------~~~--~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      ....       +.....+..|+          ...  ..+-.++|++||.+-+  ..       .|  ....|+.+|.+.
T Consensus        84 ~~~g~i~e~~~~~~~~~~~vNv~g~~~ltq~~lp~M~~~~~G~IV~isS~ag~--~~-------~p--~~~~Y~aSK~Al  152 (257)
T PRK09291         84 GEAGALVDIPVELVRELFETNVFGPLELTQGVVRKMVARGKGKIVFVSSIAGL--IT-------GP--FTGAYCASKHAL  152 (257)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--CC-------CC--CCCHHHHHHHHH
T ss_conf             89977344999999999999979999999997899987699689998787766--89-------99--984199999999


Q ss_pred             HHHHHHCC---CCCCCCCCCCCCCCCC
Q ss_conf             55432001---2345676420347777
Q gi|254780595|r  136 EKEWLAIT---KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       136 E~~~~~~~---~~~~~~~~ilR~~~iy  159 (289)
                      +.+....+   ..+|+.+..+-|+.+-
T Consensus       153 ~~~t~sLa~El~~~GIrVn~I~PG~v~  179 (257)
T PRK09291        153 EAIAEAMHAELAPFGIQVATVNPGPYR  179 (257)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEECCCC
T ss_conf             999999999843009589999847999


No 99 
>PRK06181 short chain dehydrogenase; Provisional
Probab=98.71  E-value=5.2e-07  Score=59.50  Aligned_cols=191  Identities=14%  Similarity=0.041  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCE--EEECCCCCCCHH---H---HHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----644982--898067864023---4---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGIS--PFLFADQKINNL---L---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~~--~~~~~~~~~~~~---~---~~~~~~~~~v   68 (289)
                      .++|||| +=||..+++.|.++|++|....|+.++...+    ...+..  .+..|..+.++.   +   .+....+|.+
T Consensus         3 v~lITGassGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~~~~~~~~~~~~~G~iDiL   82 (263)
T PRK06181          3 VVIITGASEGIGRALAVRLARAGARLVLAARNEERLASLAQELANYGAEALVVATDVSDAEACERLIEAAVAHFGGIDIL   82 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99995810199999999999879989999889999999999999549967999807999999999999999982996489


Q ss_pred             EEEECCCCC------CC-EEECC-CCCHHH-------H----HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             876124443------31-00012-210134-------4----32012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSE------GD-PCIIS-MSKDFY-------K----FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~------~~-~~~~~-~~~~~~-------~----~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-...      .+ ..+.. +..|+.       +    ..++-.++|.+||.+-+-           +.-....|+
T Consensus        83 VNNAGi~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~G~IvnisS~ag~~-----------~~p~~~~Y~  151 (263)
T PRK06181         83 VNNAGMTMWSRFDELTDLSVLEDVMRVNYLGAVYCTHAALPHLKASQGQIVVVSSLAGLT-----------GVPTRSGYA  151 (263)
T ss_pred             EECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC-----------CCCCCHHHH
T ss_conf             987856788872326869999999999829999999999999863893799994755527-----------789973599


Q ss_pred             HHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHH-HHCCCCCCCCCCC-CEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             5544555543200---12345676420347777898503444-3113454322211-00010247777999999951355
Q gi|254780595|r  130 TQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIK-IRQKNSLRLVKKN-QVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       130 ~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~-~~~g~~~~~~~~~-~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      .+|.+...+.+..   ...+|+.+..+-|+.|--|    |.. ...+......... ........+|+|+.++..++++.
T Consensus       152 aSK~av~~~t~~la~El~~~gIrVn~v~PG~v~T~----~~~~~~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~ai~~~k  227 (263)
T PRK06181        152 ASKHALHGFFDSLRIELADTGVAVTVVCPGFVATD----IRKRALDGDGKPLGKSPMQEGKIMSAEECAEMMLPAIARRK  227 (263)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCC----CCHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999999999984755939999972889897----47001444555234674435678999999999999996699


Q ss_pred             CCC
Q ss_conf             786
Q gi|254780595|r  205 GGI  207 (289)
Q Consensus       205 ~~i  207 (289)
                      ..+
T Consensus       228 ~~v  230 (263)
T PRK06181        228 RLL  230 (263)
T ss_pred             CEE
T ss_conf             799


No 100
>PRK07775 short chain dehydrogenase; Provisional
Probab=98.71  E-value=1.5e-07  Score=62.58  Aligned_cols=192  Identities=13%  Similarity=0.080  Sum_probs=104.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCC--CEEEECCCCCCCH---HHH---HHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634556----449--8289806786402---346---541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKG--ISPFLFADQKINN---LLR---EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~--~~~~~~~~~~~~~---~~~---~~~~~~~~v   68 (289)
                      .+||||| +=||..+++.|.+.|++|....|+.++...+.    ..+  ...+..|..+...   .+.   .....+|.+
T Consensus        12 tAlVTGAssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL   91 (275)
T PRK07775         12 PAIVAGASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEAVAFPLDVTDPDSVKSFVAQATEALGDIEVL   91 (275)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79994623599999999999879989999898999999999999649948999912899999999999999985996599


Q ss_pred             EEEECCCCCC---CEEECC----CCCHH-------HHHH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---100012----21013-------4432-----012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIIS----MSKDF-------YKFM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~----~~~~~-------~~~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +.....    ...|+       .+..     .+..++|++||+..+...           -....|+
T Consensus        92 VnNAG~~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~a~lP~M~~~~~G~IV~isS~a~~~~~-----------p~~~~Y~  160 (275)
T PRK07775         92 VSGAGDTYFGKLHEISTEQFESQVQIHLVGANRLATAVLPGMVERRRGDLIFVGSDVALRQR-----------PHMGAYG  160 (275)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCC-----------CCCHHHH
T ss_conf             97675688886010999999999988527999999999999997599579998447650689-----------9980599


Q ss_pred             HHHHHHHHHHHHCC---CCCCCCCCCCCCCCCCCCC-CCH-HHHHHCCCCCCCCCCCCE-E-CCHHHHHHHHHHHHHHCC
Q ss_conf             55445555432001---2345676420347777898-503-444311345432221100-0-102477779999999513
Q gi|254780595|r  130 TQRFNAEKEWLAIT---KKLNIKLAVLRLSGIYGPK-RNP-FIKIRQKNSLRLVKKNQV-F-NRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       130 ~~k~~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~-r~~-~~~~~~g~~~~~~~~~~~-~-~~ihv~Dva~~i~~l~~~  202 (289)
                      .+|...+.+.+.++   ..+|+.+..+.|+.|==|- ... -..+..... .+...++. . -+.--+|+|+++.+++..
T Consensus       161 AsKaav~~lt~~La~El~~~gIrVn~V~PG~v~T~m~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~pedIA~av~flas~  239 (275)
T PRK07775        161 AAKAGLVAMVTNLQMELEGTGVRASIVHPGPTKTSMGWSLPAEQIGPALE-DWAKWGQARHDYFLRASDLARAITFVAET  239 (275)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHH-HHHHHCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999999985656908999972688188988878666405778-88874112566898999999999999669


Q ss_pred             CCC
Q ss_conf             557
Q gi|254780595|r  203 HLG  205 (289)
Q Consensus       203 ~~~  205 (289)
                      +.+
T Consensus       240 P~~  242 (275)
T PRK07775        240 PRG  242 (275)
T ss_pred             CCC
T ss_conf             984


No 101
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.71  E-value=8.7e-07  Score=58.23  Aligned_cols=189  Identities=21%  Similarity=0.230  Sum_probs=106.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CC-CEEEECCCCCCCHHHH-------HHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345564----49-8289806786402346-------541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KG-ISPFLFADQKINNLLR-------EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~-~~~~~~~~~~~~~~~~-------~~~~~~~~v   68 (289)
                      ++||||+ +=||..+++.|.++|.+|+...|++++...+..    .+ +..+..|..+. +...       .....+|.+
T Consensus         7 ~~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dvs~~-~~v~~~~~~~~~~~g~iD~l   85 (238)
T PRK05786          7 NVLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKYGNVIYVVGDVSKL-EGAREAAEKAAKVFGALHGL   85 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHHCCCCEE
T ss_conf             89992898789999999999879999999698899999999874359779997578999-99999999999983998879


Q ss_pred             EEEECCCCCC--CE---EECCCCCHH----------HHHHHCCCCCCCCCCEE-ECCCCCCCCCCCCCCCCC-CCHHHHH
Q ss_conf             8761244433--10---001221013----------44320123343333201-025762123453211234-3113455
Q gi|254780595|r   69 VQCIKPSSEG--DP---CIISMSKDF----------YKFMPHVKWIGYLSSTS-IYGNREGQWVDEHSFVHP-ISCVATQ  131 (289)
Q Consensus        69 ~~~~~~~~~~--~~---~~~~~~~~~----------~~~~~~~~~~i~~SS~~-VYg~~~g~~i~E~~~~~P-~~~y~~~  131 (289)
                      +++++.....  +.   .......++          ...+.+-..+|.+||++ ++..            .| ...|+.+
T Consensus        86 v~naG~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~~~m~~g~~ii~iss~~~~~~~------------~~~~~~Y~as  153 (238)
T PRK05786         86 VVTAGGYIEDTVEELAGLEDMLNNHLKAPLYAVNASLPLLREGSSIVLVSSIRGIYKA------------WPRQLSYAAA  153 (238)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHCCCC------------CCCCHHHHHH
T ss_conf             9805756788523189999999998589999999999974216779999644541678------------9861789999


Q ss_pred             HHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC---CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--
Q ss_conf             44555543200123---45676420347777898---50344431134543222110001024777799999995135--
Q gi|254780595|r  132 RFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK---RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       132 k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~---r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--  203 (289)
                      |.+.+.+.+..+.+   +|+.+-.+-|+.+-.+.   +. ......     .  +.   ....-+|+|+++.+|+...  
T Consensus       154 Kaal~~ltk~lA~ela~~gIrVN~IaPG~i~t~~~~~~~-~~~~~~-----~--~~---~~~~peeiA~~v~fL~S~~a~  222 (238)
T PRK05786        154 KAGLAKAVEILAAELLDRGIRVNGVAPSGIDGDFVPGRD-WKKLRK-----L--GD---PQAPPEDFAKVIIWLLTDEAE  222 (238)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCC-HHHHHH-----H--CC---CCCCHHHHHHHHHHHHCCHHC
T ss_conf             999999999999996417959999962889988877768-698776-----3--01---799999999999999697213


Q ss_pred             --CCCCEECCCCC
Q ss_conf             --57861626843
Q gi|254780595|r  204 --LGGIFNLSDDE  214 (289)
Q Consensus       204 --~~~iyni~~~~  214 (289)
                        -|+++++-.|.
T Consensus       223 ~iTG~~i~VDGG~  235 (238)
T PRK05786        223 WVNGVVIPVDGGR  235 (238)
T ss_pred             CCCCCEEEECCCH
T ss_conf             9668808889350


No 102
>PRK06139 short chain dehydrogenase; Provisional
Probab=98.71  E-value=3.9e-07  Score=60.25  Aligned_cols=190  Identities=12%  Similarity=0.034  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----64498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .++|||| +=||..+++.|.++|++|....|+.+.+..+    ...+.  ..+..|..+.+..      ..+....+|.+
T Consensus         8 vvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~G~IDiL   87 (324)
T PRK06139          8 VVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFLGRIDVW   87 (324)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79993825499999999999879989999899999999999999549948999766788578999999999974998788


Q ss_pred             EEEECCCCCC--CE-EECC----CCCHHH----------HHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433--10-0012----210134----------4320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG--DP-CIIS----MSKDFY----------KFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~--~~-~~~~----~~~~~~----------~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-....  +. ....    +..|+.          ..+.  +-.++|.+||.+-+-.         .|  -.+.|+
T Consensus        88 VNNAGi~~~g~~~e~~~e~~~~vi~vNl~G~~~~~~aalp~M~~~g~G~IINisS~ag~~~---------~P--~~saY~  156 (324)
T PRK06139         88 FNNVGVGAVGRFEETPLEAHEQVIQTNLIGYLRDAHAALPIFKAQGHGIFINMISLGGFAA---------QP--YAAAYS  156 (324)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCC---------CC--CCCHHH
T ss_conf             6457557777535599999999999986999999999999998659918999736324136---------99--984198


Q ss_pred             HHHHHHHHH----HHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCH-HHHHHHHHHHHHHCCCC
Q ss_conf             554455554----3200123456764203477778985034443113454322211000102-47777999999951355
Q gi|254780595|r  130 TQRFNAEKE----WLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRI-RVEDVARCVIFLMTHHL  204 (289)
Q Consensus       130 ~~k~~~E~~----~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~i-hv~Dva~~i~~l~~~~~  204 (289)
                      .+|...+-+    -.+..+..++.++.+-|+.|=-|..   ..-++......    +....+ .-+.+|++|+++.+++.
T Consensus       157 ASK~Av~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP~~---~~~~~~~~~~~----~~~~p~~~pe~vA~ai~~~~~~~~  229 (324)
T PRK06139        157 ASKFGLRGFSEALRAELTDFPDIHVCDVYPAFVDTPGF---RHGANYTGRRL----TPPPPMYDPRRVAKAMVRLADRPR  229 (324)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCC---HHHHHCCCCCC----CCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999999999983799891899985799588520---14353378788----999998799999999999983899


Q ss_pred             CCCEE
Q ss_conf             78616
Q gi|254780595|r  205 GGIFN  209 (289)
Q Consensus       205 ~~iyn  209 (289)
                      .++|-
T Consensus       230 r~~~v  234 (324)
T PRK06139        230 NTTTV  234 (324)
T ss_pred             CEEEC
T ss_conf             72541


No 103
>PRK08177 short chain dehydrogenase; Provisional
Probab=98.70  E-value=7.3e-07  Score=58.69  Aligned_cols=190  Identities=14%  Similarity=0.063  Sum_probs=102.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCC--HHHHHHH--CCCCEEEEEECCC
Q ss_conf             3999888-8889999999998898899996794463455644-9828980678640--2346541--1563278761244
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKIN--NLLREKL--YFTTHIVQCIKPS   75 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~--~~~~~~~--~~~~~v~~~~~~~   75 (289)
                      ++||||| .=||..++++|.++|++|+++.|++++...+... +......|..+..  ..+...+  ...|.++++++-.
T Consensus         3 ~~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~D~~~~~~i~~~~~~~~~~~iDvlinNAGi~   82 (225)
T PRK08177          3 TALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQALPGVHIERLDMNDPASLDQLLQRLQGQRFDLLFVNAGIS   82 (225)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             89992734299999999999886999999798877899872548728998458889999999996067788899878436


Q ss_pred             CCC-----CEEECC----CCCHHH-----------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC-CCHHHHHHHH
Q ss_conf             433-----100012----210134-----------4320123343333201025762123453211234-3113455445
Q gi|254780595|r   76 SEG-----DPCIIS----MSKDFY-----------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP-ISCVATQRFN  134 (289)
Q Consensus        76 ~~~-----~~~~~~----~~~~~~-----------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P-~~~y~~~k~~  134 (289)
                      ...     +.....    +..++.           .....-.+++++||..-.  ..       .+..| ...|+.+|.+
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~~N~~~~~~l~~~~~~~l~~~~g~iv~isS~~g~--~~-------~~~~~~~~~Y~aSKaA  153 (225)
T PRK08177         83 GPAHQSAADATAAEIGQLFLTNAIAPIRLARRLLGQVRPGQGVLAFMSSQLGS--VE-------LPDGGEMPLYKASKAA  153 (225)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEE--EC-------CCCCCCCHHHHHHHHH
T ss_conf             76767846599999999999987899999999988863167877533301332--01-------4898863677999999


Q ss_pred             HHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC---CCCCCE
Q ss_conf             55543200123---456764203477778985034443113454322211000102477779999999513---557861
Q gi|254780595|r  135 AEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH---HLGGIF  208 (289)
Q Consensus       135 ~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~---~~~~iy  208 (289)
                      .+.+.+.++.+   .++.+..+.|+.|-    ..|.    +       .+   -.+-+++.|+.++..++.   ..+|.|
T Consensus       154 l~~lt~sla~El~~~gI~Vn~i~PG~v~----T~M~----~-------~~---a~~~~e~~a~~~~~~i~~~~~~~~g~f  215 (225)
T PRK08177        154 LNSMTRSFVAELGEPDLTVLSMHPGWVK----TDMG----G-------DA---APLDVETSTKGLVEQIEAASGKGGHRF  215 (225)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCC----CCCC----C-------CC---CCCCHHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             9999999999846578299999718881----6999----9-------99---997999999999999972798889748


Q ss_pred             ECCCCCHHHH
Q ss_conf             6268433338
Q gi|254780595|r  209 NLSDDEPAPP  218 (289)
Q Consensus       209 ni~~~~~~s~  218 (289)
                      -=-++++++|
T Consensus       216 ~~~~g~~~pw  225 (225)
T PRK08177        216 IDYQGEPLPW  225 (225)
T ss_pred             ECCCCCCCCC
T ss_conf             9989967859


No 104
>PRK07577 short chain dehydrogenase; Provisional
Probab=98.69  E-value=2.9e-08  Score=66.66  Aligned_cols=186  Identities=14%  Similarity=0.094  Sum_probs=104.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC---HHHHH--HHCCCCEEEEEECCC
Q ss_conf             3999888-88899999999988988999967944634556449828980678640---23465--411563278761244
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN---NLLRE--KLYFTTHIVQCIKPS   75 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~---~~~~~--~~~~~~~v~~~~~~~   75 (289)
                      ++||||+ +=||..+++.|.++|++|+.+.|+..+.  +   ..+.+..|..+..   ..+..  ....+|.++++++..
T Consensus         5 ~alITGas~GIG~aia~~la~~G~~Vv~~~r~~~~~--~---~~~~~~~D~~d~~~~~~~~~~~~~~~~id~LVnnAG~~   79 (234)
T PRK07577          5 TVLVTGATKGIGLALSLRLANLGHQVIGIARSAIDD--F---PGELFACDLADIEQTAATLAQINEIHPVDAIVNNVGIA   79 (234)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCC--C---CCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             899937788899999999998799999963475447--8---97699995799999999999999769998999899889


Q ss_pred             CCC-------CEEECCCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             433-------10001221013----------4432--0123343333201025762123453211234311345544555
Q gi|254780595|r   76 SEG-------DPCIISMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        76 ~~~-------~~~~~~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      ...       +.....+..++          ...+  .+-.++|++||.+++|..            ....|+.+|...+
T Consensus        80 ~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~~------------~~~~Y~asKaal~  147 (234)
T PRK07577         80 LPQPLGKIDLAALQDVYDLNVRAAVQVTQAFLEGMKLREQGRIVNICSRAIFGAL------------DRTSYSAAKSALV  147 (234)
T ss_pred             CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHCCCCC------------CCHHHHHHHHHHH
T ss_conf             9988055999999999999979999999999999887489867999601102788------------7477899999999


Q ss_pred             HHHHHCCCC---CCCCCCCCCCCCCCCCC-C-------CHHHHHHCCCCCCCCCCCCEEC-CHHHHHHHHHHHHHHCCC-
Q ss_conf             543200123---45676420347777898-5-------0344431134543222110001-024777799999995135-
Q gi|254780595|r  137 KEWLAITKK---LNIKLAVLRLSGIYGPK-R-------NPFIKIRQKNSLRLVKKNQVFN-RIRVEDVARCVIFLMTHH-  203 (289)
Q Consensus       137 ~~~~~~~~~---~~~~~~ilR~~~iyGp~-r-------~~~~~~~~g~~~~~~~~~~~~~-~ihv~Dva~~i~~l~~~~-  203 (289)
                      .+.+.++.+   +|+.+-.+-|+.|--+- +       ....++....         ... ....+|+|+++.+|+... 
T Consensus       148 ~ltkslA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~---------P~~R~g~p~eia~~v~fL~s~~s  218 (234)
T PRK07577        148 GCTRTWALELAEYGITVNAVAPGPIETELFRQTRPVGSEEEKRVLASI---------PMRRLGTPEEVAAAIAFLLSDDA  218 (234)
T ss_pred             HHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCCCCHHHHHHHHHCC---------CCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             999999999865596999995488977355422758889999998579---------99998889999999999958521


Q ss_pred             ---CCCCEECCCC
Q ss_conf             ---5786162684
Q gi|254780595|r  204 ---LGGIFNLSDD  213 (289)
Q Consensus       204 ---~~~iyni~~~  213 (289)
                         -|++.++-.|
T Consensus       219 ~~itGq~i~VdGG  231 (234)
T PRK07577        219 GFITGQVLGVDGG  231 (234)
T ss_pred             CCCCCCEEEECCC
T ss_conf             5812824784889


No 105
>PRK08263 short chain dehydrogenase; Provisional
Probab=98.69  E-value=1.1e-07  Score=63.37  Aligned_cols=146  Identities=16%  Similarity=0.156  Sum_probs=87.9

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCHH---H---HHHHCCCCEEEEEE
Q ss_conf             999888-8889999999998898899996794463455644---982898067864023---4---65411563278761
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINNL---L---REKLYFTTHIVQCI   72 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~~---~---~~~~~~~~~v~~~~   72 (289)
                      +||||| .=||..+++.|.++|++|+++.|+.+++..+...   .+..+..|..+....   +   ......+|.+++++
T Consensus         6 ~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiLVNNA   85 (275)
T PRK08263          6 WFITGASRGFGREWTEAALERGDRVVATARDTATLADLAERYGDALLPLALDVTDRAAVFAAVEQAVKHFGRLDIVVNNA   85 (275)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99946743999999999998799899997989999999997599679999648999999999999999849987899888


Q ss_pred             CCCCCC---C----EEECCCCCHHH-------HHH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             244433---1----00012210134-------432-----0123343333201025762123453211234311345544
Q gi|254780595|r   73 KPSSEG---D----PCIISMSKDFY-------KFM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        73 ~~~~~~---~----~~~~~~~~~~~-------~~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      +.....   +    .....+..|+.       +..     .+-.++|.+||.+-+-   +      .|  -...|+.+|.
T Consensus        86 G~~~~~~~~e~~~~~~~~~~~vNl~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~~---~------~p--~~~~Y~ASK~  154 (275)
T PRK08263         86 GYGLFGMIEEVTESEARAQIDTNVFGALWVTQAVLPYLRAQRSGHIIQISSIGGIS---A------FP--MVGIYHASKW  154 (275)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEECCHHHCC---C------CC--CCCHHHHHHH
T ss_conf             66788874769999999999986199999876426133516997799945701056---7------99--9707999999


Q ss_pred             HHHHHHHHCC---CCCCCCCCCCCCCCCC
Q ss_conf             5555432001---2345676420347777
Q gi|254780595|r  134 NAEKEWLAIT---KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       134 ~~E~~~~~~~---~~~~~~~~ilR~~~iy  159 (289)
                      +.+.+.+..+   ..+|+.+.++-|+.|-
T Consensus       155 Al~~lt~sLa~El~~~gIrVn~V~PG~v~  183 (275)
T PRK08263        155 ALEGFSEALAQEVAHFGIKVTLVEPGGYS  183 (275)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             99999999999840339689999708875


No 106
>PRK07201 short chain dehydrogenase; Provisional
Probab=98.69  E-value=3.6e-07  Score=60.43  Aligned_cols=179  Identities=15%  Similarity=0.132  Sum_probs=101.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCE--EEECCCCCCCH------HHHHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----644982--89806786402------346541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGIS--PFLFADQKINN------LLREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~~--~~~~~~~~~~~------~~~~~~~~~~~v   68 (289)
                      .++|||| .=||..++.+|.++|.+|....|+.+++..+    ...+.+  .+..|..+.+.      .+......+|.+
T Consensus       378 valITGASSGIG~A~A~~LA~~GA~Vvl~AR~~e~Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~~G~IDVL  457 (663)
T PRK07201        378 HVIITGASSGIGRATAIKVAEAGATVFALARDGEKLDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGRHGHVDYL  457 (663)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79993887599999999999879989999899999999999999559918999962799999999999999967998889


Q ss_pred             EEEECCCCC------CCE---EECCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             876124443------310---0012210134-------4320-----123343333201025762123453211234311
Q gi|254780595|r   69 VQCIKPSSE------GDP---CIISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        69 ~~~~~~~~~------~~~---~~~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      +++++....      .+.   ....+.-|+.       +..+     +-.++|.+||.+++-..         |  -.+.
T Consensus       458 VNNAG~si~~~~~~~~d~~~d~er~m~vN~~G~v~l~~a~lP~M~~r~~G~IVNISSiag~~~~---------P--~~sa  526 (663)
T PRK07201        458 VNNAGRSIRRSVVNSTDRFHDYERTMQLNYFGAVRLVLGLLPHMRERRFGHVVNISSIGVQTNA---------P--RFSA  526 (663)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCC---------C--CCHH
T ss_conf             9896446757501134549999999999749999999999998885399399997556547789---------9--8649


Q ss_pred             HHHHHHHHHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH-CCC
Q ss_conf             3455445555432001---234567642034777789850344431134543222110001024777799999995-135
Q gi|254780595|r  128 VATQRFNAEKEWLAIT---KKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM-THH  203 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~---~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~-~~~  203 (289)
                      |+.+|.+.|...+...   ...|+.++.+.|+.|-=|    |..--+     ..   ....-+.-+|+|+.++.++ +++
T Consensus       527 YsASKaAl~aftr~La~Ela~~GVrVttI~PG~V~Tp----Miapt~-----~y---~~~p~l~pe~aA~~i~~a~~~~p  594 (663)
T PRK07201        527 YVASKAALDAFARVAASETLSDGITFTNIHMPLVRTP----MIAPTK-----RY---NPVPTLSPEEAADMVARALVEKP  594 (663)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC----CCCCCC-----CC---CCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             9999999999999999983757828999715971788----778752-----22---78998999999999999985188


No 107
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=98.69  E-value=3.2e-07  Score=60.75  Aligned_cols=192  Identities=14%  Similarity=0.075  Sum_probs=105.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HH-HHC--CCEEEECCCCCCCH---HH---HHHHCCCCEE
Q ss_conf             999888-88899999999988988999967944634----55-644--98289806786402---34---6541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TL-KHK--GISPFLFADQKINN---LL---REKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l-~~~--~~~~~~~~~~~~~~---~~---~~~~~~~~~v   68 (289)
                      +||||+ +=||..+++.|.++|++|+...|+.++..    .. ...  .+..+..|..+.+.   .+   .+....+|.+
T Consensus         5 alITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~g~iDiL   84 (245)
T PRK12824          5 ALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEEGPVDIL   84 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99947888899999999998799899995880778999999874049938999913899999999999999974999899


Q ss_pred             EEEECCCCCCC---EEECCC----C----------CHHHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---000122----1----------0134432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCIISM----S----------KDFYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~~----~----------~~~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......   -.....    .          +.....+  .+-.++|++||.+.+-..           .....|+
T Consensus        85 VnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~-----------~~~~~Y~  153 (245)
T PRK12824         85 VNNAGITRDSGFKRMSHQEWNDVINTNLNSVFNVTQPLFPAMCEQGYGRIINISSVNGLKGQ-----------FGQTNYS  153 (245)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC-----------CCCHHHH
T ss_conf             98988899999023999999999999734159999999999998399559997467757788-----------9968999


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-----CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             5544555543200123---456764203477778985-----03444311345432221100010247777999999951
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-----NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-----~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .+|.....+.+.++++   +|+.+-.+-|+.+--|--     ....++.+..+..        -+.-.+|+|+++.+|..
T Consensus       154 asKaal~~ltk~lA~E~a~~gIrvN~I~PG~i~T~~~~~~~~e~~~~~~~~~Pl~--------R~g~peevA~~v~FL~S  225 (245)
T PRK12824        154 AAKAGMIGFTKALASEGARYGITVNCIAPGYIATPMVEQAGPEVLQSIKNQIPMK--------RLGTPEEIAAAVAFLVS  225 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCHHCCHHHHHHHHHCCCCC--------CCCCHHHHHHHHHHHHC
T ss_conf             9999999999999999725491999997446878210005999999998569988--------98789999999999958


Q ss_pred             CCC----CCCEECCCC
Q ss_conf             355----786162684
Q gi|254780595|r  202 HHL----GGIFNLSDD  213 (289)
Q Consensus       202 ~~~----~~iyni~~~  213 (289)
                      ...    |++..+..|
T Consensus       226 d~a~~iTG~~i~VDGG  241 (245)
T PRK12824        226 EAAGFITGETISINGG  241 (245)
T ss_pred             CHHCCCCCCEEEECCC
T ss_conf             6325841853797867


No 108
>PRK07035 short chain dehydrogenase; Provisional
Probab=98.68  E-value=5.3e-07  Score=59.48  Aligned_cols=192  Identities=14%  Similarity=0.067  Sum_probs=104.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCC--CEEEECCCCCCCH---HH---HHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----56449--8289806786402---34---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKG--ISPFLFADQKINN---LL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~--~~~~~~~~~~~~~---~~---~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|++|....|+.++...    +...+  ...+..|..+.+.   .+   .+....+|.+
T Consensus        10 valITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDil   89 (252)
T PRK07035         10 IALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERHGRLDIL   89 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995887499999999999879989999798899999999999649957999824899999999999999982997789


Q ss_pred             EEEECCCCCCCEE----ECCC--------------CCHHHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8761244433100----0122--------------101344320--1233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPSSEGDPC----IISM--------------SKDFYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~~~~~----~~~~--------------~~~~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++......+.    ....              .+.....+.  .-.++|++||...+.           |......|
T Consensus        90 VnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IvnisS~~~~~-----------~~~~~~~Y  158 (252)
T PRK07035         90 VNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKLMKEQGGGSIVNVASVNGVS-----------PGDFQGIY  158 (252)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHH
T ss_conf             8768558888882009999999999987124310004536999966997499972544368-----------89874889


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH-------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             45544555543200123---45676420347777898503-------444311345432221100010247777999999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP-------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~-------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +.+|...+.+.+.++.+   +|+.+-.+.|+.+-.+....       ...+....+        .--+...+|+++++.+
T Consensus       159 ~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~P--------l~R~g~pedia~~v~f  230 (252)
T PRK07035        159 SITKAAVISMTKAFAKECAPFGIRVNALLPGLTDTKFASALFKNDAILKQALAHIP--------LRRHAEPSEMAGAVLY  230 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHH
T ss_conf             99999999999999998603295999996287887424302489999999985699--------9998299999999999


Q ss_pred             HHCCC----CCCCEECCC
Q ss_conf             95135----578616268
Q gi|254780595|r  199 LMTHH----LGGIFNLSD  212 (289)
Q Consensus       199 l~~~~----~~~iyni~~  212 (289)
                      |....    -|+++.+-.
T Consensus       231 L~S~~a~~iTG~~i~VDG  248 (252)
T PRK07035        231 LVSDASSYTTGECLNVDG  248 (252)
T ss_pred             HHCCHHCCCCCCEEEECC
T ss_conf             968542293686488694


No 109
>PRK05884 short chain dehydrogenase; Provisional
Probab=98.67  E-value=3.7e-07  Score=60.39  Aligned_cols=183  Identities=12%  Similarity=0.067  Sum_probs=93.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HCCCEEEECCCCCCC---HHHHHHHCCCCEEEEEECC-
Q ss_conf             93999888-88899999999988988999967944634556-449828980678640---2346541156327876124-
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK-HKGISPFLFADQKIN---NLLREKLYFTTHIVQCIKP-   74 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~-~~~~~~~~~~~~~~~---~~~~~~~~~~~~v~~~~~~-   74 (289)
                      |||||||+ +=||..+++.|.+.|++|....|+.++..... ..+...+.+|..+..   ..........|.+++.... 
T Consensus         1 ~~VlVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~~~~~~~d~~d~~~~~~~~~~~~~~~d~lvn~~~~~   80 (223)
T PRK05884          1 MEVLVTGGDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELDVDAIVCDNTDPASLEEARGLFPHHLDTIVNVPAPS   80 (223)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCEEEEEEEE
T ss_conf             93999878879999999999987999999959878999998534876899852788999999999998619478841230


Q ss_pred             -----CCCC--CEEECCC----CCHHH----------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             -----4433--1000122----10134----------4320123343333201025762123453211234311345544
Q gi|254780595|r   75 -----SSEG--DPCIISM----SKDFY----------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        75 -----~~~~--~~~~~~~----~~~~~----------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                           ....  +......    ..++.          ..+..-.++|.+||.+.              . ..+.|+.+|.
T Consensus        81 ~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m~~~G~Iini~s~~~--------------~-~~~~~~asKa  145 (223)
T PRK05884         81 WDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHLRSGGSIINVVPENP--------------P-AGSADAAIKA  145 (223)
T ss_pred             CCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC--------------C-CCCHHHHHHH
T ss_conf             247875556212159999999999979999999999986158987999945767--------------8-8758999999


Q ss_pred             HHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----CCC
Q ss_conf             5555432001234---567642034777789850344431134543222110001024777799999995135----578
Q gi|254780595|r  134 NAEKEWLAITKKL---NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----LGG  206 (289)
Q Consensus       134 ~~E~~~~~~~~~~---~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----~~~  206 (289)
                      ....+.+..+.+.   |+.+-.+-|+.+..|+   +..+....+     +       -.+|+++++.+|....    .|+
T Consensus       146 al~~~t~~lA~e~~~~gIrVN~IaPG~~~~~~---~~~~~~~~~-----~-------~~~evA~~~~FLaS~~as~iTGq  210 (223)
T PRK05884        146 ALSNWTAGQAEVFGTRGITINAVACGRSVQPG---YDGLSRTPP-----P-------VAAEIARLALFLTTPAARHITGQ  210 (223)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCCCCH---HHHHHCCCC-----C-------CHHHHHHHHHHHCCCHHCCEECC
T ss_conf             99999999999967659799798079988831---568716899-----9-------78999999999809431874274


Q ss_pred             CEECCCC
Q ss_conf             6162684
Q gi|254780595|r  207 IFNLSDD  213 (289)
Q Consensus       207 iyni~~~  213 (289)
                      ++++-.+
T Consensus       211 ~i~VDGG  217 (223)
T PRK05884        211 TLHVSHG  217 (223)
T ss_pred             EEEECCC
T ss_conf             7895868


No 110
>PRK07856 short chain dehydrogenase; Provisional
Probab=98.67  E-value=4.9e-08  Score=65.38  Aligned_cols=190  Identities=11%  Similarity=0.038  Sum_probs=105.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHH-------HHHCCCCEEEEEEC
Q ss_conf             3999888-888999999999889889999679446345564498289806786402346-------54115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR-------EKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~v~~~~~   73 (289)
                      .+||||+ +=||..+++.|+++|.+|....|+......   .....+..|..+. +.+.       +....+|.++++++
T Consensus        10 ~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~---~~~~~~~~Dv~~~-~~v~~~~~~~~~~~g~iDilVnNAG   85 (254)
T PRK07856         10 VVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAPEVDG---RPAEFHACDIRDP-DQVAALVDAIAERHGRLDVLVNNAG   85 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCC---CCEEEEECCCCCH-HHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89994767689999999999879999999798557489---8439998469999-9999999999998099888998898


Q ss_pred             CCCCC---CEEECCC----CCHH----------HHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             44433---1000122----1013----------4432-0--123343333201025762123453211234311345544
Q gi|254780595|r   74 PSSEG---DPCIISM----SKDF----------YKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        74 ~~~~~---~~~~~~~----~~~~----------~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      .....   +......    ..++          ...+ +  ...++|.+||.+..  .         +......|+.+|.
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~q~~~~~m~~~~~~G~IVnisS~~~~--~---------~~~~~~~Y~asKa  154 (254)
T PRK07856         86 GSPYALAAEASPRFHEKIVELNLLAPLLVAQAANAVMQQQPGGGSIVNIGSVSGR--R---------PSPGTAAYGAAKA  154 (254)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC--C---------CCCCCHHHHHHHH
T ss_conf             8999881349999999999998289999999999999972799789994542432--7---------8897287999999


Q ss_pred             HHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-
Q ss_conf             55554320012345--67642034777789850-------344431134543222110001024777799999995135-
Q gi|254780595|r  134 NAEKEWLAITKKLN--IKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-  203 (289)
Q Consensus       134 ~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-  203 (289)
                      ..+.+.+..+.+.+  +.+-.+.|+.|.-+...       ...++.+..+.    +    -....+|+|+++.+|.... 
T Consensus       155 al~~ltk~lA~e~a~~IrVN~VaPG~i~T~~~~~~~~~~e~~~~~~~~iPl----g----R~g~pedvA~~v~fL~S~~s  226 (254)
T PRK07856        155 GLLNLTTSLAVEWAPKVRVNAVVVGLVETEQSELHYGDAEGIAAVAATVPL----G----RLATPADIGWACLFLASDAA  226 (254)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHCCHH
T ss_conf             999999999999779988999975989771143315999999999837999----9----97699999999999958721


Q ss_pred             ---CCCCEECCCCC
Q ss_conf             ---57861626843
Q gi|254780595|r  204 ---LGGIFNLSDDE  214 (289)
Q Consensus       204 ---~~~iyni~~~~  214 (289)
                         -|++..+-.|.
T Consensus       227 ~~iTG~~i~VDGG~  240 (254)
T PRK07856        227 SYVSGANLEVHGGG  240 (254)
T ss_pred             CCEECCEEEECCCC
T ss_conf             68108557889999


No 111
>PRK12939 short chain dehydrogenase; Provisional
Probab=98.64  E-value=5.4e-07  Score=59.43  Aligned_cols=193  Identities=12%  Similarity=0.030  Sum_probs=109.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|++|....|+.++...    ++..+.  ..+..|..+.+..      ..+....+|.+
T Consensus         9 valVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDiL   88 (250)
T PRK12939          9 RALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAHAIAADLADPASVQRFFDAAAAALGGLDGL   88 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79995836689999999999879999999698899999999999559909999924899999999999999974999799


Q ss_pred             EEEECCCCCCC---EEECCCC----CH----------HHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---0001221----01----------344320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCIISMS----KD----------FYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~~~----~~----------~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......   -....+.    -+          ....+.  +-.++|.+||....-           +......|+
T Consensus        89 VNNAG~~~~~~~~~~~~e~~~~~~~iNl~~~~~~~k~~~~~m~~~~~G~IInisS~~~~~-----------~~~~~~~Y~  157 (250)
T PRK12939         89 VNNAGITNSKSATELDIDTWDAVMNVNVRGTFLMSRAALPHLRDSGRGRIVNLASDTALW-----------GAPKLLAYV  157 (250)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHHH
T ss_conf             988778999990349999999999998299999999999999984993799980677676-----------899858899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC------CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             5544555543200123---45676420347777898------50344431134543222110001024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK------RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~------r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      .+|...+.+.+..+.+   +++++-.+.|+.+--+.      ......+....+.        --+...+|++.++.+|.
T Consensus       158 asKaal~~ltk~lA~e~a~~~IrvN~V~PG~i~T~~~~~~~~~e~~~~~~~~~Pl--------~R~g~pedia~~v~fL~  229 (250)
T PRK12939        158 ASKGAVIGMTRSLARELGGRGITVNAIAPGLTATEATAYVPAEERHAYYLQGRAL--------ERLQVPDDVAGAVLFLL  229 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHHHH
T ss_conf             9999999999999999603293999887677987032258988999999857999--------99809999999999994


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++++-.|
T Consensus       230 S~~s~~itG~~i~VDGG  246 (250)
T PRK12939        230 SDAARFVTGQLLPVNGG  246 (250)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             81646905882897958


No 112
>PRK07041 short chain dehydrogenase; Provisional
Probab=98.63  E-value=3e-07  Score=60.84  Aligned_cols=193  Identities=13%  Similarity=0.096  Sum_probs=103.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-----CCEEEECCCCCCC--HHHHHHHCCCCEEEEEEC
Q ss_conf             3999888-8889999999998898899996794463455644-----9828980678640--234654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-----GISPFLFADQKIN--NLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-----~~~~~~~~~~~~~--~~~~~~~~~~~~v~~~~~   73 (289)
                      +++|||+ +=||..+++.|.++|++|....|+.++.......     ....+..|..+..  ..+.......|+++++++
T Consensus         9 ~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~~d~lv~nag   88 (240)
T PRK07041          9 KVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARALGGPRPVRTAALDITDEAAVDAFFAEAGPFDHVVITAA   88 (240)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89995778889999999999879999999598899999999847888669998479999999999997098788998234


Q ss_pred             CCCCCC-------EEECCCCCHHH--------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             444331-------00012210134--------432012334333320102576212345321123431134554455554
Q gi|254780595|r   74 PSSEGD-------PCIISMSKDFY--------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKE  138 (289)
Q Consensus        74 ~~~~~~-------~~~~~~~~~~~--------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~  138 (289)
                      ......       .....+..++.        .....-.++|++||...+-           |......|+.+|...+.+
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~G~Ii~iss~~~~~-----------~~~~~~~Y~asKaal~~l  157 (240)
T PRK07041         89 DTAGGPVRALPLAAAQAAMDSKFWGAYRVARAARIAPGGSLTFVSGFLAVR-----------PSASGVLQGAINAALEAL  157 (240)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHCC-----------CCCCCHHHHHHHHHHHHH
T ss_conf             479998102999999999998889999999999971696799964433147-----------788617888876799999


Q ss_pred             HHHCCCCCC-CCCCCCCCCCCCCCCCC---------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCC
Q ss_conf             320012345-67642034777789850---------344431134543222110001024777799999995135--578
Q gi|254780595|r  139 WLAITKKLN-IKLAVLRLSGIYGPKRN---------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGG  206 (289)
Q Consensus       139 ~~~~~~~~~-~~~~ilR~~~iyGp~r~---------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~  206 (289)
                      .+.++.+.+ +.+-.+-|+.|--|-..         .+..+.+..+.    +    -+--.+|+++++.+|....  -|+
T Consensus       158 tr~lA~ela~IrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~~iPl----~----R~g~pedia~~v~fL~s~~~itG~  229 (240)
T PRK07041        158 ARGLALELAPVRVNAVSPGLVDTPLWSKLAGDARAAMFAAAAERLPA----R----RVGQPEDVANAIVFLAANGFATGS  229 (240)
T ss_pred             HHHHHHHHCCCEEEEEEECCCCCHHHHHCCCHHHHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999982892899984187677366531711389999999845999----9----984999999999999847887898


Q ss_pred             CEECCCC
Q ss_conf             6162684
Q gi|254780595|r  207 IFNLSDD  213 (289)
Q Consensus       207 iyni~~~  213 (289)
                      ++.+-.|
T Consensus       230 ~i~VDGG  236 (240)
T PRK07041        230 TVLVDGG  236 (240)
T ss_pred             EEEECCC
T ss_conf             2785877


No 113
>PRK07677 short chain dehydrogenase; Provisional
Probab=98.63  E-value=1.1e-06  Score=57.74  Aligned_cols=196  Identities=13%  Similarity=0.071  Sum_probs=106.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCC--CEEEECCCCCCCH---HHH---HHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----6449--8289806786402---346---541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKG--ISPFLFADQKINN---LLR---EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~--~~~~~~~~~~~~~---~~~---~~~~~~~~v   68 (289)
                      .+||||+ +=||..++++|.+.|.+|....|+.++....    ...+  +..+..|..+.+.   .+.   +....+|.+
T Consensus         5 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iDiL   84 (254)
T PRK07677          5 VVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFGRIDAL   84 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995876789999999999879999999699999999999998569909999803899999999999999983998889


Q ss_pred             EEEECCCCCC---CEEECCC----CCH----------HHHH-HH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8761244433---1000122----101----------3443-20--1233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISM----SKD----------FYKF-MP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~----~~~----------~~~~-~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++.....   +......    ..+          .... .+  .-.++|.+||...+.           +..+...|
T Consensus        85 VnNAg~~~~~~~~~~t~~~~~~~~~vnl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~-----------~~~~~~~y  153 (254)
T PRK07677         85 INNAAGNFICPAEDLSVNGWKSVIDIVLNGTFYCSQAVGKYWIEKGIKGNIINMVATYAWD-----------AGAGVIHS  153 (254)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-----------CCCCCHHH
T ss_conf             9757557788826599999999999972318899999999999828995399995110056-----------88982889


Q ss_pred             HHHHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCC-C-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             45544555543200----123456764203477778985-0-------34443113454322211000102477779999
Q gi|254780595|r  129 ATQRFNAEKEWLAI----TKKLNIKLAVLRLSGIYGPKR-N-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       129 ~~~k~~~E~~~~~~----~~~~~~~~~ilR~~~iyGp~r-~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      +.+|...+.+.+.+    +.++|+.+-.+-|+.|.-++. .       ...++.+..+..        -+--.+|+|+++
T Consensus       154 ~asKaal~~ltk~lA~ela~~~gIrvN~I~PG~i~~~~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pediA~~v  225 (254)
T PRK07677        154 AAAKAGVLAMTRTLAVEWGRKYGIRVNAIAPGPIERTGGADKLWISEEAAKRTIQSVPLG--------RLGTPEEIAGLA  225 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHH
T ss_conf             999999999999999985723398999994276777640323249999999998579999--------984999999999


Q ss_pred             HHHHCCC----CCCCEECCCCCHH
Q ss_conf             9995135----5786162684333
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSDDEPA  216 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~~~~~  216 (289)
                      .+|....    -|+...+-.|..+
T Consensus       226 ~fL~S~~asyiTG~~i~VDGG~~l  249 (254)
T PRK07677        226 YYLLSDEAAYINGTCITMDGGQWL  249 (254)
T ss_pred             HHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             999587324824872886899010


No 114
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=98.63  E-value=1e-06  Score=57.83  Aligned_cols=189  Identities=18%  Similarity=0.105  Sum_probs=104.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC----CEEEECCCCCCCH------HHHHHHCCCCEEEE
Q ss_conf             3999888-88899999999988988999967944634556449----8289806786402------34654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG----ISPFLFADQKINN------LLREKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~----~~~~~~~~~~~~~------~~~~~~~~~~~v~~   70 (289)
                      -++|||| .=||...++.|.++|++|+...|+.+++..+...-    +.+...|..+...      .+.+....+|.+++
T Consensus         8 v~lITGASSGiG~A~A~~l~~~G~~vvl~aRR~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~~~~~~~g~iDiLvN   87 (246)
T COG4221           8 VALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGAGAALALALDVTDRAAVEAAIEALPEEFGRIDILVN   87 (246)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89994686568899999999789969998636889999998625674378961367889999999999975176058996


Q ss_pred             EECCCCCCCEEE-------CCC-CCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             612444331000-------122-1013-------44320-----123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGDPCI-------ISM-SKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~~~~-------~~~-~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      .++-... ++..       ..+ ..|+       .+.++     +..++|.+||.+  |.         .|.-..+.|+.
T Consensus        88 NAGl~~g-~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiA--G~---------~~y~~~~vY~A  155 (246)
T COG4221          88 NAGLALG-DPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIA--GR---------YPYPGGAVYGA  155 (246)
T ss_pred             CCCCCCC-CHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC--CC---------CCCCCCCCCHH
T ss_conf             6877768-703548999999999988899999998866688864796399953513--33---------66799860023


Q ss_pred             HHHHHHHHHHH---CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCC-CCCCCCCCEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             54455554320---012345676420347777898503444311345-4322211000102477779999999513557
Q gi|254780595|r  131 QRFNAEKEWLA---ITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS-LRLVKKNQVFNRIRVEDVARCVIFLMTHHLG  205 (289)
Q Consensus       131 ~k~~~E~~~~~---~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~-~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~  205 (289)
                      +|+..-.....   -....+++++.+-|+.+-.   ..|...+.... ....+--+....+.-+|+|+++.++++++..
T Consensus       156 TK~aV~~fs~~LR~e~~g~~IRVt~I~PG~v~~---~~~s~v~~~g~~~~~~~~y~~~~~l~p~dIA~~V~~~~~~P~~  231 (246)
T COG4221         156 TKAAVRAFSLGLRQELAGTGIRVTVISPGLVET---TEFSTVRFEGDDERADKVYKGGTALTPEDIAEAVLFAATQPQH  231 (246)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCEECC---EECCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             699999999999987337984699863760210---0034346874066677776058779989999999999859985


No 115
>PRK05717 oxidoreductase; Validated
Probab=98.62  E-value=1.5e-06  Score=56.89  Aligned_cols=198  Identities=15%  Similarity=0.040  Sum_probs=105.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-C--CCEEEECCCCCCCHH---H---HHHHCCCCEEEEE
Q ss_conf             3999888-888999999999889889999679446345564-4--982898067864023---4---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-K--GISPFLFADQKINNL---L---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-~--~~~~~~~~~~~~~~~---~---~~~~~~~~~v~~~   71 (289)
                      .+||||+ |=||..++++|+++|.+|+...|+.++...+.. .  ....+..|..+.+..   +   ......+|.++++
T Consensus        12 valITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~i~~~~~~~G~id~lvnN   91 (255)
T PRK05717         12 VALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKALGENAWFIAMDVADEAQVAAGVAEVLGQFGRLDALVCN   91 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89995878889999999999879989999698899999999848975899930799999999999999982999899987


Q ss_pred             ECCCCCCCEEECCCC---------CHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             124443310001221---------013----------44-3201233433332010257621234532112343113455
Q gi|254780595|r   72 IKPSSEGDPCIISMS---------KDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQ  131 (289)
Q Consensus        72 ~~~~~~~~~~~~~~~---------~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~  131 (289)
                      ++........+....         .++          .. ...+-..+|.+||....-   +      .  .....|+.+
T Consensus        92 Ag~~~~~~~~l~~~~~~~w~~~~~vNl~g~f~~~k~~~~~m~~~~G~IInisS~~~~~---~------~--~~~~~Y~as  160 (255)
T PRK05717         92 AAIANPHNTTLESLSLAQWNRVLAVNLGGPMLLAKHCAPYLRAHNGAIVNLASTRARQ---S------E--PDTEAYAAS  160 (255)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHCCCCEEEEEECCCCC---C------C--CCCHHHHHH
T ss_conf             7305789998355999999999998604265776643198874799869997601454---7------8--983767999


Q ss_pred             HHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEEC-CHHHHHHHHHHHHHHCCC----C
Q ss_conf             4455554320012345--67642034777789850344431134543222110001-024777799999995135----5
Q gi|254780595|r  132 RFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFN-RIRVEDVARCVIFLMTHH----L  204 (289)
Q Consensus       132 k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~-~ihv~Dva~~i~~l~~~~----~  204 (289)
                      |...+.+.+..+.+.+  +++-.+-|+.|-.+.  ...+...... .......... +-..+|+++++.+|+...    -
T Consensus       161 Kaal~~ltkslA~e~a~~IRvN~I~PG~i~t~~--~~~~~~~~~~-~~~~~~~Pl~R~g~~edia~~v~fL~S~~ss~iT  237 (255)
T PRK05717        161 KGGLLALTHALAISLGPEIRVNAVSPGWIDARD--PSQRRAEPLS-EADHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVT  237 (255)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC--HHHHCCHHHH-HHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             999999999999997799989999627188887--4552464689-9998479978981999999999999677214815


Q ss_pred             CCCEECCCC
Q ss_conf             786162684
Q gi|254780595|r  205 GGIFNLSDD  213 (289)
Q Consensus       205 ~~iyni~~~  213 (289)
                      |+++.+-.|
T Consensus       238 Gq~i~VDGG  246 (255)
T PRK05717        238 GQEFVVDGG  246 (255)
T ss_pred             CCEEEECCC
T ss_conf             983897989


No 116
>PRK07774 short chain dehydrogenase; Provisional
Probab=98.62  E-value=1.8e-06  Score=56.46  Aligned_cols=190  Identities=15%  Similarity=0.077  Sum_probs=109.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCCEEE--ECCCCCCCHHH-------HHHHCCCCE
Q ss_conf             3999888-88899999999988988999967944634----5564498289--80678640234-------654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGISPF--LFADQKINNLL-------REKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~~~~--~~~~~~~~~~~-------~~~~~~~~~   67 (289)
                      .+||||+ +-||..+++.|.++|.+|....|+.++..    .+...+...+  ..|.. +...+       .+....+|.
T Consensus         8 ~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~-~~~~v~~~~~~~~~~fG~iDi   86 (250)
T PRK07774          8 VAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAIAVQVDVS-DPDSAKAMADRTVSAFGGIDY   86 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCC-CHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999797688999999999986999999979889999999999855984999982589-999999999999998399989


Q ss_pred             EEEEECCCCC--CCE----EECCCCC----HHH----------HHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7876124443--310----0012210----134----------432--01233433332010257621234532112343
Q gi|254780595|r   68 IVQCIKPSSE--GDP----CIISMSK----DFY----------KFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        68 v~~~~~~~~~--~~~----~~~~~~~----~~~----------~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      ++++++....  .++    ......+    ++.          ..+  .+-.++|.+||.+.+.              |.
T Consensus        87 lVNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IIn~sS~~~~~--------------~~  152 (250)
T PRK07774         87 LVNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKHMAKRGGGAIVNQSSTAAWL--------------YS  152 (250)
T ss_pred             EEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC--------------CC
T ss_conf             9988843578999742129999999999998899999999999999982995899977500457--------------85


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-C-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             11345544555543200123---456764203477778985-0-----34443113454322211000102477779999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-N-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      ..|+.+|...+.+.+..+.+   +|+.+-.+.|+.|--|.. .     ...++....+..        -+-.-+|+++++
T Consensus       153 ~~Y~asKaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pedia~~v  224 (250)
T PRK07774        153 NFYGLAKVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATRTVTPKEFVADMVKGIPLS--------RMGTPEDLVGMC  224 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHH
T ss_conf             389999999999999999997064948999973878772200149799999998579988--------985999999999


Q ss_pred             HHHHCCC----CCCCEECCCCC
Q ss_conf             9995135----57861626843
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~~~  214 (289)
                      .+|....    .|+++++-.|.
T Consensus       225 ~fL~S~~s~~iTGq~i~VDGG~  246 (250)
T PRK07774        225 LFLLSDAASWITGQIFNVDGGQ  246 (250)
T ss_pred             HHHHCCHHCCCCCCEEEECCCC
T ss_conf             9994824268649839978881


No 117
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.62  E-value=6.1e-07  Score=59.13  Aligned_cols=190  Identities=13%  Similarity=0.049  Sum_probs=105.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC-HHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             3999888-88899999999988988999967944634556449828980678640-234654115632787612444331
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN-NLLREKLYFTTHIVQCIKPSSEGD   79 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~~~~~~   79 (289)
                      .+||||+ +=||..+++.|.++|++|+++.|+....   ....+..+..|..+.. ....+....+|.++++++-.....
T Consensus         7 ~alVTGas~GIG~aia~~~a~~Ga~V~~~d~~~~~~---~~~~~~~~~~Dv~~~~v~~~~~~~g~iDiLvNnAGi~~~~~   83 (237)
T PRK06550          7 TVLVTGAASGIGLAQARAFLEQGAHVYGVDKSDKPD---LSGNFHFIQLDLSSDKLEPLFKVVPSVDILCNTAGILDDYK   83 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHH---CCCCEEEEECCCCHHHHHHHHHHCCCCCEEEECCCCCCCCC
T ss_conf             999937477999999999998799999970861243---06973899863888999999997599979998988899999


Q ss_pred             EEE----CC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             000----12----21013----------4432--0123343333201025762123453211234311345544555543
Q gi|254780595|r   80 PCI----IS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEW  139 (289)
Q Consensus        80 ~~~----~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~  139 (289)
                      +..    ..    +..++          ...+  .+-.++|.+||..-+  ..         ......|+.+|.....+.
T Consensus        84 ~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~--~~---------~~~~~~Y~asKaal~~lT  152 (237)
T PRK06550         84 PLLDTSDEEWQHIFDINLFSTFLLTRAYLPQMLEKKSGVIINMCSIAGF--VA---------GGGGVAYTASKHALAGFT  152 (237)
T ss_pred             CHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHC--CC---------CCCCHHHHHHHHHHHHHH
T ss_conf             9055999999999999729999999999999998099189995463435--57---------998688999999999999


Q ss_pred             HHCCC---CCCCCCCCCCCCCCCCCC-CCH-------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----C
Q ss_conf             20012---345676420347777898-503-------44431134543222110001024777799999995135----5
Q gi|254780595|r  140 LAITK---KLNIKLAVLRLSGIYGPK-RNP-------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----L  204 (289)
Q Consensus       140 ~~~~~---~~~~~~~ilR~~~iyGp~-r~~-------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----~  204 (289)
                      +..+.   .+|+.+-.+-|+.|--|- +..       ...+....+        .--+..-+|+|+++.+|....    -
T Consensus       153 rslA~ela~~gIrVNaVaPG~i~T~m~~~~~~~~~~~~~~~~~~~P--------l~R~g~p~eiA~~v~FLaSd~as~iT  224 (237)
T PRK06550        153 KQLALDYAKDGIQVFGIAPGAIKTPMNAADFAEPGGMADWVARETP--------IKRWAEPEEVAELTLFLASGKADYMQ  224 (237)
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             9999996501959999976889873201003596999999985699--------99978899999999999585533814


Q ss_pred             CCCEECCCC
Q ss_conf             786162684
Q gi|254780595|r  205 GGIFNLSDD  213 (289)
Q Consensus       205 ~~iyni~~~  213 (289)
                      |+++.+-.+
T Consensus       225 G~~i~VDGG  233 (237)
T PRK06550        225 GTIVPIDGG  233 (237)
T ss_pred             CCEEEECCC
T ss_conf             862896827


No 118
>KOG4288 consensus
Probab=98.62  E-value=4.1e-08  Score=65.84  Aligned_cols=104  Identities=21%  Similarity=0.241  Sum_probs=62.1

Q ss_pred             HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC-------
Q ss_conf             3201233433332010257621234532112343113455445555432001234567642034777789850-------
Q gi|254780595|r   92 FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN-------  164 (289)
Q Consensus        92 ~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r~-------  164 (289)
                      ...++++|+|+|... ||-         -|+.|. -|-..|.++|..+++.   +++...||||+-+||. |.       
T Consensus       150 ~~~gv~~fvyISa~d-~~~---------~~~i~r-GY~~gKR~AE~Ell~~---~~~rgiilRPGFiyg~-R~v~g~~~p  214 (283)
T KOG4288         150 AKAGVPRFVYISAHD-FGL---------PPLIPR-GYIEGKREAEAELLKK---FRFRGIILRPGFIYGT-RNVGGIKSP  214 (283)
T ss_pred             HHCCCCEEEEEEHHH-CCC---------CCCCCH-HHHCCCHHHHHHHHHH---CCCCCEEECCCEEECC-CCCCCCCCC
T ss_conf             974996399987543-279---------886622-1304316889999974---2788626435302145-546760240


Q ss_pred             ------HHHHHHCCCC----CCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEEC
Q ss_conf             ------3444311345----43222110001024777799999995135-5786162
Q gi|254780595|r  165 ------PFIKIRQKNS----LRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNL  210 (289)
Q Consensus       165 ------~~~~~~~g~~----~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni  210 (289)
                            ++.+..+...    ....-+.-....+.+++||-+.+..++.+ ..|++-+
T Consensus       215 L~~vg~pl~~~~~~a~k~~~kLp~lg~l~~ppvnve~VA~aal~ai~dp~f~Gvv~i  271 (283)
T KOG4288         215 LHTVGEPLEMVLKFALKPLNKLPLLGPLLAPPVNVESVALAALKAIEDPDFKGVVTI  271 (283)
T ss_pred             HHHHHHHHHHHHHHHHCHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEH
T ss_conf             876342699998740231220755564247986789999999974248775760559


No 119
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.62  E-value=8.4e-07  Score=58.32  Aligned_cols=193  Identities=15%  Similarity=0.053  Sum_probs=105.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHHH----HHHCCCEE--EECCCCCCCHH------HHHHHCCCCE
Q ss_conf             3999888-888999999999889889999-679446345----56449828--98067864023------4654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLLT----LKHKGISP--FLFADQKINNL------LREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~~----l~~~~~~~--~~~~~~~~~~~------~~~~~~~~~~   67 (289)
                      .++|||+ +=||..+++.|.+.|++|... .|+.+....    +...+...  +..|..+.+..      ..+....+|.
T Consensus         6 valVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G~iDi   85 (250)
T PRK08063          6 VALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFGRLDV   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89995876699999999999889989997599989999999999954995899984799999999999999998099889


Q ss_pred             EEEEECCCCCC----------CEEECCCCCH-------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78761244433----------1000122101-------34432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEG----------DPCIISMSKD-------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~----------~~~~~~~~~~-------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++.....          +..+......       ....+  .+..++|++||.+...   +        ......|
T Consensus        86 LVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~---~--------~~~~~~Y  154 (250)
T PRK08063         86 FVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKLMEKNGGGKIISLSSLGSIR---Y--------LENYTTV  154 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHCC---C--------CCCCCHH
T ss_conf             9987856788992669999999999874037999999999999863898615887331056---7--------8996045


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC------C-HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             45544555543200123---456764203477778985------0-3444311345432221100010247777999999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR------N-PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r------~-~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +.+|...+.+.+.++.+   +|+.+-.+.|+.+-.|.-      . .+.......+.        --+...+|+++++.+
T Consensus       155 ~asKaal~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~--------~R~g~pedia~~v~f  226 (250)
T PRK08063        155 GVSKAALEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPA--------GRMVEPEDLVNAVLF  226 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHH
T ss_conf             878999999999999997253928999860879876776179849999999867999--------998699999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |....    -|+++.+-.|
T Consensus       227 L~S~~s~~iTG~~i~VDGG  245 (250)
T PRK08063        227 LCSPKADMIRGQTIIVDGG  245 (250)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9374534822870885948


No 120
>PRK07776 consensus
Probab=98.62  E-value=1.7e-06  Score=56.58  Aligned_cols=193  Identities=13%  Similarity=0.067  Sum_probs=105.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC----CCEEEECCCCCCC---HH---HHHHHCCCCEEEE
Q ss_conf             3999888-8889999999998898899996794463455644----9828980678640---23---4654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK----GISPFLFADQKIN---NL---LREKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~----~~~~~~~~~~~~~---~~---~~~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|++.|.+|....|+++........    ....+..|..+.+   ..   .......+|.+++
T Consensus        10 v~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDilVn   89 (252)
T PRK07776         10 TAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAAQLGAERALGVAGHAVDEEHAREAVDLTLERFGSVDILVN   89 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89994778799999999999879989999798899999999847995799997428999999999999998499869998


Q ss_pred             EECCCCCCCEE----ECCC----CCHH----------HH--HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             61244433100----0122----1013----------44--320123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGDPC----IISM----SKDF----------YK--FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~~~----~~~~----~~~~----------~~--~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      .++.....++.    ....    ..++          ..  ...+-.++|.+||...+-..           .-...|+.
T Consensus        90 NAg~~~~~~~~~e~~~e~w~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~~-----------~~~~~Y~a  158 (252)
T PRK07776         90 NAGTNPAYGPLIDQDLARFRKIFEVNVWAALGWTQLAWKAWMGEHGGAVVNVASIGGLHPS-----------PGIGAYGA  158 (252)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC-----------CCCHHHHH
T ss_conf             7866888998134999999999999807899999999999866279649980774411579-----------98479999


Q ss_pred             HHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCH-H----HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             54455554320012345--676420347777898503-4----4431134543222110001024777799999995135
Q gi|254780595|r  131 QRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNP-F----IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~-~----~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      +|.....+.+..+.+.+  +++-.+-|+.+..+.-.. +    .++....+.        --+-.-+|+|.++.+|....
T Consensus       159 sKaav~~ltk~lA~e~a~~IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~iPl--------~R~g~p~dia~~v~fL~S~~  230 (252)
T PRK07776        159 SKAALIHLTKQLALELAPRVRVNAVAPGVVRTKFAEALWEGREDEVAASYPL--------GRLGEPEDIASAVAFLVSDA  230 (252)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCC--------CCCCCHHHHHHHHHHHHCCH
T ss_conf             9999999999999998699889999645798854112205589999857999--------99809999999999995874


Q ss_pred             ----CCCCEECCCC
Q ss_conf             ----5786162684
Q gi|254780595|r  204 ----LGGIFNLSDD  213 (289)
Q Consensus       204 ----~~~iyni~~~  213 (289)
                          -|+++.+-.+
T Consensus       231 ss~iTGq~i~VDGG  244 (252)
T PRK07776        231 ASWITGETLVVDGG  244 (252)
T ss_pred             HCCCCCCEEEECCC
T ss_conf             24805872998957


No 121
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=98.61  E-value=1.1e-06  Score=57.70  Aligned_cols=201  Identities=14%  Similarity=0.126  Sum_probs=105.9

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HC----CCEEEECCCCCCCH---HH---HHHHCCCCE
Q ss_conf             999888-88899999999988988999967944634556----44----98289806786402---34---654115632
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HK----GISPFLFADQKINN---LL---REKLYFTTH   67 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~----~~~~~~~~~~~~~~---~~---~~~~~~~~~   67 (289)
                      +||||+ +=||..+++.|.++|++|....|+.++.....    ..    .+..+..|..+.+.   .+   .+....+|.
T Consensus         5 alITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDi   84 (259)
T PRK12384          5 AVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEYGEGMAYGFGADATSEQSVLALSRGVDEIFGRVDL   84 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99946886899999999998799999997988999999999986248860899983279999999999999998299719


Q ss_pred             EEEEECCCCCC---C----EEECCCCCH----------HHHHH--HC-CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433---1----000122101----------34432--01-23343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEG---D----PCIISMSKD----------FYKFM--PH-VKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~---~----~~~~~~~~~----------~~~~~--~~-~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++.....   +    ........+          .....  .+ ..++|++||.+..-   +        ......
T Consensus        85 lVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~Iv~isS~~~~~---~--------~~~~~~  153 (259)
T PRK12384         85 LVYSAGIAKAAKITDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKV---G--------SKHNSG  153 (259)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---C--------CCCCCH
T ss_conf             99899777889914599999999999886442234677636899738984599983525455---8--------854306


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCC-CCC-CHHHHHHCCCCCCC-------CCCCCEECCHHHHHHHHH
Q ss_conf             34554455554320012---3456764203477778-985-03444311345432-------221100010247777999
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYG-PKR-NPFIKIRQKNSLRL-------VKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyG-p~r-~~~~~~~~g~~~~~-------~~~~~~~~~ihv~Dva~~  195 (289)
                      |+.+|...+.+.+..+.   .+|+.+-.+.|+.+.- |-. ..+...........       .+.-..--+...+|+|++
T Consensus       154 Y~asK~al~~ltk~lA~e~a~~gIrVN~I~PG~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~diA~~  233 (259)
T PRK12384        154 YSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYAKKLGIKPDEVEQYYIDKVPLKRGCDYQDVLNM  233 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             79999999999999999962319799998388715676666655878877299989999999847998999699999999


Q ss_pred             HHHHHCCC----CCCCEECCCCC
Q ss_conf             99995135----57861626843
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~~  214 (289)
                      +.+|....    .|++..+-.|.
T Consensus       234 v~fL~S~~a~~iTG~~i~vDGG~  256 (259)
T PRK12384        234 LLFYASPKASYCTGQSINVTGGQ  256 (259)
T ss_pred             HHHHHCCHHCCCCCCEEEECCCH
T ss_conf             99995856338038728989783


No 122
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=98.60  E-value=6.4e-07  Score=58.99  Aligned_cols=201  Identities=13%  Similarity=0.038  Sum_probs=107.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCC--CEEEECCCCCCC---HHH---HHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----56449--828980678640---234---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKG--ISPFLFADQKIN---NLL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~--~~~~~~~~~~~~---~~~---~~~~~~~~~v   68 (289)
                      .++|||+ +=||..++++|.++|++|....|+.++...    +...+  +..+..|..+..   ..+   ......+|.+
T Consensus         6 ~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g~iDiL   85 (258)
T PRK12429          6 TALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFGGVDIL   85 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994887589999999999879999999798899999999998449918999835899999999999999982997099


Q ss_pred             EEEECCCCCC---CEEECC--------------CCCHHHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---100012--------------2101344320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIIS--------------MSKDFYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~--------------~~~~~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +.....              +.+.....+.  +-.++|++||.+-+  ..         ......|+
T Consensus        86 VnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~--~~---------~~~~~~Y~  154 (258)
T PRK12429         86 VNNAGIQHVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPHMKAQKWGRIINMASVHGL--VG---------SAGKAAYV  154 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHHHHHCCCCEEEEECCHHHC--CC---------CCCCHHHH
T ss_conf             98998889988155999999999997623212200677776643599289998775546--68---------99975899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHHHHHHCCCCCC--------CCCCCCEECCHHHHHHHHHHH
Q ss_conf             5544555543200123---45676420347777898-50344431134543--------222110001024777799999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPFIKIRQKNSLR--------LVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~~~~~~g~~~~--------~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      .+|.+.+.+.+.++.+   +|+.+..+-|+.|-.|- +..+..........        +.+.-...-+.--+|+++++.
T Consensus       155 asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~g~p~dia~~v~  234 (258)
T PRK12429        155 SAKHGLIGLTKVVALEGATHGVTVNAICPGYVDTPLVRKQIPDLAKERGISEEEVLEDVLLPLVPQKRFTTVEEIADLAL  234 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999999985320979999974879871022133678977399979999999972799899849999999999


Q ss_pred             HHHCCC----CCCCEECCCC
Q ss_conf             995135----5786162684
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~  213 (289)
                      +|....    -|++.++-.+
T Consensus       235 fL~S~~s~~itGq~i~VDGG  254 (258)
T PRK12429        235 FLASFAAKGVTGQAWVVDGG  254 (258)
T ss_pred             HHHCCHHCCCCCCEEEECCC
T ss_conf             99480754901763896946


No 123
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=98.60  E-value=8.5e-07  Score=58.30  Aligned_cols=193  Identities=13%  Similarity=0.068  Sum_probs=107.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.+.|.+|....|+.++...    +...+.  ..+..|..+.+..      +......+|.+
T Consensus        16 ~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDiL   95 (259)
T PRK06124         16 VALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAAEALVFDISDEEAVAAAFARIDAEHGRLDIL   95 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89992867489999999999879999999698899999999999659958999951799999999999999975999799


Q ss_pred             EEEECCCCCC---CEEECC----CCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---100012----21013----------44320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIIS----MSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~----~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++.....   +.....    +..++          ...+.  +-.++|++||.+-.  . +        ......|+
T Consensus        96 VnnAG~~~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~M~~~~~G~IInisS~~~~--~-~--------~~~~~~Y~  164 (259)
T PRK06124         96 VNNVGARNRRPLAELDDAEIRALLETDLVAPILLSRLAAQRMVRQGYGRIIAITSIAGE--V-A--------RAGDAVYP  164 (259)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC--C-C--------CCCCHHHH
T ss_conf             98988899999066999999999999849999999999999877699369997233004--6-7--------99837899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             5544555543200123---4567642034777789850-------34443113454322211000102477779999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      .+|...+.+.+..+.+   +++.+-.+.|+.|.-+...       ....+.+..+..        -+---+|+++++.+|
T Consensus       165 asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pedia~~v~fL  236 (259)
T PRK06124        165 AAKQGLTGLMRALAAEFGPHGITSNAIAPGYFATETNAAMAADPEVGEWLRARTPLG--------RWGRPEEIAGAAVFL  236 (259)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHHHHH
T ss_conf             999999999999999965139799999758897732211127999999998579989--------985999999999999


Q ss_pred             HCCC----CCCCEECCCC
Q ss_conf             5135----5786162684
Q gi|254780595|r  200 MTHH----LGGIFNLSDD  213 (289)
Q Consensus       200 ~~~~----~~~iyni~~~  213 (289)
                      ....    -|+++.+-.|
T Consensus       237 ~Sd~ssyiTG~~i~VDGG  254 (259)
T PRK06124        237 ASPAASYVNGHVLAVDGG  254 (259)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             584435863853886988


No 124
>PRK06179 short chain dehydrogenase; Provisional
Probab=98.60  E-value=2e-07  Score=61.85  Aligned_cols=144  Identities=14%  Similarity=0.148  Sum_probs=85.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEEEECCC
Q ss_conf             999888-8889999999998898899996794463455644982898067864023------465411563278761244
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL------LREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~~~~   75 (289)
                      ++|||| +=||..+++.|.++|++|++..|+.++...+.  ++..+..|..+.+..      +.+....+|.++++++-.
T Consensus         7 alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~~~--~~~~~~~Dvtd~~~v~~~~~~~~~~~g~iDiLVNNAGi~   84 (270)
T PRK06179          7 ALVTGASSGIGRATAEALARAGYRVFGTSRNPARATPIP--GVELLELDVTDDASVQAAVQEVIARAGRIDVLVNNAGVG   84 (270)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCCC--CCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             999072469999999999987999999968977730548--978999107999999999999999839988899898666


Q ss_pred             CCC---CEEE----CCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             433---1000----12210134-------4320-----123343333201025762123453211234311345544555
Q gi|254780595|r   76 SEG---DPCI----ISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        76 ~~~---~~~~----~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
                      ...   +...    ..+..|+.       +..+     +-.++|.+||..-+  .         +.--...|+.+|.+.+
T Consensus        85 ~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~--~---------~~p~~~~Y~aSK~al~  153 (270)
T PRK06179         85 LLGAAEETSIAQAQALFDTNVFGILRMTNAVLPHMRAQGSGRIINISSVLGF--L---------PAPYMALYAASKHAVE  153 (270)
T ss_pred             CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHH--C---------CCCCCCHHHHHHHHHH
T ss_conf             7887575989999999887448999999874202201799589998685662--7---------7899707999999999


Q ss_pred             HHHHH---CCCCCCCCCCCCCCCCCC
Q ss_conf             54320---012345676420347777
Q gi|254780595|r  137 KEWLA---ITKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       137 ~~~~~---~~~~~~~~~~ilR~~~iy  159 (289)
                      .+...   ....+|+.+..+-|+.|-
T Consensus       154 ~~t~sla~El~~~gIrVn~v~PG~v~  179 (270)
T PRK06179        154 GYSESLDHEVRQFGIRVSLVEPAYTR  179 (270)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCC
T ss_conf             99999999850129689999847891


No 125
>PRK12828 short chain dehydrogenase; Provisional
Probab=98.60  E-value=6.1e-07  Score=59.14  Aligned_cols=191  Identities=12%  Similarity=0.039  Sum_probs=108.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEE
Q ss_conf             3999888-888999999999889889999679446345----5644982898067864023------4654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISPFLFADQKINNL------LREKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.|+.++...    +...+......|..+.+..      .......+|.+++
T Consensus         9 valITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~~~~~v~~~~~~~G~iDilVn   88 (239)
T PRK12828          9 VVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQTLPGVPADALRIGGIDLVDPQAARRAVDEVNRQFGRLDALVN   88 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89994725489999999999879989999798778999998751788569996079999999999999998399979998


Q ss_pred             EECCCCCCC---EEECCC----CCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             612444331---000122----1013----------4432--01233433332010257621234532112343113455
Q gi|254780595|r   71 CIKPSSEGD---PCIISM----SKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQ  131 (289)
Q Consensus        71 ~~~~~~~~~---~~~~~~----~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~  131 (289)
                      +++......   ......    ..++          ...+  ..-.++|.+||.+.+-.           ......|+.+
T Consensus        89 NAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~-----------~~~~~~Y~as  157 (239)
T PRK12828         89 IAGAFVWGTIADGDADTWDRMYGVNVKTTLNASKAALPALTASGGGRIVNIGAGAALKA-----------GPGMGAYAAA  157 (239)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-----------CCCCHHHHHH
T ss_conf             97789999904499999999999996999999999999998769986999977786777-----------9996899999


Q ss_pred             HHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----C
Q ss_conf             44555543200123---4567642034777789850344431134543222110001024777799999995135----5
Q gi|254780595|r  132 RFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----L  204 (289)
Q Consensus       132 k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----~  204 (289)
                      |.+...+.+..+.+   +++.+-.+-|+.|--|.      .+...    ... ..--+..-+|+|+++++|....    .
T Consensus       158 Kaal~~ltk~lA~e~~~~gIrVN~V~PG~v~T~~------~~~~~----~~~-~~~r~~~p~diA~~v~fL~Sd~s~~iT  226 (239)
T PRK12828        158 KAGVARLTEALAAELLDRGITVNAVLPSIIDTPP------NRADM----PDA-DFSRWVTPEQIAAVIAFLLSDEAQAIT  226 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCC------HHCCC----CHH-HCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             9999999999999861309089999738788820------02418----564-617989999999999999584422855


Q ss_pred             CCCEECCCCC
Q ss_conf             7861626843
Q gi|254780595|r  205 GGIFNLSDDE  214 (289)
Q Consensus       205 ~~iyni~~~~  214 (289)
                      |+++.+-.|-
T Consensus       227 G~~i~VdGG~  236 (239)
T PRK12828        227 GASIPVDGGV  236 (239)
T ss_pred             CCEEEECCCC
T ss_conf             8748979786


No 126
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=98.60  E-value=8.4e-07  Score=58.33  Aligned_cols=187  Identities=18%  Similarity=0.172  Sum_probs=109.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HH----HHHHHCCCEE--EECCCCCCC---H---HHHHHHCCCCEE
Q ss_conf             999888-88899999999988988999967944-63----4556449828--980678640---2---346541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NL----LTLKHKGISP--FLFADQKIN---N---LLREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~----~~l~~~~~~~--~~~~~~~~~---~---~~~~~~~~~~~v   68 (289)
                      .||||| .=||+.+++.|.++|++|....|+.+ ..    ..+...|...  +..|..+.+   .   ...+... +|.+
T Consensus         1 AlVTGasRGIG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDiL   79 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDIL   79 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEEE
T ss_conf             967167861679999999867995999659825788899999985697599996038888999999999999829-9089


Q ss_pred             EEEECCCCC----------CCEEECCCCCHHHHHH---------HCCCCCCCCCCE-EECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             876124443----------3100012210134432---------012334333320-10257621234532112343113
Q gi|254780595|r   69 VQCIKPSSE----------GDPCIISMSKDFYKFM---------PHVKWIGYLSST-SIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~----------~~~~~~~~~~~~~~~~---------~~~~~~i~~SS~-~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++.|.=+.+          -|.++.-..+..+.++         ++--|+|.+||. +++|+.            .+.-|
T Consensus        80 VNNAGITrD~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~~M~K~R~GrIINisSVVG~~GN~------------GQaNY  147 (238)
T TIGR01830        80 VNNAGITRDNLLMRMKEEDWDAVINVNLKGVFNLTQAVLRPMIKQRSGRIINISSVVGLMGNA------------GQANY  147 (238)
T ss_pred             EECCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCC------------CHHHH
T ss_conf             978741343010048855689999861266878889988988750674348610020000687------------42678


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC--CHHHH---------HHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             45544555543200123456764203477778985--03444---------31134543222110001024777799999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR--NPFIK---------IRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r--~~~~~---------~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      +.+|.=..=+-.+++++.+-+  -+| .+...||.  ..|+.         +...-|.-.+  +      -.+|||.++.
T Consensus       148 aASKAG~IGftKSlAkElasR--nIt-VNaVAPGFI~TdMT~~L~e~~~~~~l~~IPLgR~--G------~pEeVA~~v~  216 (238)
T TIGR01830       148 AASKAGVIGFTKSLAKELASR--NIT-VNAVAPGFIETDMTDKLSEKVKKAMLSQIPLGRF--G------TPEEVANAVA  216 (238)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC--CCE-EEEECCCCCCCCCCHHCCHHHHHHHHHCCCCCCC--C------CHHHHHHHHH
T ss_conf             888755899999999860368--705-8887489989700021698899999852772326--7------7656999999


Q ss_pred             HHHCCC----CCCCEECCCC
Q ss_conf             995135----5786162684
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~  213 (289)
                      +|....    -|+++|+-.|
T Consensus       217 FLASd~AsYITGqv~~VdGG  236 (238)
T TIGR01830       217 FLASDEASYITGQVIHVDGG  236 (238)
T ss_pred             HHCCCCCCCCCCCEEECCCC
T ss_conf             73251247425516630687


No 127
>PRK06346 consensus
Probab=98.60  E-value=1.3e-06  Score=57.32  Aligned_cols=194  Identities=11%  Similarity=0.035  Sum_probs=107.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCC--CEEEECCCCCCCHH---H---HHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----556449--82898067864023---4---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKG--ISPFLFADQKINNL---L---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~--~~~~~~~~~~~~~~---~---~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|.+|..+.|+.++..    .+...+  ...+..|..+.+..   +   .+....+|.+
T Consensus         7 v~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~fg~iDiL   86 (251)
T PRK06346          7 VAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTYGTLDIL   86 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89994757889999999999879989999798999999999999639908999778898999999999999982999799


Q ss_pred             EEEECCCCCCCEEECC--------CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8761244433100012--------21013----------4432--01233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPSSEGDPCIIS--------MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~~~~~~~~--------~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++......+....        +..++          ...+  .+-.++|.+||..-+...           .....|
T Consensus        87 VnNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~-----------~~~~~Y  155 (251)
T PRK06346         87 VNNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNIASVGGLNGS-----------RAGAAY  155 (251)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCC-----------CCCHHH
T ss_conf             989988999987112899999999999709999999999999998599549999456547889-----------887589


Q ss_pred             HHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC--------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             4554455554320012---3456764203477778985--------0344431134543222110001024777799999
Q gi|254780595|r  129 ATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR--------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r--------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      +.+|.....+.+..+.   .+++.+-.+-|+.|--+..        ....+.......     ..  -+-.-+|+++++.
T Consensus       156 ~asK~al~~ltr~lA~e~a~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~-----~~--R~g~pediA~~v~  228 (251)
T PRK06346        156 TASKHAVIGLTKNTGFMYANKGIRCNAIAPGAVNTNIGTTITAPDEFGQERAMAGMGT-----NP--RAGQAEEIAQVAL  228 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCC-----CC--CCCCHHHHHHHHH
T ss_conf             9999999999999999862419599998768897723331247897799988624888-----89--8768999999999


Q ss_pred             HHHCCCC----CCCEECCCC
Q ss_conf             9951355----786162684
Q gi|254780595|r  198 FLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~~----~~iyni~~~  213 (289)
                      +|.....    |+++.+-.+
T Consensus       229 fL~Sd~s~~iTG~~i~VDGG  248 (251)
T PRK06346        229 FLASDDASFVNGTVITADGG  248 (251)
T ss_pred             HHHCCHHCCCCCCEEECCCC
T ss_conf             99571535936862880858


No 128
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=98.59  E-value=2e-06  Score=56.17  Aligned_cols=199  Identities=13%  Similarity=0.110  Sum_probs=103.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH---HHHHHCC--CEEEECCCCCCC---HHHH---HHHCCCCEEE
Q ss_conf             3999888-8889999999998898899996794463---4556449--828980678640---2346---5411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL---LTLKHKG--ISPFLFADQKIN---NLLR---EKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~---~~l~~~~--~~~~~~~~~~~~---~~~~---~~~~~~~~v~   69 (289)
                      .+||||+ +=||..+++.|+++|++|....|+....   ..+...+  +..+..|..+.+   ..+.   +....+|.++
T Consensus        10 valITGas~GIG~aiA~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiLV   89 (260)
T PRK12823         10 VAVVTGAAQGIGRGVALRAAAEGARVVLVDRSELVHEVAAELVAAGGEALALTADLETYAGAQAVMAAAVEAFGRIDVLI   89 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89994886789999999999879999999694689999999985499489998126885899999999999839987999


Q ss_pred             EEECCCCCCCEE-------E-CCCCCHHH-------HHH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             761244433100-------0-12210134-------432-----012334333320102576212345321123431134
Q gi|254780595|r   70 QCIKPSSEGDPC-------I-ISMSKDFY-------KFM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        70 ~~~~~~~~~~~~-------~-~~~~~~~~-------~~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      ++++......+.       + .....++.       +..     .+-.++|++||.+..+      .       ...+|+
T Consensus        90 nnag~~~~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~Ii~isS~~~~~------~-------~~~~Y~  156 (260)
T PRK12823         90 NNVGGTIWAKPFEEYEEEQIEAEIRRSLFPTLWCCRAVLPHMLAQGGGAIVNVSSIATRG------I-------NRVPYS  156 (260)
T ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCCC------C-------CCCHHH
T ss_conf             775224578982659999999999998540689999999999981696799982022058------8-------751269


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHH-CCCC------CC---CCCCCCEECCHHHHHHHHHH
Q ss_conf             5544555543200123---4567642034777789850344431-1345------43---22211000102477779999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIR-QKNS------LR---LVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~-~g~~------~~---~~~~~~~~~~ihv~Dva~~i  196 (289)
                      .+|.+.+.+.+.++.+   +|+.+-.+-|+.+-.|......... ....      ..   .......--+...+|+|.++
T Consensus       157 asKaal~~ltr~lA~ela~~gIrVN~I~PG~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~R~g~peevA~~v  236 (260)
T PRK12823        157 AAKGGVNALTASLAFEYAEHGIRVNAVAPGGTEAPPRRVPRNAAPQSEQEKAWYQQIVDQTLDSSLMKRYGTIDEQVAAI  236 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             99999999999999996152969999935867763333210134334667878999999986369988986999999999


Q ss_pred             HHHHCCC----CCCCEECCCC
Q ss_conf             9995135----5786162684
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~~  213 (289)
                      .+|....    -|+++.+-.|
T Consensus       237 ~fL~S~~s~~iTG~~i~VDGG  257 (260)
T PRK12823        237 LFLASDEASYITGSVLPVGGG  257 (260)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999585424804786886859


No 129
>PRK07109 short chain dehydrogenase; Provisional
Probab=98.58  E-value=1.3e-06  Score=57.17  Aligned_cols=191  Identities=17%  Similarity=0.107  Sum_probs=104.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCE--EEECCCCCCC---HHH---HHHHCCCCEEE
Q ss_conf             999888-8889999999998898899996794463455----644982--8980678640---234---65411563278
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGIS--PFLFADQKIN---NLL---REKLYFTTHIV   69 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~~--~~~~~~~~~~---~~~---~~~~~~~~~v~   69 (289)
                      |+|||| +=||..+++.|.++|++|..+.|+.+.+..+    ...+..  .+..|..+.+   ...   ......+|.++
T Consensus        11 VvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~~~G~IDvlV   90 (338)
T PRK07109         11 VVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEEELGPIDTWV   90 (338)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99948434999999999998799899998999999999999996398189998017999999999999999849988886


Q ss_pred             EEECCCCCC---CEEE----CCCCCHH----------HHHH-H-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             761244433---1000----1221013----------4432-0-123343333201025762123453211234311345
Q gi|254780595|r   70 QCIKPSSEG---DPCI----ISMSKDF----------YKFM-P-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        70 ~~~~~~~~~---~~~~----~~~~~~~----------~~~~-~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++.-....   +...    ..+..|+          +..+ + +-.++|.+||..-+-   +      .|  -.+.|+.
T Consensus        91 NNAGi~~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSvag~~---~------~P--~~saY~A  159 (338)
T PRK07109         91 NNAMVTVFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSALAYR---S------IP--LQSAYCA  159 (338)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---C------CC--CCCHHHH
T ss_conf             54666778763229999999998775189999999999999867997899988955545---7------89--9817999


Q ss_pred             HHHHHHHHHH----HC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCH-HHHHHHHHHHHHHCCCC
Q ss_conf             5445555432----00-123456764203477778985034443113454322211000102-47777999999951355
Q gi|254780595|r  131 QRFNAEKEWL----AI-TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRI-RVEDVARCVIFLMTHHL  204 (289)
Q Consensus       131 ~k~~~E~~~~----~~-~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~i-hv~Dva~~i~~l~~~~~  204 (289)
                      +|....-...    +. .+..++.++.+-|+.|==|.   |...++......    +....| .=+-+|++|+++.+++.
T Consensus       160 SK~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP~---f~~~~n~~~~~~----~~~pp~~~pe~vA~ai~~~a~~p~  232 (338)
T PRK07109        160 AKHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTPQ---FDWARSYLPVEP----QPVPPIYQPEVVADAILFAAEHPR  232 (338)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCH---HHHHHHCCCCCC----CCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             9999999999999999867998189997579877974---244452379888----899999898999999999974898


Q ss_pred             CCCEECC
Q ss_conf             7861626
Q gi|254780595|r  205 GGIFNLS  211 (289)
Q Consensus       205 ~~iyni~  211 (289)
                      .++|--.
T Consensus       233 r~~~vg~  239 (338)
T PRK07109        233 RELWVGG  239 (338)
T ss_pred             CEEEECH
T ss_conf             5243077


No 130
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=98.58  E-value=3.9e-07  Score=60.26  Aligned_cols=74  Identities=15%  Similarity=0.205  Sum_probs=58.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             93999888888999999999889-8899996794463455644---982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG-VYTCGTTRSVSNLLTLKHK---GISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||+|+|||.||+.++..|.+.+ ++|++.+|++++.......   .++....|..+. ..+.+.+.+.|.|++++++.
T Consensus         2 ~~ilviGaG~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~~~~v~~~~vD~~d~-~al~~li~~~d~VIn~~p~~   79 (389)
T COG1748           2 MKILVIGAGGVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELIGGKVEALQVDAADV-DALVALIKDFDLVINAAPPF   79 (389)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCH-HHHHHHHHCCCEEEEECCCH
T ss_conf             7289989866679999999857896299984888899998753346631699425675-88999872577899928705


No 131
>PRK08265 short chain dehydrogenase; Provisional
Probab=98.55  E-value=1.6e-06  Score=56.77  Aligned_cols=198  Identities=10%  Similarity=0.004  Sum_probs=106.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCHH------HHHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---982898067864023------46541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINNL------LREKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||..+++.|.++|++|..+.|+.++...+...   ....+..|..+....      ..+....+|.++++
T Consensus         8 valVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~i~~~~~~~~~~fG~iDiLVNN   87 (261)
T PRK08265          8 VAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAASLGERARFIATDITDDAAIERAVATAVARFGGLDILVNL   87 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89994877689999999999879989999798899999999819972899813899999999999999981998789985


Q ss_pred             ECCCCC--CCEEECCC----CCHH----------H-HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             124443--31000122----1013----------4-43201233433332010257621234532112343113455445
Q gi|254780595|r   72 IKPSSE--GDPCIISM----SKDF----------Y-KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN  134 (289)
Q Consensus        72 ~~~~~~--~~~~~~~~----~~~~----------~-~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~  134 (289)
                      ++....  .+......    ..++          . ...++-.++|.+||.+..-   +        ..+...|+.+|..
T Consensus        88 Ag~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~G~IInisS~~~~~---~--------~~~~~~Y~asKaa  156 (261)
T PRK08265         88 ACTYVDDGLASSRADWLAALDVNLVSAAMLAQAAHPHLKRGGGAIVNFTSISAKV---A--------QTGRWLYPASKAA  156 (261)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCC---C--------CCCCCHHHHHHHH
T ss_conf             7557887343999999999999839999999999999987697799996533045---7--------8885067999999


Q ss_pred             HHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCC---CCCCCCCEEC-CHHHHHHHHHHHHHHCCCC---
Q ss_conf             55543200123---456764203477778985034443113454---3222110001-0247777999999951355---
Q gi|254780595|r  135 AEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSL---RLVKKNQVFN-RIRVEDVARCVIFLMTHHL---  204 (289)
Q Consensus       135 ~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~---~~~~~~~~~~-~ihv~Dva~~i~~l~~~~~---  204 (289)
                      .+.+.+.++.+   +|+++-.+-|+.|.-|.   +..+......   .+...-+..- ....+|+++++.+|.....   
T Consensus       157 l~~ltk~lA~e~a~~gIrVN~IaPG~i~T~~---~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dIa~~v~fL~Sd~a~~i  233 (261)
T PRK08265        157 IRQLTRSMAMDLAPDGIRVNSVSPGWTWSRV---MDELSGGDRAKADRVAAPFHLLGRVGDPEEVAQVVAFLCSDAASFV  233 (261)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCHH---HHHHCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             9999999999974109299888558778677---8764358899999986137888997589999999999967742383


Q ss_pred             -CCCEECCCC
Q ss_conf             -786162684
Q gi|254780595|r  205 -GGIFNLSDD  213 (289)
Q Consensus       205 -~~iyni~~~  213 (289)
                       |++..+-.|
T Consensus       234 TGq~i~VDGG  243 (261)
T PRK08265        234 TGADYAVDGG  243 (261)
T ss_pred             CCCEEEECCC
T ss_conf             5970872819


No 132
>PRK06125 short chain dehydrogenase; Provisional
Probab=98.55  E-value=1.1e-06  Score=57.72  Aligned_cols=199  Identities=14%  Similarity=0.062  Sum_probs=105.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHC---CCEEEECCCCCC--CHHHHHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455----644---982898067864--02346541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHK---GISPFLFADQKI--NNLLREKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~---~~~~~~~~~~~~--~~~~~~~~~~~~~v~~~   71 (289)
                      ++||||+ +=||..+++.|.++|.+|....|+.++....    ...   .+..+..|..+.  ...+......+|+++++
T Consensus         9 ~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~g~iDiLVnn   88 (259)
T PRK06125          9 RVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAHGVDVAVHALDLSSPEAREQLAAEAGDIDILVNN   88 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             89996877689999999999879989999798899999999998700986699988899999999999985899899976


Q ss_pred             ECCCCCC--CE-EECCC----CCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433--10-00122----1013----------44320--12334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG--DP-CIISM----SKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~--~~-~~~~~----~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++.....  +. .....    ..++          ...+.  +-.++|.+||.+..           .+..+...|+.+|
T Consensus        89 AG~~~~~~~~~~~~~~w~~~~~vnl~~~~~l~~~~~p~m~~~~~G~Iini~s~~~~-----------~~~~~~~~y~asK  157 (259)
T PRK06125         89 AGAIPGGSLDDVDDAAWRAGWELKVFGYINLTRLFYPRMKARGSGVIVNVIGAAGE-----------NPDAGYICGSAGN  157 (259)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-----------CCCCCCHHHHHHH
T ss_conf             87789986454999999999998634378899999997653498199999421337-----------8887648999999


Q ss_pred             HHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCC--------CEEC-CHHHHHHHHHHHHHH
Q ss_conf             455554320012---3456764203477778985034443113454322211--------0001-024777799999995
Q gi|254780595|r  133 FNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN--------QVFN-RIRVEDVARCVIFLM  200 (289)
Q Consensus       133 ~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~--------~~~~-~ihv~Dva~~i~~l~  200 (289)
                      ...+.+.+..+.   .+++.+-.+-|+.|..|.-..+  +............        .... +-..+|+++++.+|.
T Consensus       158 aal~~ltr~lA~e~~~~gIrVNaV~PG~v~T~~~~~~--~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~fLa  235 (259)
T PRK06125        158 AALMAFTRALGGKSLDDGIRVVGVNPGPVGTDRMLTL--LKGRARAELGDESRWQELLAGLPLGRPATPREVADLVAFLA  235 (259)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHH--HHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999999999998566784999986688887057778--77777662388999999984799899788999999999995


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|++..+-.+
T Consensus       236 Sd~ss~itG~~i~vDGG  252 (259)
T PRK06125        236 SPRSGYTSGTVVTVDGG  252 (259)
T ss_pred             CHHHCCCCCCEEEECCC
T ss_conf             80536853852786808


No 133
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=98.55  E-value=2.8e-07  Score=61.03  Aligned_cols=71  Identities=14%  Similarity=0.161  Sum_probs=54.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEE
Q ss_conf             939998888889999999998898899996794463455644-98289806786402346541156327876
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQC   71 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~   71 (289)
                      |||+|.|||-+|++|++.|.++||+|+.+.++++....+... ++..+.++..+...........+|.++.+
T Consensus         1 M~IiI~GaG~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~lDv~~i~Gd~~~~~~L~~Agi~~ad~~IAv   72 (455)
T PRK09496          1 MKIIILGAGQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRLDVRTVVGNGSHPDVLREAGAEDADMLIAV   72 (455)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCEEEEEECCCCHHHHHHCCCCCCCEEEEE
T ss_conf             979999988899999999986899799998999999998862586899966899999996599869999995


No 134
>PRK09134 short chain dehydrogenase; Provisional
Probab=98.55  E-value=3.1e-06  Score=55.09  Aligned_cols=198  Identities=13%  Similarity=0.109  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHHH----HHHCCCE--EEECCCCCCCH---HHH---HHHCCCCE
Q ss_conf             3999888-888999999999889889999-679446345----5644982--89806786402---346---54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLLT----LKHKGIS--PFLFADQKINN---LLR---EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~~----l~~~~~~--~~~~~~~~~~~---~~~---~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|++|... .|+.++...    +...+..  .+..|..+.+.   .+.   +....+|.
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~~~~~G~iDi   90 (256)
T PRK09134         11 AALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARASAALGPITL   90 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79994886789999999999879989998499989999999999964991899975589999999999999998299878


Q ss_pred             EEEEECCCCCC---CEEECC----CCCH----------HHHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78761244433---100012----2101----------344320--1233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----MSKD----------FYKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~~~~----------~~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++.....   +.....    +..+          +...+.  ...++|.+||.+++....           ....|
T Consensus        91 LVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~~G~IVni~s~~~~~~~~-----------~~~~Y  159 (256)
T PRK09134         91 LVNNASLFEYDSAASFTRASWDRHMATNLRAPFVLAQAFARALPADARGLVVNMIDQRVWNLNP-----------DFLSY  159 (256)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCC-----------CCHHH
T ss_conf             9988711689970209999999997540105999999999998860780699980076547899-----------71516


Q ss_pred             HHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             4554455554320012345--67642034777789850---344431134543222110001024777799999995135
Q gi|254780595|r  129 ATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~---~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      +.+|...+.+.+.++++.+  +.+-.+-|+.+.-..+.   .+.+..+..+.    +    -+..-+|+++++.+|.+..
T Consensus       160 ~asKaal~~ltr~lA~ela~~IrVN~VaPG~~~~~~~~~~~~~~~~~~~~pl----~----R~~~pediA~~v~fLas~~  231 (256)
T PRK09134        160 TLSKAALWTATRTLAQALAPRIRVNAIGPGPTLPSGRQSPEDFARQHAATPL----G----RGPNPEEIGAALRYLLDAP  231 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHCCC
T ss_conf             9999999999999999977999899994250056876799999999837998----8----9969999999999997478


Q ss_pred             --CCCCEECCCCCHHHH
Q ss_conf             --578616268433338
Q gi|254780595|r  204 --LGGIFNLSDDEPAPP  218 (289)
Q Consensus       204 --~~~iyni~~~~~~s~  218 (289)
                        -|++.++-.|..++|
T Consensus       232 ~iTGq~i~VDGG~~l~~  248 (256)
T PRK09134        232 SVTGQMIAVDGGQHLAW  248 (256)
T ss_pred             CCCCCEEEECCCCCCCC
T ss_conf             87788288696833799


No 135
>PRK09242 tropinone reductase; Provisional
Probab=98.55  E-value=1.3e-06  Score=57.34  Aligned_cols=193  Identities=13%  Similarity=0.078  Sum_probs=105.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHC--C--CEEEECCCCCCCHH------HHHHHCCCC
Q ss_conf             3999888-8889999999998898899996794463455----644--9--82898067864023------465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHK--G--ISPFLFADQKINNL------LREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~--~--~~~~~~~~~~~~~~------~~~~~~~~~   66 (289)
                      ++||||+ +=||..+++.|.++|++|..+.|+.++....    ...  +  +..+..|..+.+..      ..+....+|
T Consensus        12 ~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iD   91 (258)
T PRK09242         12 TALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVEDHWDGLH   91 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99994848689999999999879989999698899999999998644797299999307999999999999999749997


Q ss_pred             EEEEEECCCCCCC---EE---E-CCCCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             2787612444331---00---0-1221013----------44320--123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEGD---PC---I-ISMSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~~---~~---~-~~~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++......   -.   + ..+..++          ...+.  +-.++|.+||.+-.-           +......
T Consensus        92 iLVnnAG~~~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m~~~~~G~IInisS~~~~~-----------~~~~~~~  160 (258)
T PRK09242         92 ILVNNAGGNITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLLKRHAASSIVNIGSVSGLT-----------HVRSGAP  160 (258)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCC-----------CCCCCHH
T ss_conf             99989988999980019999999999998199999999999999975992799993042116-----------8987556


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-CH------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             345544555543200123---456764203477778985-03------44431134543222110001024777799999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-NP------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~~------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      |+.+|...+.+.+..+.+   +++++-.+-|+.+--|-. ..      ...+.+..+.        --+-..+|+++++.
T Consensus       161 Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~pediA~~v~  232 (258)
T PRK09242        161 YGMTKAALQQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEQVIERTPM--------RRIGEPEEVAAAVA  232 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHCCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHH
T ss_conf             7999999999999999998027989999835889872120223799999999857998--------99879999999999


Q ss_pred             HHHCCC----CCCCEECCCC
Q ss_conf             995135----5786162684
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~  213 (289)
                      +|....    -|+++.+-.|
T Consensus       233 fLaSd~s~~iTGq~i~VDGG  252 (258)
T PRK09242        233 FLCLPAASYITGECIAVDGG  252 (258)
T ss_pred             HHHCCHHCCCCCCEEEECCC
T ss_conf             99585324754853898907


No 136
>PRK08264 short chain dehydrogenase; Validated
Probab=98.55  E-value=9.2e-07  Score=58.09  Aligned_cols=144  Identities=12%  Similarity=0.039  Sum_probs=83.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHCCCEEEECCCCCCC--HHHHHHHCCCCEEEEEECCCCC
Q ss_conf             3999888-88899999999988988-999967944634556449828980678640--2346541156327876124443
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVY-TCGTTRSVSNLLTLKHKGISPFLFADQKIN--NLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~-V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~--~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      .+||||+ +=||..++++|.++|.. |....|+++...   ..++..+..|..+.+  ....+....+|.++++++-...
T Consensus         7 ~alITGassGIG~aiA~~la~~Ga~~V~~~~r~~~~~~---~~~~~~~~~Dv~d~~~v~~~~~~~~~idvlVnNAGi~~~   83 (235)
T PRK08264          7 VVLVTGANRGIGRAFVEELLARGAAKVYAAARDPESVD---LPRVVPLQLDVTDPASVAAAAEQASDVTILINNAGISRP   83 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHCC---CCCEEEEEECCCCHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89992675499999999999869977999727840355---598799980689999999999973998699988855778


Q ss_pred             C----CEEECC----CCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             3----100012----21013----------44320--1233433332010257621234532112343113455445555
Q gi|254780595|r   78 G----DPCIIS----MSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK  137 (289)
Q Consensus        78 ~----~~~~~~----~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~  137 (289)
                      .    +.....    +..|+          ...+.  +-.++|++||.+-+-           +.-....|+.+|...+.
T Consensus        84 ~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~IvnisS~~g~~-----------~~p~~~~Y~aSKaal~~  152 (235)
T PRK08264         84 GSLLAEGDLDALRAEMETNVFGPLRMARAFAPVLAANGGGAIVNVLSVLSWV-----------NFPNLGAYSASKAAAWS  152 (235)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC-----------CCCCCHHHHHHHHHHHH
T ss_conf             9864559999999999997299999998726999857998599992754448-----------99997679999999999


Q ss_pred             HHHHCC---CCCCCCCCCCCCCCCC
Q ss_conf             432001---2345676420347777
Q gi|254780595|r  138 EWLAIT---KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       138 ~~~~~~---~~~~~~~~ilR~~~iy  159 (289)
                      +.+.+.   ...|+.+..+.|+.|-
T Consensus       153 ~~~~La~El~~~gI~V~~i~PG~v~  177 (235)
T PRK08264        153 LTQALREELAPQGTRVLGVHPGYID  177 (235)
T ss_pred             HHHHHHHHHHHHCCEEEEEEECCCC
T ss_conf             9999999850329389999728999


No 137
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=98.55  E-value=2e-06  Score=56.20  Aligned_cols=204  Identities=11%  Similarity=0.052  Sum_probs=109.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-C--CCEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-888999999999889889999679446345564-4--98289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-K--GISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-~--~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++...... .  ....+..|..+.+.   .+   .+....+|.++++
T Consensus         7 valVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNN   86 (256)
T PRK07067          7 VALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIGPAAVAVSLDVTRQDSIDRIVAAAVERFGGIDILVNN   86 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89993767789999999999879999999798899999999819975999984899999999999999981999899989


Q ss_pred             ECCCCCC---CEEECC----CCCH----------HHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             1244433---100012----2101----------34432-0--1233433332010257621234532112343113455
Q gi|254780595|r   72 IKPSSEG---DPCIIS----MSKD----------FYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQ  131 (289)
Q Consensus        72 ~~~~~~~---~~~~~~----~~~~----------~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~  131 (289)
                      ++-....   +.....    +..+          ....+ +  +-.++|.+||.+.+  . +        ......|+.+
T Consensus        87 AGi~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~G~IVnisS~~g~--~-~--------~~~~~~Y~as  155 (256)
T PRK07067         87 AALFDMAPILEISRDVYDRLFAVNVKGLFFLMQAVAQHMVEQGRGGKIINMASQAGR--R-G--------EALVSHYCAT  155 (256)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHC--C-C--------CCCCHHHHHH
T ss_conf             988999881349999999999985177899999999999980899559998416436--6-8--------9886689999


Q ss_pred             HHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHH-HHC--CCCC----CCCCCCCEE-CCHHHHHHHHHHHHHH
Q ss_conf             4455554320012---345676420347777898503444-311--3454----322211000-1024777799999995
Q gi|254780595|r  132 RFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIK-IRQ--KNSL----RLVKKNQVF-NRIRVEDVARCVIFLM  200 (289)
Q Consensus       132 k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~-~~~--g~~~----~~~~~~~~~-~~ihv~Dva~~i~~l~  200 (289)
                      |.....+.+..+.   .+++.+-.+-|+.|..|-...+.. +..  +...    ......... -+-.-+|+|+++.+|.
T Consensus       156 Kaav~~lTr~lA~ela~~gIrVNaV~PG~i~T~m~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~pedvA~~v~fLa  235 (256)
T PRK07067        156 KAAVISYTQSAALALARHGINVNAIAPGVVDTPMWDQVDALFARYENRPPGEKKRLVGEAVPLGRMGVPDDLTGAALFLA  235 (256)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999704292899995488888614456677655316997999999982799899868999999999995


Q ss_pred             CCC----CCCCEECCCCCHH
Q ss_conf             135----5786162684333
Q gi|254780595|r  201 THH----LGGIFNLSDDEPA  216 (289)
Q Consensus       201 ~~~----~~~iyni~~~~~~  216 (289)
                      ...    -|+++++-.+.-+
T Consensus       236 Sd~a~~iTG~~l~VDGG~~m  255 (256)
T PRK07067        236 SADADYIVAQTLNVDGGNWM  255 (256)
T ss_pred             CCHHCCCCCCEEEECCCHHC
T ss_conf             86432805881787956220


No 138
>PRK06500 short chain dehydrogenase; Provisional
Probab=98.54  E-value=3.2e-06  Score=55.00  Aligned_cols=197  Identities=12%  Similarity=-0.000  Sum_probs=106.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCC---HHHH---HHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---9828980678640---2346---541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKIN---NLLR---EKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~---~~~~---~~~~~~~~v~~~   71 (289)
                      .++|||+ +=||..+++.|+++|.+|..+.|+.+........   ....+..|..+..   ....   +....+|.++++
T Consensus         8 ~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDiLvnn   87 (249)
T PRK06500          8 TALITGGTSGIGLETARQFAAEGARVAITGRDAATLEAARAELGEDALVIRNDAGSVAAQRALAQALAEAGGRLDAVFIN   87 (249)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89993768789999999999879999999699899999999858975999951799999999999999976999899989


Q ss_pred             ECCCCCCC---EEECC----CCCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             12444331---00012----2101----------3443201233433332010257621234532112343113455445
Q gi|254780595|r   72 IKPSSEGD---PCIIS----MSKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN  134 (289)
Q Consensus        72 ~~~~~~~~---~~~~~----~~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~  134 (289)
                      ++......   -....    +..+          ....+.+-..+|..||...+-   +.      |  ....|+.+|..
T Consensus        88 AG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~p~m~~~g~iI~~sS~~~~~---~~------~--~~~aY~asKaa  156 (249)
T PRK06500         88 AGVAKFAPLEDWDEAMFDRSFNTNVKGPYFLIQALLPLLNNPASIVLNGSINAHI---GM------P--NSSVYAASKAA  156 (249)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECEEEE---CC------C--CCHHHHHHHHH
T ss_conf             9878999916699999999999864569999999999862298189982230761---68------9--73778999999


Q ss_pred             HHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             55543200123---456764203477778985034-------44311345432221100010247777999999951355
Q gi|254780595|r  135 AEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       135 ~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      .+.+.+..+.+   +++.+-.+.|+.+.-|....+       ..+.+.....++-+    -+-..+|+++++++|.....
T Consensus       157 l~~ltk~lA~E~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~iPl~----R~g~peeia~~v~fL~S~~a  232 (249)
T PRK06500        157 LLSLAKTLSGELLPRGIRVNAVSPGPVQTPLYGKLGLSEADLEATAAQIQGLVPLG----RFGTPEEIAKAVVFLASDES  232 (249)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999650495999997788977335531798010599999998379999----98599999999999958742


Q ss_pred             ----CCCEECCCC
Q ss_conf             ----786162684
Q gi|254780595|r  205 ----GGIFNLSDD  213 (289)
Q Consensus       205 ----~~iyni~~~  213 (289)
                          |++..+-.|
T Consensus       233 s~iTG~~i~vDGG  245 (249)
T PRK06500        233 AFIVGSEIIVDGG  245 (249)
T ss_pred             CCCCCCEEEECCC
T ss_conf             2814863888958


No 139
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=98.54  E-value=9.3e-07  Score=58.08  Aligned_cols=201  Identities=10%  Similarity=0.084  Sum_probs=105.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCE--EEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----5644982--898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGIS--PFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~--~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.|+.++...    +...+..  .+..|..+.+..      ..+....+|.+
T Consensus        12 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~~G~iDiL   91 (278)
T PRK08277         12 VAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAIALKADVLDKESLEQARQQILKDFGRCDIL   91 (278)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995867489999999999879989999798899999999998459909999824899999999999999984998889


Q ss_pred             EEEECC---CC-----------CC----CEEECCCC----CHH----------HHHH--HCCCCCCCCCCEEECCCCCCC
Q ss_conf             876124---44-----------33----10001221----013----------4432--012334333320102576212
Q gi|254780595|r   69 VQCIKP---SS-----------EG----DPCIISMS----KDF----------YKFM--PHVKWIGYLSSTSIYGNREGQ  114 (289)
Q Consensus        69 ~~~~~~---~~-----------~~----~~~~~~~~----~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~  114 (289)
                      +++++-   ..           ..    |-......    .++          ...+  .+-.++|.+||.+.+-     
T Consensus        92 VNnAG~~~p~~~~~~~~~~~~~~~~~~~d~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~-----  166 (278)
T PRK08277         92 INGAGGNHPGATTDNEFHELPPETKTFFDLDEDGFEFVFDLNLLGTLLPTQVFAKDMIEQKGGNIINISSMNAFT-----  166 (278)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----
T ss_conf             988987676663233212245455763119999999999997599999999999999876996599981366477-----


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCC----CCCCCCCEECCH
Q ss_conf             3453211234311345544555543200123---456764203477778985034443113454----322211000102
Q gi|254780595|r  115 WVDEHSFVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSL----RLVKKNQVFNRI  187 (289)
Q Consensus       115 ~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~----~~~~~~~~~~~i  187 (289)
                            +......|+.+|.....+.+..+.+   +|+.+-.+-|+.|..|....+..-..+...    .+...-..--+-
T Consensus       167 ------~~~~~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g  240 (278)
T PRK08277        167 ------PLTKVPAYSAAKAAISNFTQWLAVEFAKVGIRVNAIAPGFFLTEQNRALLLNEDGSPTERANKILAHTPMGRFG  240 (278)
T ss_pred             ------CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             ------88986557999999999999999996535949999852888772667764186678799999998479988984


Q ss_pred             HHHHHHHHHHHHHCCC-----CCCCEECCCC
Q ss_conf             4777799999995135-----5786162684
Q gi|254780595|r  188 RVEDVARCVIFLMTHH-----LGGIFNLSDD  213 (289)
Q Consensus       188 hv~Dva~~i~~l~~~~-----~~~iyni~~~  213 (289)
                      ..+|+++++++|...+     -|+++.+-.+
T Consensus       241 ~pedia~~v~fLaS~~as~yiTG~~i~VDGG  271 (278)
T PRK08277        241 KPEELLGTLLWLADEDASSFVTGVVLPVDGG  271 (278)
T ss_pred             CHHHHHHHHHHHHCCCHHCCCCCCEEEECCC
T ss_conf             9999999999990980527733872886925


No 140
>PRK07707 consensus
Probab=98.53  E-value=2.5e-07  Score=61.29  Aligned_cols=192  Identities=17%  Similarity=0.022  Sum_probs=102.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHC----CCEEEECCCCCC---CHHHHHHHCCCCEEEEEEC
Q ss_conf             999888-8889999999998898899996-794463455644----982898067864---0234654115632787612
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTT-RSVSNLLTLKHK----GISPFLFADQKI---NNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~-r~~~~~~~l~~~----~~~~~~~~~~~~---~~~~~~~~~~~~~v~~~~~   73 (289)
                      +||||+ +=||..+++.|.++|++|.... ++.+....+...    ....+..|..+.   ...+......+|.++++++
T Consensus         5 alVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~v~~Dl~~~~~~~~~~~~~~~~iD~lVnnAG   84 (239)
T PRK07707          5 ALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQEELGEVIPVPVQADLASPDGAEKLWSQIEHPLDAIVYNSG   84 (239)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             99966887899999999998799899983999899999999844366069998689999999999985788999998999


Q ss_pred             CCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             44433---100012----21013----------4432--01233433332010257621234532112343113455445
Q gi|254780595|r   74 PSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN  134 (289)
Q Consensus        74 ~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~  134 (289)
                      .....   +.....    +..++          ...+  .+-.++|.+||...+  .         +..+...|+.+|..
T Consensus        85 ~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~II~isS~~~~--~---------g~~~~~~Y~asKaa  153 (239)
T PRK07707         85 KSIFGLVTDVTNDELNDMVQLHVKSPYKLLSMLLPSMIQRKSGNIVAVSSIWGQ--I---------GASCEVLYSMVKGA  153 (239)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--C---------CCCCCHHHHHHHHH
T ss_conf             999987010999999999999989999999999899987699679997378874--7---------68751688999999


Q ss_pred             HHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC--
Q ss_conf             55543200123---4567642034777789850-----3444311345432221100010247777999999951355--
Q gi|254780595|r  135 AEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL--  204 (289)
Q Consensus       135 ~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~--  204 (289)
                      .+.+.+.++++   +|+.+-.+-|+.|--|--.     ....+.+..+  +      --+-..+|+|+++.+|.....  
T Consensus       154 v~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~p--l------gR~g~pediA~~v~FL~S~~a~~  225 (239)
T PRK07707        154 QNSFVKALAKELAPSGIRVNAVAPGAIETEMLNVFSEEDKEEIAEEIP--L------GRLGLPEEVAKTVSFLLSPGASY  225 (239)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCHHHHHHHHHCCC--C------CCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             999999999997663969999974889872333139999999985699--9------99858999999999995872247


Q ss_pred             --CCCEECCCC
Q ss_conf             --786162684
Q gi|254780595|r  205 --GGIFNLSDD  213 (289)
Q Consensus       205 --~~iyni~~~  213 (289)
                        |++..+-.|
T Consensus       226 iTG~~l~VdGG  236 (239)
T PRK07707        226 ITGQIISVNGG  236 (239)
T ss_pred             CCCCEEEECCC
T ss_conf             51863885879


No 141
>PRK09135 pteridine reductase; Provisional
Probab=98.52  E-value=1.9e-06  Score=56.29  Aligned_cols=195  Identities=12%  Similarity=0.083  Sum_probs=103.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HHH----HHHHC---CCEEEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             999888-88899999999988988999967944-634----55644---98289806786402346-------5411563
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NLL----TLKHK---GISPFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~~----~l~~~---~~~~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      +||||+ +=||..+++.|.++|++|....|+.. ...    .+...   .+..+..|..+. ..+.       +....+|
T Consensus         9 alVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~-~~v~~~~~~~~~~~G~iD   87 (249)
T PRK09135          9 ALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDP-DALEQLVAAAVAAFGRLD   87 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCC
T ss_conf             9996887589999999999879989998189879999999999850598189998169999-999999999999839998


Q ss_pred             EEEEEECCCCCC---CEEECC----CCCHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             278761244433---100012----21013----------44-3201233433332010257621234532112343113
Q gi|254780595|r   67 HIVQCIKPSSEG---DPCIIS----MSKDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        67 ~v~~~~~~~~~~---~~~~~~----~~~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      .++++++.....   +.....    +..++          .. ..++-.++|.+||...+.           +......|
T Consensus        88 iLVNNAg~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~G~IInisS~~~~~-----------~~~~~~~Y  156 (249)
T PRK09135         88 ALVNNASSFYPTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQLRKQRGAIVNITDIHAER-----------PLKNYPVY  156 (249)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC-----------CCCCCHHH
T ss_conf             9998998899998155999999999998339999999999999874788789998712277-----------88985678


Q ss_pred             HHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCC-C-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             4554455554320012345--6764203477778985-0-----344431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKR-N-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r-~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|.....+.+.++.+.+  +.+-.+-|+.|.-|.. .     ...++.+..+..        -+-..+|+|+++.+|.
T Consensus       157 ~asKaal~~ltr~lA~ela~~IrVNaVaPG~i~t~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pediA~~v~fLa  228 (249)
T PRK09135        157 CAAKAALEMLTRSLALELAPEVRVNAVAPGAILWPENDQGLDAEARQAILARTPLK--------RIGTPEDIAEAVLFLL  228 (249)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHHHHHH
T ss_conf             99999999999999999779988999930773677633449999999998579999--------9819999999999996


Q ss_pred             CCC---CCCCEECCCCCHHH
Q ss_conf             135---57861626843333
Q gi|254780595|r  201 THH---LGGIFNLSDDEPAP  217 (289)
Q Consensus       201 ~~~---~~~iyni~~~~~~s  217 (289)
                      +..   -|+++.+-.|..+|
T Consensus       229 sdasyiTGq~i~VDGG~slt  248 (249)
T PRK09135        229 EDASFITGQILAVDGGRSLT  248 (249)
T ss_pred             CCCCCCCCCEEEECCCCCCC
T ss_conf             56787429848859894576


No 142
>PRK06057 short chain dehydrogenase; Provisional
Probab=98.52  E-value=2.4e-06  Score=55.76  Aligned_cols=195  Identities=12%  Similarity=0.029  Sum_probs=104.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-CCCEEEECCCCCCCHHHH-------HHHCCCCEEEEEE
Q ss_conf             3999888-888999999999889889999679446345564-498289806786402346-------5411563278761
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KGISPFLFADQKINNLLR-------EKLYFTTHIVQCI   72 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-~~~~~~~~~~~~~~~~~~-------~~~~~~~~v~~~~   72 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+....... .+...+..|..+. +.+.       +....+|.+++++
T Consensus         9 valVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~~~~~~Dv~~~-~~v~~~v~~~~~~~G~iDiLVNnA   87 (255)
T PRK06057          9 VAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAADELGGLFVQVDVTDE-DAVNALFDTAAETYGSVDIAFNNA   87 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCH-HHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             8999684888999999999986998999969889999999864997999816999-999999999999819987899888


Q ss_pred             CCCCCCCEEE-----CCC----CCHH----------HHHH--HCCCCCCCCCCE-EECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             2444331000-----122----1013----------4432--012334333320-1025762123453211234311345
Q gi|254780595|r   73 KPSSEGDPCI-----ISM----SKDF----------YKFM--PHVKWIGYLSST-SIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        73 ~~~~~~~~~~-----~~~----~~~~----------~~~~--~~~~~~i~~SS~-~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +-....+...     ...    ..++          ...+  .+-.++|.+||. +..|..           .....|+.
T Consensus        88 Gi~~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~g~~-----------~~~~~Y~a  156 (255)
T PRK06057         88 GISPPEDDSILNTGLDAWQRVQDVNLKSVYLCCKAALPHMVEAGKGSIINTASFVAVMGSA-----------TSQISYTA  156 (255)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-----------CCCHHHHH
T ss_conf             5578899862009999999999998299999999999999983995899973765635888-----------65255999


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHHH----HHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             544555543200123---45676420347777898-50344----43113454322211000102477779999999513
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPFI----KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~~----~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      +|.....+.+..+.+   +|+.+-.+-|+.|--|- +..+.    +..... ..++-+    -+-..+|+|+++.+|...
T Consensus       157 sKaav~~lTr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~e~~~~~~-~~~Plg----R~g~peeiA~~v~fLaSd  231 (255)
T PRK06057        157 SKGGVLAMSRELGVQFARQGIRVNALCPGPVNTPLLQELFAKDPERAARRL-VHVPLG----RFAEPEEIAAAVAFLASD  231 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCHHHHHHHH-HCCCCC----CCCCHHHHHHHHHHHHCC
T ss_conf             999999999999998603193999997387996577766305999999998-369988----978899999999999676


Q ss_pred             C----CCCCEECCCC
Q ss_conf             5----5786162684
Q gi|254780595|r  203 H----LGGIFNLSDD  213 (289)
Q Consensus       203 ~----~~~iyni~~~  213 (289)
                      .    .|+++.+-.+
T Consensus       232 ~ss~iTG~~i~VDGG  246 (255)
T PRK06057        232 DASFITASTFLVDGG  246 (255)
T ss_pred             HHCCCCCCEEEECCC
T ss_conf             424826873886938


No 143
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=98.52  E-value=1.9e-06  Score=56.30  Aligned_cols=200  Identities=16%  Similarity=0.081  Sum_probs=108.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCC--EEEECCCCCCCH---H---HHHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----5564498--289806786402---3---46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGI--SPFLFADQKINN---L---LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~--~~~~~~~~~~~~---~---~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.+...    .++..+.  ..+..|..+.+.   .   .......+|.+
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDiL   91 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVGVIDIL   91 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995857689999999999869999999599899999999999549917999932899999999999999982999899


Q ss_pred             EEEECCCCCC---CEEECCC----CCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000122----1013----------4432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISM----SKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~----~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-....   +......    ..++          ...+  .+-.++|.+||...+-   +        ......|+
T Consensus        92 VnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~---~--------~~~~~~Y~  160 (265)
T PRK07097         92 VNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSEL---G--------RETVSAYA  160 (265)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC---C--------CCCCHHHH
T ss_conf             989989999882659999999999986072899999999989980897599990521156---7--------88866899


Q ss_pred             HHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHHHH-CCCCCC----CCCCCCEE-CCHHHHHHHHHHHHHH
Q ss_conf             554455554320012---34567642034777789850344431-134543----22211000-1024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIKIR-QKNSLR----LVKKNQVF-NRIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~~~-~g~~~~----~~~~~~~~-~~ihv~Dva~~i~~l~  200 (289)
                      .+|.....+.+.++.   .+|+.+-.+-|+.|--|.-..+.... .+....    +.+ .... -+-..+|+++++.+|.
T Consensus       161 asKaav~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~-~~P~~R~g~p~dia~~v~FL~  239 (265)
T PRK07097        161 AAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIA-KTPAARWGTPEDLAGPAVFLA  239 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999999999999999702495999996588988630456653101112159999984-799889788999999999994


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++++-.|
T Consensus       240 Sd~s~~iTGq~i~VDGG  256 (265)
T PRK07097        240 SDASNFVNGHILYVDGG  256 (265)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84424835875997908


No 144
>PRK05867 short chain dehydrogenase; Provisional
Probab=98.52  E-value=2.1e-06  Score=56.03  Aligned_cols=200  Identities=16%  Similarity=0.060  Sum_probs=105.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463455----64498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++...+    ...+.  ..+..|..+.+..      ..+....+|.+
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   90 (253)
T PRK05867         11 RALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGIDIA   90 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89997956599999999999869999999798899999999998459919999836999999999999999995998599


Q ss_pred             EEEECCCCCC---CEEECCC----CCH----------HHHHH-HC--CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8761244433---1000122----101----------34432-01--233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISM----SKD----------FYKFM-PH--VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~----~~~----------~~~~~-~~--~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++.....   +......    ..+          ....+ +.  -..+|.+||.+-+  ..+       .+.....|
T Consensus        91 VnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~gg~IvnisS~~g~--~~~-------~~~~~~~Y  161 (253)
T PRK05867         91 VCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGH--IIN-------VPQQVSHY  161 (253)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC--CCC-------CCCCHHHH
T ss_conf             989977888750109999999999997599999999999999981899803887551112--657-------77402778


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC--
Q ss_conf             45544555543200123---4567642034777789850344431134543222110001024777799999995135--
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--  203 (289)
                      +.+|.....+.+..+.+   +++.+-.+-|+.|--|-...+..........++-+    -+-.-+|+++++++|....  
T Consensus       162 ~asKaav~~ltr~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~iPlg----R~g~pediA~~v~fLaSd~s~  237 (253)
T PRK05867        162 CASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLG----RLGRPEELAGLYLYLASEASS  237 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHHCCHHC
T ss_conf             9999999999999999970009299999658899876421178999998479988----982999999999999387214


Q ss_pred             --CCCCEECCCCC
Q ss_conf             --57861626843
Q gi|254780595|r  204 --LGGIFNLSDDE  214 (289)
Q Consensus       204 --~~~iyni~~~~  214 (289)
                        -|+++.+-.+-
T Consensus       238 ~iTG~~i~VDGG~  250 (253)
T PRK05867        238 YMTGSDIVIDGGY  250 (253)
T ss_pred             CCCCCEEEECCCC
T ss_conf             8548718858894


No 145
>PRK12742 oxidoreductase; Provisional
Probab=98.52  E-value=3.6e-06  Score=54.71  Aligned_cols=194  Identities=15%  Similarity=0.128  Sum_probs=103.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHH-CCCEEEECCCCCCCHH--HHHHHCCCCEEEEEECCCC
Q ss_conf             3999888-888999999999889889999679-446345564-4982898067864023--4654115632787612444
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRS-VSNLLTLKH-KGISPFLFADQKINNL--LREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~-~~~~~~l~~-~~~~~~~~~~~~~~~~--~~~~~~~~~~v~~~~~~~~   76 (289)
                      ++||||+ +=||..+++.|.++|++|....++ .+....+.. .+...+..+..+.+..  .......+|.++++++...
T Consensus         8 ~alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~iD~lVnnAg~~~   87 (237)
T PRK12742          8 SVLVLGGSRGIGAAIVRRFVTDGANVVFTYAGSKDAAERLAAETGATAVFTDSADRDAVIDVVRKSGPLDILVVNAGIAL   87 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             89992788799999999999879999997799989999998863982899354589999999998699989998997789


Q ss_pred             CCCE---EECC----CCCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             3310---0012----2101----------344320123343333201025762123453211234311345544555543
Q gi|254780595|r   77 EGDP---CIIS----MSKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEW  139 (289)
Q Consensus        77 ~~~~---~~~~----~~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~  139 (289)
                      ..+.   ....    +..+          ....+.+-.++|++||++  |..        .+......|+.+|.+.+.+.
T Consensus        88 ~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~G~ii~i~S~~--~~~--------~~~~~~~~Y~asKaal~~lt  157 (237)
T PRK12742         88 FGDALELDADAIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVN--GDR--------MPVAGMAAYAASKSALQGMA  157 (237)
T ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEC--CCC--------CCCCCCHHHHHHHHHHHHHH
T ss_conf             99813499999999998750679999999999712378599999530--023--------68886078899999999999


Q ss_pred             HHCCCC---CCCCCCCCCCCCCCCCC---CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----CCCCEE
Q ss_conf             200123---45676420347777898---50344431134543222110001024777799999995135----578616
Q gi|254780595|r  140 LAITKK---LNIKLAVLRLSGIYGPK---RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----LGGIFN  209 (289)
Q Consensus       140 ~~~~~~---~~~~~~ilR~~~iyGp~---r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----~~~iyn  209 (289)
                      +.++.+   +|+.+-.+-|+.|--|-   ............+ +      --+.+.+|+++++.+|....    -|+++.
T Consensus       158 k~lA~ela~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~p-l------~R~g~p~eia~~v~fL~S~~a~~iTG~~i~  230 (237)
T PRK12742        158 RGLARDFGPRGITINVVQPGPIDTDANPANGPMRDLMHSFMA-I------KRHGRPEEVAGMVAWLAGPEASFVTGAMHT  230 (237)
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHCCC-C------CCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             999999740297999996278888888677179999982599-8------998789999999999958653575588177


Q ss_pred             CCC
Q ss_conf             268
Q gi|254780595|r  210 LSD  212 (289)
Q Consensus       210 i~~  212 (289)
                      +-.
T Consensus       231 VDG  233 (237)
T PRK12742        231 IDG  233 (237)
T ss_pred             ECC
T ss_conf             485


No 146
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=98.49  E-value=1.4e-06  Score=57.07  Aligned_cols=196  Identities=13%  Similarity=0.062  Sum_probs=108.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCHHHH-------HHHCCCCEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---98289806786402346-------54115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINNLLR-------EKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~~~~-------~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.++|..|....|+.++...+...   ....+..|..+. ..+.       .....+|.+++
T Consensus         8 ~alITG~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~-~~v~~~~~~~~~~~g~iDiLIN   86 (245)
T PRK12936          8 KALVTGASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAAELGERVKIFPANLSDR-DEVKALGQKAEADLEGVDILVN   86 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCCEEEE
T ss_conf             899927476899999999998699999982999999999998389669999137999-9999999999997599969998


Q ss_pred             EECCCCCCC---EEECCC----CCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             612444331---000122----101----------34432--01233433332010257621234532112343113455
Q gi|254780595|r   71 CIKPSSEGD---PCIISM----SKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQ  131 (289)
Q Consensus        71 ~~~~~~~~~---~~~~~~----~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~  131 (289)
                      +++......   ......    ..+          ....+  .+-.++|.+||.+.+  . +.        .....|+.+
T Consensus        87 nAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~k~~~G~IInisS~a~~--~-~~--------~~~~~Y~as  155 (245)
T PRK12936         87 NAGITKDGLFVRMSDEDWDAVLEVNLTAVFRLTRELTHPMMRRRYGRIINITSVVGV--T-GN--------PGQANYCAS  155 (245)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--C-CC--------CCCHHHHHH
T ss_conf             998899998120999999999999819999999999999987488559997345535--6-89--------985899999


Q ss_pred             HHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH-HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC----
Q ss_conf             44555543200123---456764203477778985034-4431134543222110001024777799999995135----
Q gi|254780595|r  132 RFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF-IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH----  203 (289)
Q Consensus       132 k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~-~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~----  203 (289)
                      |.+...+.+.++.+   +|+.+-.+-|+.+--|-...+ ...++.    +.+.-..--+-..+|++.++.+|....    
T Consensus       156 Kaai~~ltrslA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~----~~~~~Pl~R~g~p~dia~~v~fL~S~~a~~i  231 (245)
T PRK12936        156 KAGMIGFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEA----IMGAIPMKRMGTGAEVASAVAYLASDEAAYV  231 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHH----HHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             999999999999997052929999975768863100039999999----9856998898299999999999968343484


Q ss_pred             CCCCEECCCC
Q ss_conf             5786162684
Q gi|254780595|r  204 LGGIFNLSDD  213 (289)
Q Consensus       204 ~~~iyni~~~  213 (289)
                      -|++.++..|
T Consensus       232 TGq~i~VdGG  241 (245)
T PRK12936        232 TGQTLHVNGG  241 (245)
T ss_pred             CCCEEEECCC
T ss_conf             6871797878


No 147
>PRK06523 short chain dehydrogenase; Provisional
Probab=98.49  E-value=6.9e-07  Score=58.81  Aligned_cols=200  Identities=12%  Similarity=0.052  Sum_probs=107.9

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCH---H---HHHHHCCCCEEEEEEC
Q ss_conf             93999888-888999999999889889999679446345564498289806786402---3---4654115632787612
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINN---L---LREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~---~---~~~~~~~~~~v~~~~~   73 (289)
                      .++||||+ +=||..++++|+++|.+|+...|+..+..   ......+..|..+...   .   ..+....+|.++++++
T Consensus        10 K~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~~~---~~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iDiLVnNAG   86 (260)
T PRK06523         10 KRALVTGGTKGIGAATVARFREAGARVVTTARSRPDDL---PEGVEFVAADLTTAEGCAAVARAVLERLGGVDILVHVLG   86 (260)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCC---CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             98999475769999999999987999999948840137---986289983799999999999999997499979998998


Q ss_pred             C----CCCC-CEEECCC----CCHHH-------HH---H--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             4----4433-1000122----10134-------43---2--012334333320102576212345321123431134554
Q gi|254780595|r   74 P----SSEG-DPCIISM----SKDFY-------KF---M--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        74 ~----~~~~-~~~~~~~----~~~~~-------~~---~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      .    .... +......    ..++.       +.   +  .+-.++|++||.+..  ..+        ......|+.+|
T Consensus        87 ~~~~~~~~~~~~~~~~w~~~~~~Nl~~~~~~~q~~~p~m~~~~~G~IinisS~~~~--~~~--------~~~~~~Y~asK  156 (260)
T PRK06523         87 GSSAPAGGFAALTDEEWQDELNLNLLAAVRLDRALLPAMIARGSGVIIHVTSIQRR--LPL--------PESTTAYAAAK  156 (260)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHC--CCC--------CCCCHHHHHHH
T ss_conf             87679988031999999999999849999999999999998399866999552214--688--------86508899999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-HHHHHHCCCCCCCCCCCC---------EE-CCHHHHHHHHHHHH
Q ss_conf             4555543200123---4567642034777789850-344431134543222110---------00-10247777999999
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-PFIKIRQKNSLRLVKKNQ---------VF-NRIRVEDVARCVIF  198 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-~~~~~~~g~~~~~~~~~~---------~~-~~ihv~Dva~~i~~  198 (289)
                      .+.+.+.+.++.+   +|+.+-.+-|+.+--|+-. ....+............+         .. -+.--+|+|+++.+
T Consensus       157 aal~~ltk~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iPlgR~g~peeiA~~v~F  236 (260)
T PRK06523        157 AALSTYSKSLSKEVAPKGVRVNRVSPGWIETEAAVALAERLAEAAGTDYEGAKQIIMDSLGGIPLGRPAEPEEVAELIAF  236 (260)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999997343929999964889875278899999876189989999999985278898897599999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |....    .|+++++-.|
T Consensus       237 L~Sd~s~~iTG~~i~VDGG  255 (260)
T PRK06523        237 LASDRAASITGTEYVIDGG  255 (260)
T ss_pred             HHCCHHCCEECCEEEECCC
T ss_conf             9484426860855788788


No 148
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=98.48  E-value=2.2e-06  Score=55.90  Aligned_cols=194  Identities=10%  Similarity=0.057  Sum_probs=108.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEE--EECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----56449828--9806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISP--FLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~--~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|.+|....|++++...    +...+...  +..|..+. ..+.       .....+|.
T Consensus        11 ~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~-~~v~~~v~~~~~~~G~iDi   89 (254)
T PRK08085         11 NILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKAHAAAFNVTHK-QEIEAAIEHIEKDIGPIDV   89 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCCE
T ss_conf             899968567899999999998699999996988999999999984498189998268999-9999999999998399869


Q ss_pred             EEEEECCCCCCCE------EE-CCCCCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             7876124443310------00-122101----------34432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEGDP------CI-ISMSKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~~~------~~-~~~~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++-......      .+ ..+..+          ....+  .+-.++|.+||.+-.  . +.        .....|
T Consensus        90 lVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~q~~~~~m~~~~~G~IInisS~~~~--~-~~--------~~~~~Y  158 (254)
T PRK08085         90 LINNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVARYMVKRQAGKIINICSMQSE--L-GR--------DTITPY  158 (254)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC--C-CC--------CCCHHH
T ss_conf             998986788877010989999999999849999999998599887399729999773014--4-78--------985678


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH-------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             45544555543200123---45676420347777898503-------444311345432221100010247777999999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP-------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~-------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +.+|.+.+.+.+..+.+   +++.+-.+-|+.+--|....       ..++....+.    +    -+-..+|+++++++
T Consensus       159 ~asKaai~~ltr~lA~e~a~~~IrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl----~----R~g~pedia~~~~f  230 (254)
T PRK08085        159 AASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPA----A----RWGDPQELIGAAVF  230 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHH
T ss_conf             999999999999999996727969999976889871021003799999999857998----8----98899999999999


Q ss_pred             HHCCC----CCCCEECCCCCH
Q ss_conf             95135----578616268433
Q gi|254780595|r  199 LMTHH----LGGIFNLSDDEP  215 (289)
Q Consensus       199 l~~~~----~~~iyni~~~~~  215 (289)
                      |....    -|+++++-.|.-
T Consensus       231 LaS~~ss~iTG~~i~VDGG~~  251 (254)
T PRK08085        231 LSSKASDFVNGHLLFVDGGML  251 (254)
T ss_pred             HHCCHHCCCCCCEEEECCCEE
T ss_conf             957522486587499889888


No 149
>PRK06196 oxidoreductase; Provisional
Probab=98.48  E-value=2.3e-06  Score=55.83  Aligned_cols=157  Identities=7%  Similarity=-0.024  Sum_probs=90.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH--CCCEEEECCCCCCCHHH------HHHHCCCCEEEEEE
Q ss_conf             3999888-888999999999889889999679446345564--49828980678640234------65411563278761
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH--KGISPFLFADQKINNLL------REKLYFTTHIVQCI   72 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~--~~~~~~~~~~~~~~~~~------~~~~~~~~~v~~~~   72 (289)
                      .++|||+ .=||...++.|.++|++|+...|+.++......  .+++.+..|..+....-      ......+|.+++++
T Consensus        28 ~~vITGa~sGIG~~tA~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~lDLs~~~sVr~~a~~~~~~~~~lDvLInNA  107 (316)
T PRK06196         28 TAIVTGGYSGLGLETTRALAQAGAHVVVPARRPDAAREALAGIDGVEVVALDLADLASVRAFAERFLDSGRRIDILINNA  107 (316)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             89991799679999999999789989999499999999998741785798368899999999999997579832999578


Q ss_pred             CCCCCCCEE----E-CCCCCH----------HHHHHH--CCCCCCCCCCEEECCCC--CCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             244433100----0-122101----------344320--12334333320102576--2123453211234311345544
Q gi|254780595|r   73 KPSSEGDPC----I-ISMSKD----------FYKFMP--HVKWIGYLSSTSIYGNR--EGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        73 ~~~~~~~~~----~-~~~~~~----------~~~~~~--~~~~~i~~SS~~VYg~~--~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      +-.......    + ..+..|          +...+.  ...|+|++||..-+...  .+. ++-+.+..|...|+.+|+
T Consensus       108 Gi~~~~~~~t~dG~E~~~~vN~lg~flLt~lLlp~L~~~~~~RIV~vSS~~h~~~~i~~~d-~~~~~~y~~~~aY~~SKl  186 (316)
T PRK06196        108 GVMACPETRVGDGWEAQFATNHLGHFALVNLLWPALAAGAGARVVAVSSLGHRRSPIRWDD-VHFERGYDKWLAYGQSKT  186 (316)
T ss_pred             CCCCCCCEEECCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECHHHHCCCCCCCC-CCCCCCCCCHHHHHHHHH
T ss_conf             7678875353455577665541228789999889975368977999713776438876445-465678982799999899


Q ss_pred             HHHHHHHHCC---CCCCCCCCCCCCCCCC
Q ss_conf             5555432001---2345676420347777
Q gi|254780595|r  134 NAEKEWLAIT---KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       134 ~~E~~~~~~~---~~~~~~~~ilR~~~iy  159 (289)
                      +.--..++++   +..|+.+..+.|+.|.
T Consensus       187 anilft~~La~rl~~~gI~v~avhPG~v~  215 (316)
T PRK06196        187 ANALFAVHLDKLGADQGVRAFSVHPGGIA  215 (316)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             99999999999836899489997377315


No 150
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=98.47  E-value=5.5e-07  Score=59.39  Aligned_cols=144  Identities=10%  Similarity=-0.001  Sum_probs=84.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCE-EEEEECCHHHH-------HHHHHCCC--EEEECCCCCCCHH---HH---HHHCC
Q ss_conf             3999888-88899999999988988-99996794463-------45564498--2898067864023---46---54115
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVY-TCGTTRSVSNL-------LTLKHKGI--SPFLFADQKINNL---LR---EKLYF   64 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~-V~~~~r~~~~~-------~~l~~~~~--~~~~~~~~~~~~~---~~---~~~~~   64 (289)
                      -+||||+ +=||..++++|.++|.+ |..+.|++.+.       ..+...+.  ..+..|..+....   +.   +....
T Consensus         2 tvlITGas~GIG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   81 (181)
T pfam08659         2 TYLVTGGLGGLGLELARWLAERGARHLVLLSRSGAPDPEAEALLAELEARGAEVTVVACDVSDRDAVAALLAEIRADGPP   81 (181)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             89996878789999999999879978999868976629999999999965996999975689999999888657987398


Q ss_pred             CCEEEEEECCCCCC---CEEECC----CCCHH------HHHH--HCCCCCCCCCCEEE-CCCCCCCCCCCCCCCCCCCHH
Q ss_conf             63278761244433---100012----21013------4432--01233433332010-257621234532112343113
Q gi|254780595|r   65 TTHIVQCIKPSSEG---DPCIIS----MSKDF------YKFM--PHVKWIGYLSSTSI-YGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        65 ~~~v~~~~~~~~~~---~~~~~~----~~~~~------~~~~--~~~~~~i~~SS~~V-Yg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +|.++|+++-....   +.....    +..++      .+..  ....++|++||.+- +|..            ....|
T Consensus        82 id~lvnnAG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~~~~~IV~iSS~ag~~g~~------------~~~~Y  149 (181)
T pfam08659        82 LRGVIHAAGVLRDALLANMTAEDFARVLAPKVTGAWNLHEATRDRPLDFFVLFSSIAGVLGSP------------GQANY  149 (181)
T ss_pred             EEEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCHHHCCCCC------------CCHHH
T ss_conf             489995446678856888289999999999989999999996510344000230076647899------------94899


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             455445555432001234567642034777
Q gi|254780595|r  129 ATQRFNAEKEWLAITKKLNIKLAVLRLSGI  158 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~~~~~~~ilR~~~i  158 (289)
                      +.+|...+.+.+++. ..|+++..+-|+.|
T Consensus       150 ~AsKa~l~~la~~l~-~~Girvn~iapG~i  178 (181)
T pfam08659       150 AAANAFLDALAHYRR-AQGLPATSINWGPW  178 (181)
T ss_pred             HHHHHHHHHHHHHHH-HCCCCEEEEECCCC
T ss_conf             999999999999998-65992999858876


No 151
>PRK07806 short chain dehydrogenase; Provisional
Probab=98.46  E-value=1.2e-05  Score=51.69  Aligned_cols=201  Identities=14%  Similarity=0.067  Sum_probs=105.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HH----HHHHHCCCEE--EECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-88899999999988988999967944-63----4556449828--9806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NL----LTLKHKGISP--FLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~----~~l~~~~~~~--~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      .+||||+ .=||..++++|.++|++|....|+.. ..    ..+...+.+.  +..|..+. +.+.       +....+|
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~~~~~Dvtd~-~~v~~l~~~~~~~~G~iD   86 (248)
T PRK07806          8 IALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRASAVGADLTDE-ASVAALMDAIRAEFGGLD   86 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHCCCCC
T ss_conf             8999378859999999999987998999838956899999999996198399997899999-999999999999849998


Q ss_pred             EEEEEECCCCCC----CEEECC-C------CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC-CCHHHHHHHH
Q ss_conf             278761244433----100012-2------101344320123343333201025762123453211234-3113455445
Q gi|254780595|r   67 HIVQCIKPSSEG----DPCIIS-M------SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP-ISCVATQRFN  134 (289)
Q Consensus        67 ~v~~~~~~~~~~----~~~~~~-~------~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P-~~~y~~~k~~  134 (289)
                      .+++.++.....    +..... .      .+.....+..-.++|++||....-      +.- .+..| ...|+.+|.+
T Consensus        87 iLVnNAg~~~~~~~~~~~~~~~n~~~~~~~~~~~~p~m~~gg~Ii~isS~~~~~------~~~-~~~~p~~~~y~asK~A  159 (248)
T PRK07806         87 ALVLNASGGMESGMDPDYAMRLNRDAQRRLLTLALPLMPAGSRVVFVTSHQAHF------IPT-VKTMPEYEAVAASKRA  159 (248)
T ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHC------CCC-CCCCCCCHHHHHHHHH
T ss_conf             999899998778997226899998999999999997750497899985516615------687-7778662899999999


Q ss_pred             HHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCH-HHHHHCCC--CCCCCCCCCEECCHHHHHHHHHHHHHHCCC--CCC
Q ss_conf             5554320012---345676420347777898503-44431134--543222110001024777799999995135--578
Q gi|254780595|r  135 AEKEWLAITK---KLNIKLAVLRLSGIYGPKRNP-FIKIRQKN--SLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGG  206 (289)
Q Consensus       135 ~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~-~~~~~~g~--~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~--~~~  206 (289)
                      .+.+.+..+.   .+|+.+.++-|+.+-+|-... +.......  ....+-+    -+--.+|+|.++.++...+  -|+
T Consensus       160 ~~~~~~~la~ela~~gIrvn~v~pg~i~t~~~~~~~~~~~~~~~~~~~~p~g----R~g~pediA~av~fLas~~~~TGq  235 (248)
T PRK07806        160 GEDALRALRPELAHAGIGFVVVSGDMIEGTVTATLLNRLNPGAIDARRAAAG----KLYTVSEFAAEVARAVTAPVPAGH  235 (248)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHCCCCHHHHHHHHCCCC----CCCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             9999999999977659889997279878514444323724468987506778----998989999999999579989999


Q ss_pred             CEECCCCC
Q ss_conf             61626843
Q gi|254780595|r  207 IFNLSDDE  214 (289)
Q Consensus       207 iyni~~~~  214 (289)
                      +.++-.+.
T Consensus       236 ti~VdGG~  243 (248)
T PRK07806        236 IVYVGGAD  243 (248)
T ss_pred             EEEECCHH
T ss_conf             89988778


No 152
>PRK07831 short chain dehydrogenase; Provisional
Probab=98.46  E-value=1.9e-06  Score=56.34  Aligned_cols=193  Identities=13%  Similarity=0.078  Sum_probs=104.0

Q ss_pred             EEEEECC-CH-HHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHC-C---CEEEECCCCCCCHHHH-------HHHCC
Q ss_conf             3999888-88-8999999999889889999679446345----5644-9---8289806786402346-------54115
Q gi|254780595|r    2 HLMIFGA-GY-TGKFIADAALKVGVYTCGTTRSVSNLLT----LKHK-G---ISPFLFADQKINNLLR-------EKLYF   64 (289)
Q Consensus         2 kIlI~Ga-G~-iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~-~---~~~~~~~~~~~~~~~~-------~~~~~   64 (289)
                      ++||||+ |- ||..+++.|.+.|.+|....|+.++...    +... +   +..+..|..+. ..+.       +....
T Consensus        18 valVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~-~~v~~~v~~~~~~~G~   96 (261)
T PRK07831         18 VVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSE-AQVDALIDAAVERLGR   96 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCC
T ss_conf             499949996478999999999879989998087777899999999843877289997568999-9999999999998299


Q ss_pred             CCEEEEEECCCCCCC----------EEECCC-------CCHHHHHHHC---CCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             632787612444331----------000122-------1013443201---23343333201025762123453211234
Q gi|254780595|r   65 TTHIVQCIKPSSEGD----------PCIISM-------SKDFYKFMPH---VKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        65 ~~~v~~~~~~~~~~~----------~~~~~~-------~~~~~~~~~~---~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      +|.++++++-.....          ..+...       .+.....+..   -.++|.+||.+-+  ..         ..+
T Consensus        97 iDiLVNNAG~~~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~gG~IinisS~~~~--~~---------~~~  165 (261)
T PRK07831         97 LDVLVNNAGLGGQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMRAAPHGGVIVNNASVLGW--RA---------QHS  165 (261)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCC--CC---------CCC
T ss_conf             8699988866899881449999999986132151999999999999976999789845440305--67---------887


Q ss_pred             CCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHH
Q ss_conf             31134554455554320012---3456764203477778985------03444311345432221100010247777999
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~  195 (289)
                      ...|+.+|.....+.+..+.   .+|+.+-.+-|+.+..|..      ..+..+....+.        --+...+|+|++
T Consensus       166 ~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~t~~~~~~~~~~~~~~~~~~~p~--------gR~g~pediA~~  237 (261)
T PRK07831        166 QAHYAAAKAGVMALTRCSAIEAAEYGVRINAVAPSIARHKFLKKVTSAELLDRLASGEAF--------GRAAEPWEVAAV  237 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHCCCCHHHHHHHHCCCCC--------CCCCCHHHHHHH
T ss_conf             436899999999999999999845290899995587677022213999999998707997--------897599999999


Q ss_pred             HHHHHCCC----CCCCEECCCCC
Q ss_conf             99995135----57861626843
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~~  214 (289)
                      +.+|....    -|++..+..+.
T Consensus       238 v~fLaSd~s~~iTGq~i~V~gg~  260 (261)
T PRK07831        238 IAFLASDYSSYLTGEVVSVSSQH  260 (261)
T ss_pred             HHHHHCHHHCCCCCEEEEECCCC
T ss_conf             99995815469757388988997


No 153
>PRK06841 short chain dehydrogenase; Provisional
Probab=98.46  E-value=4.5e-06  Score=54.16  Aligned_cols=193  Identities=10%  Similarity=0.013  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH---HCCCEEEECCCCCCCHH---H---HHHHCCCCEEEEE
Q ss_conf             3999888-88899999999988988999967944634556---44982898067864023---4---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK---HKGISPFLFADQKINNL---L---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~---~~~~~~~~~~~~~~~~~---~---~~~~~~~~~v~~~   71 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+......   ......+..|..+.+..   +   .+....+|.++++
T Consensus        17 valVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~g~iDiLVNN   96 (255)
T PRK06841         17 VAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAAQLLGGNAKGLVCDVSDSQSVEAAVAAAISAFGRIDILVNS   96 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             99997967789999999999879999999698789999998459966999984699999999999999981998799989


Q ss_pred             ECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433---100012----21013----------4432--012334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++-....   +-....    ...++          ...+  .+-.++|.+||.+-.-   +        ......|+.+|
T Consensus        97 AGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IInisS~~~~~---~--------~~~~~~Y~asK  165 (255)
T PRK06841         97 AGVALLAPAEDVSEADWDKTIDINLKGSFLMAQAVGRHMIAAGGGKIVNLASQAGVV---A--------LERHVAYCASK  165 (255)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC---C--------CCCCHHHHHHH
T ss_conf             978999980449999999999985599999999999999982996599994666566---8--------99858899999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CC-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             4555543200123---45676420347777898-50-----344431134543222110001024777799999995135
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RN-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
                      .....+.+..+.+   +|+.+-.+-|+.|--|- +.     ...+++...+.    +    -+-..+|+|+++++|....
T Consensus       166 aav~~ltrslA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~Pl----~----R~g~pediA~~v~fLaSd~  237 (255)
T PRK06841        166 AGVVGMTKVLALEWGPHGITVNAISPTVVLTELGKKAWAGEKGERAKKLIPA----G----RFAYPEEIAAAALFLASDA  237 (255)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHCCH
T ss_conf             9999999999999703095999985388977034332474889999855999----9----9778999999999996873


Q ss_pred             ----CCCCEECCCC
Q ss_conf             ----5786162684
Q gi|254780595|r  204 ----LGGIFNLSDD  213 (289)
Q Consensus       204 ----~~~iyni~~~  213 (289)
                          -|+++.+-.|
T Consensus       238 ss~iTG~~i~VDGG  251 (255)
T PRK06841        238 AAMITGENLVIDGG  251 (255)
T ss_pred             HCCCCCCEEEECCC
T ss_conf             23855870895868


No 154
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=98.45  E-value=4.6e-06  Score=54.12  Aligned_cols=193  Identities=13%  Similarity=0.072  Sum_probs=103.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH--HHHHHHCCC--EEEECCCCCCCH---HH---HHHHCCCCEEEE
Q ss_conf             3999888-888999999999889889999679446--345564498--289806786402---34---654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN--LLTLKHKGI--SPFLFADQKINN---LL---REKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~--~~~l~~~~~--~~~~~~~~~~~~---~~---~~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.++|++|++..++..+  ...+...+.  ..+..|..+.+.   .+   ......+|.+++
T Consensus        12 ~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~G~iDilVn   91 (253)
T PRK08993         12 VAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIEQVTALGRRFLSLTADLRKIDGIPALLERAVAEFGHIDILVN   91 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             89993887689999999999879999995587749999999965995799980379999999999999998499729998


Q ss_pred             EECCCCCCCE---EECC----CCCH----------HHH-HHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6124443310---0012----2101----------344-320--123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGDP---CIIS----MSKD----------FYK-FMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~~---~~~~----~~~~----------~~~-~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++.....+.   ....    ...+          +.. ...  +..++|++||...+-..           .....|+.
T Consensus        92 nAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~~~~~~~~G~IvnisS~~~~~~~-----------~~~~~Y~a  160 (253)
T PRK08993         92 NAGLIRREDAIEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGG-----------IRVPSYTA  160 (253)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCC-----------CCCHHHHH
T ss_conf             9977889980129999999999988544356678768999972778852389861003688-----------98656799


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             544555543200123---456764203477778985034-------4431134543222110001024777799999995
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +|...+.+.+..+.+   +|+.+-.+-|+.+-.+.-..+       ..+...    ++-    --+..-+|+|+++.+|.
T Consensus       161 sKaal~~ltr~lA~e~a~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~----~p~----~R~g~peeiA~~v~fL~  232 (253)
T PRK08993        161 SKSGVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDR----IPA----GRWGLPSDLMGPVVFLA  232 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHC----CCC----CCCCCHHHHHHHHHHHH
T ss_conf             9999999999999996233959999964878677554303798999999955----999----99819999999999995


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    .|+++.+-.|
T Consensus       233 S~~a~~iTG~~i~VDGG  249 (253)
T PRK08993        233 SSASDYINGYTIAVDGG  249 (253)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84322825853898957


No 155
>PRK07904 short chain dehydrogenase; Provisional
Probab=98.45  E-value=4.7e-06  Score=54.06  Aligned_cols=183  Identities=10%  Similarity=0.058  Sum_probs=95.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCC-EEEEEECCHH-HH----HHHHHCCC---EEEECCCCCCCH---HHHHHH--CCCC
Q ss_conf             3999888-8889999999998898-8999967944-63----45564498---289806786402---346541--1563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGV-YTCGTTRSVS-NL----LTLKHKGI---SPFLFADQKINN---LLREKL--YFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~-~V~~~~r~~~-~~----~~l~~~~~---~~~~~~~~~~~~---~~~~~~--~~~~   66 (289)
                      .|||||| .=||..++++++++|+ .|....|+.+ ..    ..+...+.   ..+.+|..+.+.   .+....  ..+|
T Consensus        10 tvlITGassGIG~a~a~~~~~~g~~~v~l~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~~~~~i~~~~~~~~id   89 (253)
T PRK07904         10 TILLLGGTSEIGLAICERYLRNAPARVVLAALPDDPRRDAAVAQMKAAGASSVEVIDFDALDTDSHPKVIDAAFAGGDVD   89 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             89993565099999999999749898999978973269999999985499718999556679899999999998549935


Q ss_pred             EEEEEECCCCCCCEEEC-------CCCCHHHH----------HH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             27876124443310001-------22101344----------32--0123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEGDPCII-------SMSKDFYK----------FM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~~~~~~-------~~~~~~~~----------~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++.+++.....+....       ...-++..          .+  .+-.++|.+||.+-+  ..       .  .....
T Consensus        90 v~i~~aG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~Iv~isSvag~--~~-------~--~~~~~  158 (253)
T PRK07904         90 VAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLGEKMRAQGFGQIIAMSSAAGE--RV-------R--RSNFV  158 (253)
T ss_pred             EEEECCCCCCCCHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC--CC-------C--CCCCH
T ss_conf             9996244567825540229999999989949999999999999975499869996660003--67-------9--99726


Q ss_pred             HHHHHHHHHHH---HHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             34554455554---320012345676420347777898503444311345432221100010247777999999951355
Q gi|254780595|r  128 VATQRFNAEKE---WLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       128 y~~~k~~~E~~---~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      |+.+|......   +......+|+.++.+.|+.|-    ..|+.-... .       .  -.+-.+|+|+.++..++++.
T Consensus       159 Y~ASKaal~~f~~~L~~el~~~gIrV~~V~PG~V~----T~mt~~~~~-~-------p--~~~~~e~vA~~i~~ai~~~k  224 (253)
T PRK07904        159 YGSTKAGLDGFYLGLGEALREYGVRVLVIRPGQVR----TRMSADVKE-A-------P--LTVDKEDVANLAVTAVAKGK  224 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC----CCCCCCCCC-C-------C--CCCCHHHHHHHHHHHHHCCC
T ss_conf             88999999999999999847728889999727886----765689998-9-------9--76899999999999998599


Q ss_pred             CCCEE
Q ss_conf             78616
Q gi|254780595|r  205 GGIFN  209 (289)
Q Consensus       205 ~~iyn  209 (289)
                      ..+|-
T Consensus       225 ~~i~~  229 (253)
T PRK07904        225 ELVWA  229 (253)
T ss_pred             CEEEC
T ss_conf             69994


No 156
>PRK08339 short chain dehydrogenase; Provisional
Probab=98.45  E-value=2.2e-06  Score=55.89  Aligned_cols=201  Identities=13%  Similarity=0.032  Sum_probs=106.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHC---CCEEEECCCCCCCHHHHH------HHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----5644---982898067864023465------4115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHK---GISPFLFADQKINNLLRE------KLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~---~~~~~~~~~~~~~~~~~~------~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.+.|++|+.+.|+.++...    +...   .+..+..|..+. ..+..      .....|.
T Consensus        10 ~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~-~~v~~~~~~~~~~g~~di   88 (263)
T PRK08339         10 LAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESDVEVHYIVADLTKR-EDLERTVKELKNIGDPDI   88 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCE
T ss_conf             8999162609999999999986999999979889999999999850498579998489999-999999999995699989


Q ss_pred             EEEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78761244433---100012----21013----------4432--01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++.....   +.....    ...++          ...+  .+-.++|++||.+...           +......|
T Consensus        89 lv~nag~~~~~~~~~~~~e~w~~~~~vnl~~~~~~~~~~~p~m~~~~~G~II~isS~a~~~-----------~~~~~~~y  157 (263)
T PRK08339         89 FFFSTGGPKPGYFMEMSMEDWEEAVKLLLYPAVYLTRALVPGMERKGFGRIIYSTSVAIKE-----------PIPNIALS  157 (263)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCHHHH
T ss_conf             9989999999891559999999999998699999999998765243896399955424347-----------89861778


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH-HHHHH--CCCCC-----CCCCCCCEECCHHHHHHHHHHH
Q ss_conf             45544555543200123---45676420347777898503-44431--13454-----3222110001024777799999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP-FIKIR--QKNSL-----RLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~-~~~~~--~g~~~-----~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      +.+|...+.+.+..+.+   +|+.+-.+.|+.|..|.-.. .....  .+...     ...+.-..--+..-+|+|+++.
T Consensus       158 ~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~  237 (263)
T PRK08339        158 NVVRIAMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAQDRARREGKSVEEALQEYAKPIPLGRLGEPEEIGYLVA  237 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999999999711197999995287987236667565776528988999999970799999859999999999


Q ss_pred             HHHCCC----CCCCEECCCCC
Q ss_conf             995135----57861626843
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~~  214 (289)
                      +|....    -|+++++-.|.
T Consensus       238 fL~Sd~a~~itG~~i~VDGG~  258 (263)
T PRK08339        238 FLASDLGSYINGAMIPVDGGR  258 (263)
T ss_pred             HHHCCHHCCCCCCEEEECCCC
T ss_conf             982944268148628988981


No 157
>PRK06172 short chain dehydrogenase; Provisional
Probab=98.44  E-value=5.7e-06  Score=53.60  Aligned_cols=192  Identities=12%  Similarity=0.030  Sum_probs=104.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCE--EEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----5644982--89806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGIS--PFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~--~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+....    +...+.+  .+..|..+ ...+.       +....+|.
T Consensus         9 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~-~~~v~~~~~~~~~~~G~iDi   87 (253)
T PRK06172          9 VALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEALFIACDVTR-DAEVKALVEKTIAAYGRLDY   87 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHHHCCCCCE
T ss_conf             89993757689999999999879989999798899999999999649937999818999-99999999999998299999


Q ss_pred             EEEEECCCCCCCE----EECCCC----CHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             7876124443310----001221----013----------4432--0123343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEGDP----CIISMS----KDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~~~----~~~~~~----~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++-.....+    ......    .++          ...+  .+-.++|.+||..-..   +        ......
T Consensus        88 LVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~g~~---~--------~~~~~~  156 (253)
T PRK06172         88 AFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPLMLAQGGGAIVNTASVAGLG---A--------APKMSI  156 (253)
T ss_pred             EEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCC---C--------CCCCHH
T ss_conf             99898889999990139999999999997399999999999999985995899976666476---8--------999778


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCH-------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             345544555543200123---45676420347777898-503-------4443113454322211000102477779999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNP-------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~-------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      |+.+|.....+.+..+.+   +++++-.+-|+.|--|- +..       ..++....+.        --+-..+|+|+++
T Consensus       157 Y~asKaal~~ltr~lA~e~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~pediA~~v  228 (253)
T PRK06172        157 YAASKHAVIGLTKSAAIEYAKKGIRVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPV--------GRIGKVEEIANAV  228 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHH
T ss_conf             99999999999999999863318789999779798757764421899999999737998--------9985999999999


Q ss_pred             HHHHCCCC----CCCEECCCC
Q ss_conf             99951355----786162684
Q gi|254780595|r  197 IFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       197 ~~l~~~~~----~~iyni~~~  213 (289)
                      ++|.....    |+++.+-.|
T Consensus       229 ~FLaSd~a~~iTG~~i~VDGG  249 (253)
T PRK06172        229 LYLCSDGASFTTGHSLMVDGG  249 (253)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999385326825982873924


No 158
>PRK07576 short chain dehydrogenase; Provisional
Probab=98.44  E-value=4.3e-06  Score=54.30  Aligned_cols=193  Identities=12%  Similarity=0.111  Sum_probs=104.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCCEE--EECCCCCCCH------HHHHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----556449828--9806786402------346541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGISP--FLFADQKINN------LLREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~~~--~~~~~~~~~~------~~~~~~~~~~~v   68 (289)
                      ++||||+ +=||..+++.|.++|.+|....|+.++..    .+...+...  +..|..+.+.      ...+....+|.+
T Consensus        10 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiL   89 (260)
T PRK07576         10 NVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPEALGVSADVRDYAAVEAAFAAIADEFGPIDVL   89 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995896199999999999879999999798899999999999539948999931899999999999999984999899


Q ss_pred             EEEECCCCCC---CEEECCCC----CHH----------HHHHH-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             8761244433---10001221----013----------44320-123343333201025762123453211234311345
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISMS----KDF----------YKFMP-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~~----~~~----------~~~~~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++++.....   +.....+.    .++          ...++ .-.++|.+||...+-.           ......|+.
T Consensus        90 VnnAg~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~p~m~~~~G~IInisS~~~~~~-----------~~~~~~y~a  158 (260)
T PRK07576         90 VSGAAGNFPAPAAGMSANGFKTVVDIDLLGTFNVLKAAYPLLRRPGASIIQISAPQAVVA-----------MPMQAHVCA  158 (260)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCCC-----------CCCHHHHHH
T ss_conf             989867899891559999999999986463899999999998717977999988211367-----------887189999


Q ss_pred             HHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC-C-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             54455554320012---3456764203477778985-0-------34443113454322211000102477779999999
Q gi|254780595|r  131 QRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR-N-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       131 ~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r-~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      +|.....+.+.++.   .+++++-.+-|+.|..+.. .       ....+.+..+..        -+---+|++.++.+|
T Consensus       159 sKaav~~ltk~lA~e~a~~gIrVN~IaPG~i~~t~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pedia~~v~FL  230 (260)
T PRK07576        159 AKAGVDMLTRTLALEWGPEGVRVNSISPGPIAGTEGMARLAPTPELQAAVAQSVPLK--------RNGTGQDIANAALFL  230 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHHHHH
T ss_conf             999999999999999713392999983477578366663279999999998479999--------986999999999999


Q ss_pred             HCCCC----CCCEECCCC
Q ss_conf             51355----786162684
Q gi|254780595|r  200 MTHHL----GGIFNLSDD  213 (289)
Q Consensus       200 ~~~~~----~~iyni~~~  213 (289)
                      .....    |+++.+-.+
T Consensus       231 ~Sd~s~~iTG~~i~VDGG  248 (260)
T PRK07576        231 ASDMASYITGVVLPVDGG  248 (260)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             587424825861887939


No 159
>PRK07074 short chain dehydrogenase; Provisional
Probab=98.43  E-value=2e-06  Score=56.17  Aligned_cols=191  Identities=14%  Similarity=0.108  Sum_probs=103.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCEEEECCCCCCCH--HHH---HHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455----64498289806786402--346---541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----KHKGISPFLFADQKINN--LLR---EKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||+.++++|.+.|.+|....|+.++...+    ....+..+..|..+.+.  .+.   .....+|.+++.
T Consensus         4 valITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~i~~~g~iDiLVNN   83 (256)
T PRK07074          4 TALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVDALGDAAVAPVICDLTDAASVERLAAALANEGPVDVLVAN   83 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89998846899999999999869999999798899999999826997799997279999999999999985998799988


Q ss_pred             ECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433---100012----21013----------4432--012334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++.....   +.....    +..++          ...+  .+-.++|++||.+-++.     .       +...|+.+|
T Consensus        84 AG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~-----~-------~~~~Y~asK  151 (256)
T PRK07074         84 AGAARAATLHDTTSASWRADNALNLEATYLCVEAVEAGMKARSRGAIVNIGSVNGMAA-----L-------GHPAYSAAK  151 (256)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-----C-------CCHHHHHHH
T ss_conf             8778998915599999999999985999999999999998759976999966565676-----8-------857899999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC--------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             4555543200123---4567642034777789850--------3444311345432221100010247777999999951
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN--------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~--------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .....+.+.++.+   .|+.+-.+-|+.|-.|...        .+..+.+..+.    +    -+.-.+|+|+++.+|..
T Consensus       152 aal~~ltk~lA~e~~~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~~~~~Pl----~----R~g~pedIA~~v~FLaS  223 (256)
T PRK07074        152 AGLISYTKSLAIEYGRFGIRANAVCPGTVKTQAWEARVAANPQVFEELKKWYPL----Q----DFATPDDVANAVLFLAS  223 (256)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHC
T ss_conf             999999999999964249799998427798736664322499999999847998----8----98699999999999958


Q ss_pred             CC----CCCCEECCC
Q ss_conf             35----578616268
Q gi|254780595|r  202 HH----LGGIFNLSD  212 (289)
Q Consensus       202 ~~----~~~iyni~~  212 (289)
                      ..    -|+++.+-.
T Consensus       224 ~~as~iTG~~i~VDG  238 (256)
T PRK07074        224 PAARAITGVCLPVDG  238 (256)
T ss_pred             CHHCCCCCCEEEECC
T ss_conf             053593587388588


No 160
>PRK09730 hypothetical protein; Provisional
Probab=98.41  E-value=1e-05  Score=52.09  Aligned_cols=193  Identities=13%  Similarity=0.100  Sum_probs=101.7

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEEC-CHHHHH----HHHHCCCEE--EECCCCCCCHH------HHHHHCCC
Q ss_conf             93-999888-88899999999988988999967-944634----556449828--98067864023------46541156
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTR-SVSNLL----TLKHKGISP--FLFADQKINNL------LREKLYFT   65 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r-~~~~~~----~l~~~~~~~--~~~~~~~~~~~------~~~~~~~~   65 (289)
                      || .||||+ +=||..+++.|.++|++|....+ +.+...    .+...+...  +..|..+.+..      +.+....+
T Consensus         1 mKValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~~g~i   80 (247)
T PRK09730          1 MAIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQHDEPL   80 (247)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             97999906226999999999998799999966998789999999999749928999825899999999999999975995


Q ss_pred             CEEEEEECCCCCC---C-EEECCCC----CH----------HHHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             3278761244433---1-0001221----01----------344320-----1233433332010257621234532112
Q gi|254780595|r   66 THIVQCIKPSSEG---D-PCIISMS----KD----------FYKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFV  122 (289)
Q Consensus        66 ~~v~~~~~~~~~~---~-~~~~~~~----~~----------~~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~  122 (289)
                      |.++++++-....   + .......    .+          ....+.     ...++|.+||.+..  . +.       +
T Consensus        81 d~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~~~g~IVnisS~~~~--~-g~-------~  150 (247)
T PRK09730         81 AALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVASR--L-GS-------P  150 (247)
T ss_pred             EEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHC--C-CC-------C
T ss_conf             599989863568998133999999999999738999999999999999628999769998126546--5-89-------8


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHH
Q ss_conf             3431134554455554320012---3456764203477778985------034443113454322211000102477779
Q gi|254780595|r  123 HPISCVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVA  193 (289)
Q Consensus       123 ~P~~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva  193 (289)
                      .....|+.+|...+.+.+.++.   .+++.+-.+-|+.+.-+-.      ..+.++....+..        -+--.+|++
T Consensus       151 ~~~~~Y~asKaav~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pedia  222 (247)
T PRK09730        151 GEYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDRVKSNIPMQ--------RGGQAEEVA  222 (247)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHH
T ss_conf             412777999999999999999997054928999977889785432349969999998579989--------984999999


Q ss_pred             HHHHHHHCCCC----CCCEECC
Q ss_conf             99999951355----7861626
Q gi|254780595|r  194 RCVIFLMTHHL----GGIFNLS  211 (289)
Q Consensus       194 ~~i~~l~~~~~----~~iyni~  211 (289)
                      +++.+|.....    |++..+-
T Consensus       223 ~~v~fL~Sd~a~~iTGq~i~VD  244 (247)
T PRK09730        223 QAIVWLLSDKASYVTGSFIDLA  244 (247)
T ss_pred             HHHHHHHCCHHCCCCCCEEEEC
T ss_conf             9999996872248348347857


No 161
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=98.41  E-value=5.4e-06  Score=53.71  Aligned_cols=199  Identities=15%  Similarity=0.058  Sum_probs=105.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCE--EEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----5644982--89806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGIS--PFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~--~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.++...    +...+..  .+..|..+. ..+.       +....+|.
T Consensus        14 valVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~-~~v~~~v~~~~~~~G~iDi   92 (259)
T PRK08213         14 TALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDALWLAADVADE-ADIERLAEETLERFGHIDI   92 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHHCCCCE
T ss_conf             899948776899999999998699999997988999999999995499589998268999-9999999999998399989


Q ss_pred             EEEEECCCCCC---CEEECCC--------------CCHHHHH-H--HCCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCC
Q ss_conf             78761244433---1000122--------------1013443-2--012334333320102-576212345321123431
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIISM--------------SKDFYKF-M--PHVKWIGYLSSTSIY-GNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~~--------------~~~~~~~-~--~~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~  126 (289)
                      ++++++.....   +......              .+..... .  .+-.++|.+||.+-+ |...        ...+..
T Consensus        93 LVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~~m~~~~~G~IVnisS~ag~~g~~~--------~~~~~~  164 (259)
T PRK08213         93 LVNNAGATWGAPAEDHPVEAWDKVMNLNVRGTFLLSQAVAKRSMIPRGYGRIINVASIAGLGGNPP--------GSMDTI  164 (259)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCC--------CCCCHH
T ss_conf             998997788986456999999999988441199999999999998579945999935211667886--------541349


Q ss_pred             HHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCC-CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             134554455554320012---345676420347777898-5034443113454322211000102477779999999513
Q gi|254780595|r  127 CVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPK-RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~-r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      .|+.+|.....+.+..+.   .+|+.+-.+-|+.+--|- +..+....+.....++-+    -+-.-+|++.++.+|...
T Consensus       165 aY~asKaav~~ltr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~Pl~----R~g~peeia~~v~fLaSd  240 (259)
T PRK08213        165 AYNTSKGAVINFTRALAAEWGPHGIRVNAIAPGFFPTKMTRGTLERLGEELLAHTPLG----RLGDDEDLKGAALLLASD  240 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHHCC
T ss_conf             9999999999999999999610391999997798988552101499999998579999----991999999999999682


Q ss_pred             C----CCCCEECCCC
Q ss_conf             5----5786162684
Q gi|254780595|r  203 H----LGGIFNLSDD  213 (289)
Q Consensus       203 ~----~~~iyni~~~  213 (289)
                      .    -|+++.+-.|
T Consensus       241 ~as~iTG~~i~VDGG  255 (259)
T PRK08213        241 ASKHITGQILAVDGG  255 (259)
T ss_pred             HHCCCCCCEEEECCC
T ss_conf             535854871775836


No 162
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=98.40  E-value=8.9e-07  Score=58.19  Aligned_cols=72  Identities=19%  Similarity=0.286  Sum_probs=51.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC--------------HHHHHHHCCCC
Q ss_conf             9399988888899999999988988999967944634556449828980678640--------------23465411563
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN--------------NLLREKLYFTT   66 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~   66 (289)
                      |||-|+|.||+|..++..|.+.||+|+|+.-++++...+..... ++  .+....              .........+|
T Consensus         1 MkI~ViGlGyVGl~~a~~la~~G~~V~g~D~d~~~v~~ln~g~~-p~--~E~~l~~~l~~~~~~~~~~~~~~~~~i~~~d   77 (185)
T pfam03721         1 MRIAVIGLGYVGLPTAVCLAEIGHDVVGVDINQSKIDKLNNGKI-PI--YEPGLEELLKANVSGRLRFTTDVAEAIKEAD   77 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCC-CC--CCCCHHHHHHHHHCCCEEEECCHHHHHHHCC
T ss_conf             97999897874899999999489939999799899999862689-74--6758899998734089699878799884498


Q ss_pred             EEEEEECCC
Q ss_conf             278761244
Q gi|254780595|r   67 HIVQCIKPS   75 (289)
Q Consensus        67 ~v~~~~~~~   75 (289)
                      .++.|++-+
T Consensus        78 ~i~I~VpTP   86 (185)
T pfam03721        78 VIFIAVPTP   86 (185)
T ss_pred             EEEEECCCC
T ss_conf             999973687


No 163
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=98.40  E-value=3e-06  Score=55.21  Aligned_cols=193  Identities=11%  Similarity=0.093  Sum_probs=106.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---98289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++.......   ....+..|..+.+.   .+   ......+|.++++
T Consensus        11 ~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiLVNN   90 (251)
T PRK07523         11 RALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESLKGSAHTLAFDVTDHDAVRAAIDAFEAEIGPIDILVNN   90 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89995836699999999999879999999699899999999818872799995799999999999999975998699989


Q ss_pred             ECCCCCC-------CEEECCCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433-------10001221013----------4432--012334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG-------DPCIISMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~-------~~~~~~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++-....       +.....+..++          ...+  .+-.++|.+||....  .. .        .....|+.+|
T Consensus        91 AG~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~--~~-~--------~~~~~Y~asK  159 (251)
T PRK07523         91 AGMQHRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSA--LA-R--------PGIAPYTATK  159 (251)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC--CC-C--------CCCHHHHHHH
T ss_conf             88799999055999999999999739999999999899886399679999415760--76-8--------9947899999


Q ss_pred             HHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             455554320012---3456764203477778985034-------443113454322211000102477779999999513
Q gi|254780595|r  133 FNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       133 ~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      ...+.+.+..+.   .+|+.+-.+-|+.|--|-...+       .++.+..+.    +    -+-..+|+++++++|...
T Consensus       160 aav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl----g----R~g~peeia~~v~fLaSd  231 (251)
T PRK07523        160 GAVGNLTKGMATDWAKHGLQCNAIAPGYFDTPLNAALVADPEFSAWLEKRTPA----G----RWGKVEELVGACIFLASD  231 (251)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHHCC
T ss_conf             99999999999997020949999973789873243213899999999857999----9----978999999999999487


Q ss_pred             C----CCCCEECCCC
Q ss_conf             5----5786162684
Q gi|254780595|r  203 H----LGGIFNLSDD  213 (289)
Q Consensus       203 ~----~~~iyni~~~  213 (289)
                      .    -|+++.+-.|
T Consensus       232 ~s~~iTG~~i~VDGG  246 (251)
T PRK07523        232 ASSFVNGHVLYVDGG  246 (251)
T ss_pred             HHCCCCCCEEEECCC
T ss_conf             424826874880938


No 164
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=98.38  E-value=9.9e-07  Score=57.91  Aligned_cols=73  Identities=16%  Similarity=0.307  Sum_probs=54.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC---------------HHHHHHHCCC
Q ss_conf             9399988888899999999988988999967944634556449828980678640---------------2346541156
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN---------------NLLREKLYFT   65 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~---------------~~~~~~~~~~   65 (289)
                      |||-|+|.||+|..++..|.++||+|+|+.-++++...+..... ++.  +....               .........+
T Consensus         1 MkI~ViGlGyVGl~~a~~lA~~G~~V~g~D~d~~~i~~l~~g~~-p~~--E~gl~~ll~~~~~~~~l~~ttd~~~~i~~~   77 (411)
T TIGR03026         1 MKIAVIGLGYVGLPLAALLADLGHEVTGVDIDQEKVDKLNKGKS-PIY--EPGLDELLAKALAAGRLRATTDYEDAIRDA   77 (411)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCC-CCC--CCCHHHHHHHHHHCCCEEEECCHHHHHHHC
T ss_conf             97999897877999999999489948999899999999977989-978--989899999998639979987889987209


Q ss_pred             CEEEEEECCCC
Q ss_conf             32787612444
Q gi|254780595|r   66 THIVQCIKPSS   76 (289)
Q Consensus        66 ~~v~~~~~~~~   76 (289)
                      |.++.|++-+.
T Consensus        78 dii~I~V~TP~   88 (411)
T TIGR03026        78 DVIIICVPTPL   88 (411)
T ss_pred             CEEEEECCCCC
T ss_conf             99999768986


No 165
>PRK07478 short chain dehydrogenase; Provisional
Probab=98.37  E-value=1e-05  Score=52.19  Aligned_cols=195  Identities=13%  Similarity=0.080  Sum_probs=105.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----564498--289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.++...    +...+.  ..+..|..+ ...+.       +....+|.
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~~~~~~Dvt~-~~~v~~~v~~~~~~~G~iDi   86 (254)
T PRK07478          8 VAIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEAVALAGDVRD-EAYAKALVALAVERFGGLDI   86 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHHHHCCCCE
T ss_conf             79995887689999999999879999999798899999999999649908999768999-99999999999998499989


Q ss_pred             EEEEECCCCCCCEE----ECCC----CCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433100----0122----1013----------4432--0123343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEGDPC----IISM----SKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~~~~----~~~~----~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++-.....+.    ....    ..++          ...+  .+-.++|++||..-+  ..+.        .....
T Consensus        87 LVNNAG~~~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~g~--~~g~--------~~~~~  156 (254)
T PRK07478         87 AFNNAGILGEMGPVPELSLEGWRETLATNLTSAFLGAKHQIPAMLARGGGSLIFTSTFVGH--TAGF--------PGMAA  156 (254)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC--CCCC--------CCCHH
T ss_conf             9988743689989144999999999999869999999999999988699879998436643--3688--------97356


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             345544555543200123---4567642034777789850-------344431134543222110001024777799999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      |+.+|.....+.+..+.+   +++.+-.+-|+.+.-|-..       ....+....+        .--+-.-+|+|++++
T Consensus       157 Y~asKaav~~lTr~lA~E~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~p--------l~R~g~peeiA~~v~  228 (254)
T PRK07478        157 YAASKAGLIGLTQVLAAEYGARGIRVNALLPGGTDTPMGRAAADTPEALAFVAGLHA--------LKRMAQPEEIAQAAL  228 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHCCCC--------CCCCCCHHHHHHHHH
T ss_conf             798899999999999998570385999997798988757642599999999862899--------889839999999999


Q ss_pred             HHHCCC----CCCCEECCCCCH
Q ss_conf             995135----578616268433
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDDEP  215 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~~~  215 (289)
                      +|....    -|+++.+-.|-.
T Consensus       229 FLaSd~ss~iTG~~i~VDGG~s  250 (254)
T PRK07478        229 FLASDAASFVTGTALLADGGVS  250 (254)
T ss_pred             HHHCCHHCCCCCCEEEECCCEE
T ss_conf             9958432384497588788973


No 166
>PRK06701 short chain dehydrogenase; Provisional
Probab=98.36  E-value=2.6e-05  Score=49.82  Aligned_cols=193  Identities=11%  Similarity=0.074  Sum_probs=107.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH-----HHHHHCCCEE--EECCCCCCC---HHH---HHHHCCCCE
Q ss_conf             3999888-8889999999998898899996794463-----4556449828--980678640---234---654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL-----LTLKHKGISP--FLFADQKIN---NLL---REKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~-----~~l~~~~~~~--~~~~~~~~~---~~~---~~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++.     ..++..+...  +..|..+..   ..+   .+....+|.
T Consensus        47 valVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G~~~~~~~~Dv~d~~~v~~~v~~~~~~fG~iDi  126 (289)
T PRK06701         47 VALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEGVKCLLIPGDVSDEQFCKDAVEETVRELGRLDI  126 (289)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89996825799999999999879989998289467899999999963990899984789999999999999998599989


Q ss_pred             EEEEECCCCCCCEEE--------CCCCCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             787612444331000--------122101----------34432012334333320102576212345321123431134
Q gi|254780595|r   68 IVQCIKPSSEGDPCI--------ISMSKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        68 v~~~~~~~~~~~~~~--------~~~~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      ++++++......+..        ..+..+          ....++.-..+|.+||.+.+....           ....|+
T Consensus       127 LVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~~~~p~m~~gg~IInisS~~~~~g~~-----------~~~~Y~  195 (289)
T PRK06701        127 LVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTKAALPHLKPGSAIINTGSITGYEGNE-----------TLIDYS  195 (289)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCEECCCCC-----------CHHHHH
T ss_conf             998883467888724499999999974521789999999999973497799950121525788-----------407789


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             5544555543200123---456764203477778985------0344431134543222110001024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      .+|...+.+.+.++.+   +++.+-.+-|+.|.-+-.      ..+..+....+  +  +    -+-.-+|++.++++|.
T Consensus       196 asKaav~~ltk~LA~Ela~~gIrVNaIaPG~v~T~~~~~~~~~~~~~~~~~~~P--l--g----R~g~peDIA~~v~fLa  267 (289)
T PRK06701        196 ATKGAIHAFTRSLSQSLVQKGIRVNAVAPGPIWTPLIPSDFDEEKVSQFGSDTP--M--K----RPGQPEELAPAYVYLA  267 (289)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCC--C--C----CCCCHHHHHHHHHHHH
T ss_conf             999999999999999970339189899657887887656599999999985699--8--9----9809999999999995


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++.+-.|
T Consensus       268 Sd~ss~iTGq~i~VDGG  284 (289)
T PRK06701        268 SPDSSYITGQMLHVNGG  284 (289)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             74114854868996888


No 167
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=98.35  E-value=5.2e-06  Score=53.80  Aligned_cols=198  Identities=11%  Similarity=0.009  Sum_probs=105.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++...    ++..+.  ..+..|..+.+..      ..+....+|.+
T Consensus         5 valITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDil   84 (250)
T TIGR03206         5 TAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGPVDVL   84 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99996857689999999999879999999798899999999999539928999944899999999999999975999799


Q ss_pred             EEEECCCCCCC---EEECCC----CCH----------HHHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---000122----101----------34432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCIISM----SKD----------FYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~~----~~~----------~~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......   ......    ..+          ....+  .+-.++|++||..-..           +..+...|+
T Consensus        85 vnnAg~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~-----------~~~~~~~Y~  153 (250)
T TIGR03206        85 VNNAGWDKFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARV-----------GSSGEAVYA  153 (250)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHHH
T ss_conf             989888999890349999999999998299999999999999974991799965577576-----------899858899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCC-C----CCCCCCCEEC-CHHHHHHHHHHHHHH
Q ss_conf             5544555543200123---45676420347777898503444311345-4----3222110001-024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNS-L----RLVKKNQVFN-RIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~-~----~~~~~~~~~~-~ihv~Dva~~i~~l~  200 (289)
                      .+|.+...+.+..+.+   +|+.+-.+-|+.+--|   .+..+.+... .    .......... +...+|+|+++.+|.
T Consensus       154 asKaav~~ltk~lA~ela~~gIrVNaV~PG~i~T~---~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~~v~fL~  230 (250)
T TIGR03206       154 ACKGGLVAFSKTMAREHARHGITVNVVCPGPTDTA---LLDDICGGAENPEKLREAFTRAIPLGRLGQPDDLPGAILFFS  230 (250)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCH---HHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999996532918999976888867---789876443886999999984799899839999999999995


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++.+-.|
T Consensus       231 Sd~s~~itG~~i~VDGG  247 (250)
T TIGR03206       231 SDDASFITGQVLSVSGG  247 (250)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             83433845883886869


No 168
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.34  E-value=2.1e-05  Score=50.39  Aligned_cols=193  Identities=12%  Similarity=0.092  Sum_probs=102.0

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---CCCEEEECCCCCCCH---H---HHHHHCCCCEEE
Q ss_conf             3999888-8--88999999999889889999679446345564---498289806786402---3---465411563278
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVSNLLTLKH---KGISPFLFADQKINN---L---LREKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~---~~~~~~~~~~~~~~~---~---~~~~~~~~~~v~   69 (289)
                      .+||||| |  =||..+++.|.++|.+|....|+.+....+..   .....+..|..+.+.   .   ..+....+|.++
T Consensus         9 ~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iD~lV   88 (252)
T PRK06079          9 KIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKLVDEEDLLVECDVASDESIERAFAQIKERFGKIDGIV   88 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89998999987799999999998699999984887999999985088865999518999999999999999868887344


Q ss_pred             EEECCCCCC-------CEEECCCCC----H---HHH-------HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             761244433-------100012210----1---344-------3201233433332010257621234532112343113
Q gi|254780595|r   70 QCIKPSSEG-------DPCIISMSK----D---FYK-------FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        70 ~~~~~~~~~-------~~~~~~~~~----~---~~~-------~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      |+++.....       +........    +   ...       ..++-..+|.+||.+.+.   +        .-....|
T Consensus        89 nnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~g~Iv~iss~~~~~---~--------~p~~~~y  157 (252)
T PRK06079         89 HAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPLLNPPASIVTLTYFGSER---A--------IPNYNVM  157 (252)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCC---C--------CCCCCCH
T ss_conf             3320257310246444388999999998888999999988876403577067886440345---5--------7774101


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             45544555543200123---456764203477778985-------03444311345432221100010247777999999
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +.+|...+.+.+..+.+   +|+.+-.+.|+.|--+..       ..+.......    +.+    -+...+|+++++.+
T Consensus       158 ~aaKaal~~ltr~lA~ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~----p~g----r~~~peeia~~v~F  229 (252)
T PRK06079        158 GIAKAALESSVRYLARDLGKKGIRVNAISAGAIKTLAVTGIKGHGDLLKESDSRT----VDG----VSVTIEEVGNVAAF  229 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCC----CCC----CCCCHHHHHHHHHH
T ss_conf             7789999999999999984389899999637787701015667899999998579----989----99899999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |+...    -|+++.+-.|
T Consensus       230 L~Sd~a~~iTGq~i~VDGG  248 (252)
T PRK06079        230 LLSDLSTGVTGDIIYVDKG  248 (252)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9485416825972897949


No 169
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=98.34  E-value=1.5e-06  Score=56.83  Aligned_cols=198  Identities=16%  Similarity=0.121  Sum_probs=104.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHH---H---HHHHCCCCEEEEEECC
Q ss_conf             3999888-8889999999998898899996794463455644982898067864023---4---6541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL---L---REKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~---~---~~~~~~~~~v~~~~~~   74 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.+++....   ......+..|..+....   +   .+....+|.++++++-
T Consensus        11 valVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~~---~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAGi   87 (266)
T PRK06171         11 IIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDEK---HKGYQFWPTDISSAKEVNHTVAEIIERFGRIDGLVNNAGI   87 (266)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCC---CCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             7999477878999999999987999999978853505---8976999816999999999999999983998899988866


Q ss_pred             CCC---CC------------EEEC-CCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             443---31------------0001-221013----------4432--012334333320102576212345321123431
Q gi|254780595|r   75 SSE---GD------------PCII-SMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        75 ~~~---~~------------~~~~-~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ...   .+            ..+. .+..++          ...+  .+-.++|.+||.+-+-   +        .....
T Consensus        88 ~~~~~~~d~~~~~~~~e~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~---g--------~~~~~  156 (266)
T PRK06171         88 NFPRLLVDEKAPAGQYELNEAAFEKMVNINQKGVFLMSQAVARQMVKQHDGVIVNMSSEAGLE---G--------SEGQS  156 (266)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---C--------CCCCH
T ss_conf             765321244576654559999999999999499999999999999983995799805777567---8--------98758


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHH-HH-HH--CCCCCC-C------CCCCCEECCHHHHH
Q ss_conf             1345544555543200123---45676420347777898-5034-44-31--134543-2------22110001024777
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPF-IK-IR--QKNSLR-L------VKKNQVFNRIRVED  191 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~-~~-~~--~g~~~~-~------~~~~~~~~~ihv~D  191 (289)
                      .|+.+|.....+.+.++.+   +|+.+-.+-|+.|-.++ +.+. .. +.  .+.... .      ...-..--+-..+|
T Consensus       157 ~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~pee  236 (266)
T PRK06171        157 CYAATKAAVNSFTRSWAKELGKHGIRVVGVAPGILEATGLRTPEYEEALAYTRNITVEQLRAGYTKTSTIPLGRSGKLSE  236 (266)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCHHH
T ss_conf             99999999999999999998454959999831771665456701577765403665889998887765799889749999


Q ss_pred             HHHHHHHHHCCC----CCCCEECCCC
Q ss_conf             799999995135----5786162684
Q gi|254780595|r  192 VARCVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       192 va~~i~~l~~~~----~~~iyni~~~  213 (289)
                      +|+++.+|....    -|+++++-.+
T Consensus       237 iA~~v~fLaSd~as~iTG~~i~VDGG  262 (266)
T PRK06171        237 VADLVCYLLSERASYITGVTTNIAGG  262 (266)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999585525805862898788


No 170
>PRK06138 short chain dehydrogenase; Provisional
Probab=98.34  E-value=4.8e-06  Score=54.02  Aligned_cols=200  Identities=13%  Similarity=0.052  Sum_probs=104.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----C-CCEEEECCCCCCCHHHH-------HHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345564----4-98289806786402346-------541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----K-GISPFLFADQKINNLLR-------EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~-~~~~~~~~~~~~~~~~~-------~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.|+.+.......    . ....+..|..+. ..+.       .....+|.+
T Consensus         7 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~-~~v~~~~~~~~~~~G~iDiL   85 (252)
T PRK06138          7 VAIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAERVAAAIAAGGRAFARQGDVGSA-EAVEALVDFVAARWGRLDVL   85 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHHHHHHHHHHHCCCCCEE
T ss_conf             89994746799999999999879989999688789999999983799199999428999-99999999999982999899


Q ss_pred             EEEECCCCCCC---EEECC----CCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331---00012----21013----------44320--12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD---PCIIS----MSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~----~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++......   .....    +..++          ...+.  +-.++|.+||...+-   +.        .....|+
T Consensus        86 VNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~---~~--------~~~~~Y~  154 (252)
T PRK06138         86 VNNAGFGCGGTVVTTDEADWDAVMRVNVGGVFLWAKYAIPIMQRQGGGSIVNTASQLALA---GG--------RGRAAYV  154 (252)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---CC--------CCCHHHH
T ss_conf             989889999980109999999999999699999999999999981996799976566577---89--------9977899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHHHHHHCCCC-CCCCCCCCEE-CCHHHHHHHHHHHHHHCCC
Q ss_conf             5544555543200123---45676420347777898-503444311345-4322211000-1024777799999995135
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPFIKIRQKNS-LRLVKKNQVF-NRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~~~~~~g~~-~~~~~~~~~~-~~ihv~Dva~~i~~l~~~~  203 (289)
                      .+|.....+.+..+.+   +++.+-.+-|+.|--|- +..+........ .......... -+-.-+|+|+++.+|....
T Consensus       155 asKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedIA~~v~FL~Sd~  234 (252)
T PRK06138        155 ASKGAIASLTRAMALDHATDGIRVNAVAPGTIDTPYFRRIFARHADPEALREALRARHPMNRFGTAEEVAQAALFLASDE  234 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCH
T ss_conf             99999999999999986222919999975889973566776613897999999971799899788999999999996763


Q ss_pred             C----CCCEECCCC
Q ss_conf             5----786162684
Q gi|254780595|r  204 L----GGIFNLSDD  213 (289)
Q Consensus       204 ~----~~iyni~~~  213 (289)
                      .    |+++.+-.|
T Consensus       235 as~iTG~~i~VDGG  248 (252)
T PRK06138        235 SSFATGTTLVVDGG  248 (252)
T ss_pred             HCCCCCCEEECCCC
T ss_conf             25936874881853


No 171
>PRK12827 short chain dehydrogenase; Provisional
Probab=98.33  E-value=3.7e-06  Score=54.64  Aligned_cols=192  Identities=13%  Similarity=0.062  Sum_probs=102.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH----HHH----HHHCC--CEEEECCCCCCCH------HHHHHHCC
Q ss_conf             3999888-888999999999889889999679446----345----56449--8289806786402------34654115
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN----LLT----LKHKG--ISPFLFADQKINN------LLREKLYF   64 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~----~~~----l~~~~--~~~~~~~~~~~~~------~~~~~~~~   64 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.|+.++    ...    +...+  +..+..|..+.+.      ...+....
T Consensus         8 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~   87 (251)
T PRK12827          8 RVLITGGSGGLGRAIAVRLAADGADVIVLDIHPMRGRAEAEAVAALIEAAGGKALGLAFDVRDFAATRAALDAGVEEFGR   87 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             89996825589999999999879989998488853289999999999964984999990389999999999999998399


Q ss_pred             CCEEEEEECCCCCC---CEEECC----CCCH----------HH-HHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             63278761244433---100012----2101----------34-432--0123343333201025762123453211234
Q gi|254780595|r   65 TTHIVQCIKPSSEG---DPCIIS----MSKD----------FY-KFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        65 ~~~v~~~~~~~~~~---~~~~~~----~~~~----------~~-~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      +|.++++++-....   +.....    +..+          .. ...  ..-.++|.+||.+..-   +        ...
T Consensus        88 iDiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~---~--------~~~  156 (251)
T PRK12827         88 LDILVNNAGIATDAAFAELSIEEWDDVIDVNLDGFFNVTQAALPPMIRARRGGRIVNIASVAGVR---G--------NRG  156 (251)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC---C--------CCC
T ss_conf             97999899889999903499999999999985999999999999999838994699982533355---7--------898


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-----CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             311345544555543200123---456764203477778985-----034443113454322211000102477779999
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-----NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-----~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      ...|+.+|.....+.+..+.+   +|+.+-.+-|+.|--|-.     ....++.+..+.        --+-..+|+|+++
T Consensus       157 ~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~Pl--------~R~g~pediA~~v  228 (251)
T PRK12827        157 QVNYAASKAGLIGLTKTLANELAPRGITVNAVAPGAINTPMADNAAMTGGEHALNPVPV--------QRLGEPDEVAALV  228 (251)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHH
T ss_conf             68899999999999999999965049699999648898720110387699999847998--------8977899999999


Q ss_pred             HHHHCCC----CCCCEECCC
Q ss_conf             9995135----578616268
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSD  212 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~  212 (289)
                      .+|....    -|+++.+-.
T Consensus       229 ~fLaSd~s~~iTG~~i~VDG  248 (251)
T PRK12827        229 AFLVSDAASYVTGQVIPVDG  248 (251)
T ss_pred             HHHHCCHHCCCCCCEEEECC
T ss_conf             99958332496586487536


No 172
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=98.33  E-value=1.4e-05  Score=51.31  Aligned_cols=205  Identities=11%  Similarity=0.088  Sum_probs=104.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC---CEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-88899999999988988999967944634556449---8289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG---ISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~---~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||..+++.|+++|.+|..+.|+.++...+....   +..+..|..+.+.   .+   .+....+|.++++
T Consensus         7 valITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDiLVnN   86 (262)
T TIGR03325         7 VVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGDAVVGVEGDVRSLDDHKEAVARCVAAFGKIDCLIPN   86 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89990678789999999999879999999899899999998679967999845799999999999999984998889972


Q ss_pred             ECCCCCCCE--------EECCCC----CHHH-------HH----HHCCCCCCCC-CCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             124443310--------001221----0134-------43----2012334333-3201025762123453211234311
Q gi|254780595|r   72 IKPSSEGDP--------CIISMS----KDFY-------KF----MPHVKWIGYL-SSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        72 ~~~~~~~~~--------~~~~~~----~~~~-------~~----~~~~~~~i~~-SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++......+        ....+.    .++.       +.    .+.-..+|.. |+.+.++..            ....
T Consensus        87 AG~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~g~iI~~~S~~~~~~~~------------~~~~  154 (262)
T TIGR03325        87 AGIWDYSTALVDIPDDRIDEAFDEVFHINVKGYLLAVKAALPALVASRGSVIFTISNAGFYPNG------------GGPL  154 (262)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC------------CCHH
T ss_conf             6516877643458624149999999999749999999999999997098189998710324889------------9668


Q ss_pred             HHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHH-HHHCCCCCCC-----CCCCCEEC-CHHHHHHHHHHHH
Q ss_conf             34554455554320012345--67642034777789850344-4311345432-----22110001-0247777999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFI-KIRQKNSLRL-----VKKNQVFN-RIRVEDVARCVIF  198 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~-~~~~g~~~~~-----~~~~~~~~-~ihv~Dva~~i~~  198 (289)
                      |+.+|.....+.+..+.+.+  +++-.+-|+.|.-|-+.... ..........     ........ +-..+|+|+++++
T Consensus       155 Y~asKaal~~ltr~lA~e~~~~IRVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeia~av~f  234 (262)
T TIGR03325       155 YTAAKHAVVGLVKELAFELAPYVRVNGVAPGGMSSDLRGPKSLGMADKSISTVPLGDMLKSVLPIGRMPDAEEYTGAYVF  234 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCHHHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999999975997899995378887986754431355542110589999707998998399999999999


Q ss_pred             HHCCC-----CCCCEECCCCCHHHHHH
Q ss_conf             95135-----57861626843333899
Q gi|254780595|r  199 LMTHH-----LGGIFNLSDDEPAPPQN  220 (289)
Q Consensus       199 l~~~~-----~~~iyni~~~~~~s~~e  220 (289)
                      ++...     -|+++++-.|  ++++-
T Consensus       235 L~s~~~s~~iTG~~l~VDGG--~~~~~  259 (262)
T TIGR03325       235 FATRGDTVPATGAVLNYDGG--MGVRG  259 (262)
T ss_pred             HCCCCHHCCEECCEEEECCC--CCCCE
T ss_conf             81980226945868897947--10673


No 173
>PRK08324 short chain dehydrogenase; Validated
Probab=98.33  E-value=1.3e-05  Score=51.47  Aligned_cols=200  Identities=12%  Similarity=0.051  Sum_probs=106.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----C-CCEEEECCCCCCCHHHH-------HHHCCCCEEE
Q ss_conf             999888-888999999999889889999679446345564----4-98289806786402346-------5411563278
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----K-GISPFLFADQKINNLLR-------EKLYFTTHIV   69 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~-~~~~~~~~~~~~~~~~~-------~~~~~~~~v~   69 (289)
                      +||||+ |=||..+++.|.++|.+|..+.|+.+.......    . ....+..|..+. ..+.       ....++|+++
T Consensus       424 ALVTGga~GIG~A~A~~fa~eGA~Vvl~D~~~~~l~~~a~el~~~~~~~~~~~DVtd~-~~v~~~v~~~~~~fGgIDiLV  502 (676)
T PRK08324        424 ALVTGAAGGIGLATAKRLAAEGACVVLADIDEEAAEAAAAELGGRDRALGVACDVTDE-AAVQAAFEEAALAFGGVDIVV  502 (676)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCH-HHHHHHHHHHHHHHCCCCEEE
T ss_conf             9994798816299999999879989999588899999999970799479998068999-999999999999859988899


Q ss_pred             EEECCCCCCC---EE---E-CCCCCHH----------HHHHH--C-CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             7612444331---00---0-1221013----------44320--1-2334333320102576212345321123431134
Q gi|254780595|r   70 QCIKPSSEGD---PC---I-ISMSKDF----------YKFMP--H-VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        70 ~~~~~~~~~~---~~---~-~~~~~~~----------~~~~~--~-~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      ++++-.....   ..   + ..+..++          ...+.  + -..+|++||....-  .         ......|+
T Consensus       503 nNAGi~~~~~~~e~s~e~w~~~~~vNl~g~f~~~r~a~p~M~~qg~GG~IV~isS~~a~~--~---------~~~~~aY~  571 (676)
T PRK08324        503 SNAGIALSGPIGETSDELWRRSFEVNFTGHFLVAREAVRIMKAQGTGGNLVFIASKNAVN--P---------GPNFGAYS  571 (676)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHC--C---------CCCCHHHH
T ss_conf             767778998826599999999998860999999999999999769991999982577526--7---------99968999


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCC-C---CCHHH-HHH-CCCCC-CCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             5544555543200123---4567642034777789-8---50344-431-13454-322211000102477779999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGP-K---RNPFI-KIR-QKNSL-RLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp-~---r~~~~-~~~-~g~~~-~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      .+|.+...+.+.++.+   +|+.+-.+-|+.|... +   ..... +.. .|... .....+-.--.+.-+|+|++++++
T Consensus       572 asKAAl~~Ltr~lA~Ela~~GIRVNaV~Pg~V~t~~~~~~~~~~~~ra~a~g~~~e~y~~~~~L~R~~~peDVA~av~fL  651 (676)
T PRK08324        572 AAKAAELHLVRQYALELGPDGIRVNGVNPDAVRSGSGIWTGEWIEARAAAYGLSEEEYMARNLLKREVTPEDVAEAFVFL  651 (676)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999999997122969999857964778755773346888875599989996059889967899999999998


Q ss_pred             HCCC----CCCCEECCCCC
Q ss_conf             5135----57861626843
Q gi|254780595|r  200 MTHH----LGGIFNLSDDE  214 (289)
Q Consensus       200 ~~~~----~~~iyni~~~~  214 (289)
                      ....    .|.++.+-.|.
T Consensus       652 ASd~ss~iTG~~l~VDGG~  670 (676)
T PRK08324        652 ASDLLAKTTGAIITVDGGN  670 (676)
T ss_pred             HCCHHCCCCCCEEEECCCH
T ss_conf             4807429268877858686


No 174
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.33  E-value=2.9e-05  Score=49.53  Aligned_cols=193  Identities=12%  Similarity=0.060  Sum_probs=100.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHH-CC--CEEEECCCCCCC---HHHHH---HHC-CCCEEE
Q ss_conf             3999888-88899999999988988999967944-6345564-49--828980678640---23465---411-563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NLLTLKH-KG--ISPFLFADQKIN---NLLRE---KLY-FTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~~~l~~-~~--~~~~~~~~~~~~---~~~~~---~~~-~~~~v~   69 (289)
                      .+||||+ +=||..+++.|.++|++|+...|+.+ ....+.. .+  ...+..|..+.+   ..+..   ... .+|.++
T Consensus         8 ~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~~idilV   87 (254)
T PRK08642          8 IVLVTGGSRGLGAAIARAFAREGARVVVNYHRSEDAAEALADELGDRAIAIQADVTDRNQVDAMFATATEHFGKPITTVV   87 (254)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99997811199999999999879999996189889999999981994699980699999999999999999499776998


Q ss_pred             EEECCCCC--------CCE-EECCCC----CHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             76124443--------310-001221----013----------4432--0123343333201025762123453211234
Q gi|254780595|r   70 QCIKPSSE--------GDP-CIISMS----KDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        70 ~~~~~~~~--------~~~-~~~~~~----~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      +++.....        .+. ......    .++          ...+  ....++|++||....           .|..|
T Consensus        88 nnA~~~~~~~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~~~m~~~~~G~IinisS~~~~-----------~~~~~  156 (254)
T PRK08642         88 NNALADFSFDGDARPKAEDITWEDFQQQLEGAVKGALNTIQAALPGMRERGFGRIINIGTNLFQ-----------NPVVP  156 (254)
T ss_pred             ECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHC-----------CCCCC
T ss_conf             6764224568766689345999999999999999999999999997787489966886003315-----------88876


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHH
Q ss_conf             311345544555543200123---456764203477778985------03444311345432221100010247777999
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~  195 (289)
                      ...|+.+|...+.+.+.++.+   +|+.+-.+-|+.+--+..      .....+.+..+..        -+.-.+|++++
T Consensus       157 ~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pedia~~  228 (254)
T PRK08642        157 YHDYTAAKAALLSLTRTLAADLGPYGITVNMVSGGLLRTTDASAATPEEVFDLIAATTPLR--------RVTTPQEFADA  228 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHH
T ss_conf             0377899999999999999997133969988745554676655569899999998479989--------99599999999


Q ss_pred             HHHHHCCC----CCCCEECCCC
Q ss_conf             99995135----5786162684
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~  213 (289)
                      +.+|....    -|++.++-.|
T Consensus       229 v~fL~S~~as~iTGq~i~VDGG  250 (254)
T PRK08642        229 VLFFASPWSRAVTGQNLVVDGG  250 (254)
T ss_pred             HHHHHCCHHCCEECCEEEECCC
T ss_conf             9999481536820874896708


No 175
>PRK07062 short chain dehydrogenase; Provisional
Probab=98.32  E-value=1e-05  Score=52.08  Aligned_cols=201  Identities=14%  Similarity=0.116  Sum_probs=104.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHC--C--CEEEECCCCCCCHH---HH---HHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----5644--9--82898067864023---46---5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHK--G--ISPFLFADQKINNL---LR---EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~--~--~~~~~~~~~~~~~~---~~---~~~~~~~   66 (289)
                      .+||||+ +=||..++++|++.|.+|....|+.++...    +...  +  +..+..|..+....   +.   +....+|
T Consensus        10 ~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iD   89 (265)
T PRK07062         10 VAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPGARLLAARCDVLDEADVAAFAAAVEARFGGVD   89 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89995757799999999999879999999798899999999998736996599997579999999999999999839988


Q ss_pred             EEEEEECCCCCC---CEEE----CCCCCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             278761244433---1000----1221013-------44320-----123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEG---DPCI----ISMSKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~---~~~~----~~~~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++.....   +...    ..+..++       .+..+     .-.++|.+||...+           .|......
T Consensus        90 iLVnNAg~~~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~-----------~~~~~~~~  158 (265)
T PRK07062         90 MLVNNAGQGRVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLLRASAAPSITCVNSLLAL-----------QPEPHMVA  158 (265)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC-----------CCCCCCHH
T ss_conf             8997788889888487999999999987214589999999999996299629999344235-----------78999689


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCC-CCHHHHHHC-CCCC-CC-----CCCCCEEC-CHHHHHHHHH
Q ss_conf             34554455554320012---345676420347777898-503444311-3454-32-----22110001-0247777999
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPK-RNPFIKIRQ-KNSL-RL-----VKKNQVFN-RIRVEDVARC  195 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~-r~~~~~~~~-g~~~-~~-----~~~~~~~~-~ihv~Dva~~  195 (289)
                      |+.+|.....+.+..+.   .+|+.+-.+.|+.|..|. +..+..... +... .+     ....-... +.-.+|++.+
T Consensus       159 Y~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iPl~R~g~peevA~~  238 (265)
T PRK07062        159 TSAARAGLLNLVKSLATELAPEGVRVNSILLGLVESGQWRRRYEARADPGLSWEAWTAALARKKGIPLGRFGRPDEAARA  238 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             99999999999999999976649399989608587724543313202545578999999887469998897689999999


Q ss_pred             HHHHHCCC----CCCCEECCCC
Q ss_conf             99995135----5786162684
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~  213 (289)
                      +.+|....    -|+...+-.|
T Consensus       239 v~fLaS~~s~~iTG~~i~VDGG  260 (265)
T PRK07062        239 LFFLASPLSSYTTGSHIDVSGG  260 (265)
T ss_pred             HHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999687325735842798978


No 176
>PRK05866 short chain dehydrogenase; Provisional
Probab=98.30  E-value=3.7e-06  Score=54.66  Aligned_cols=181  Identities=12%  Similarity=0.096  Sum_probs=98.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCC--CEEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634556----449--82898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKG--ISPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~--~~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .+||||| .=||..+++.|.++|++|+.+.|+.++...+.    ..+  ...+..|..+.+..      ..+....+|.+
T Consensus        42 vaLITGassGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL  121 (290)
T PRK05866         42 RILLTGASSGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGDAMAIPCDLSDLDAVDALVADVEERIGGVDIL  121 (290)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89990813099999999999869989999899999999999999649908999778898999999999999985998889


Q ss_pred             EEEECCCC-----CCCEEECC----CCCHHHH-------HH-----HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             87612444-----33100012----2101344-------32-----0123343333201025762123453211234311
Q gi|254780595|r   69 VQCIKPSS-----EGDPCIIS----MSKDFYK-------FM-----PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        69 ~~~~~~~~-----~~~~~~~~----~~~~~~~-------~~-----~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      +++++-..     +..+.+.+    +.-|+..       ..     .+-.++|.+||.+++...        .|.  ...
T Consensus       122 VNNAG~~~~~~~~~~~~~~~d~~~~~~vN~~g~~~l~~~~lp~M~~~~~G~IVnisS~~~~~~~--------~p~--~~~  191 (290)
T PRK05866        122 INNAGRSIRRPLAESLDRWHDVERTMVLNYYAPLRLIRGLAPGMIERGDGHIINVATWGVLSEA--------SPL--FSV  191 (290)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCC--------CCC--CCH
T ss_conf             9757666787422215779999999999839999999875099996699649999272432788--------988--641


Q ss_pred             HHHHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             345544555543200---12345676420347777898503444311345432221100010247777999999951355
Q gi|254780595|r  128 VATQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL  204 (289)
Q Consensus       128 y~~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~  204 (289)
                      |+.+|.+...+.+..   ...+|+.+..+-|+.|-    .+|..   ...  ..   .....+--+++|+.++..+.+..
T Consensus       192 Y~ASKaAl~~lt~sLa~El~~~gIrVn~V~PG~V~----Tpm~a---~~~--~~---~~~~~~~pe~~A~~iv~a~~~r~  259 (290)
T PRK05866        192 YNASKAALSAVSRVIETEWGDRGVHSTTLYYPLVA----TPMIA---PTK--AY---DGLPALTADEAAEWMVTAARTRP  259 (290)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----CCCCC---CCC--CC---CCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             89999999999999999852619699999768898----75679---887--76---78888999999999999984498


No 177
>PRK12743 acetoin dehydrogenase; Provisional
Probab=98.30  E-value=9.2e-06  Score=52.39  Aligned_cols=192  Identities=12%  Similarity=0.015  Sum_probs=104.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEEC-CHHHH----HHHHHCCCEE--EECCCCCCC------HHHHHHHCCCCEE
Q ss_conf             999888-88899999999988988999967-94463----4556449828--980678640------2346541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTR-SVSNL----LTLKHKGISP--FLFADQKIN------NLLREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r-~~~~~----~~l~~~~~~~--~~~~~~~~~------~~~~~~~~~~~~v   68 (289)
                      +||||+ +=||..++..|.++|++|....+ +.+..    ..+...+...  +..|..+.+      ....+....+|.+
T Consensus         5 alITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDil   84 (253)
T PRK12743          5 AIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLGRLDVL   84 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99907588999999999998799899974899799999999999459918999904899999999999999981999899


Q ss_pred             EEEECCCCCCC-------EEECCCCCH----------HHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             87612444331-------000122101----------34432-0--1233433332010257621234532112343113
Q gi|254780595|r   69 VQCIKPSSEGD-------PCIISMSKD----------FYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        69 ~~~~~~~~~~~-------~~~~~~~~~----------~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +++++......       .....+..+          ....+ +  ...++|++||...+-..           .....|
T Consensus        85 VNnAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~k~~~~G~IVnisS~~~~~~~-----------~~~~~Y  153 (253)
T PRK12743         85 VNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHMVKQGQGGRIINITSVHEHTPL-----------PDASAY  153 (253)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCCC-----------CCCHHH
T ss_conf             989989999980029999999999998599999999999999975899638999636655788-----------985899


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             45544555543200123---4567642034777789850-----344431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|...+.+.+..+.+   +|+.+-.+-|+.|--|-..     .........+  +      --+...+|+++++.+|.
T Consensus       154 ~asKaal~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~iP--l------~R~g~pedia~~v~fL~  225 (253)
T PRK12743        154 TAAKHALGGLTKAMALELVEHKILVNAVAPGAIATPMNGMDDSDVKPDAEPSIP--L------RRPGHTHEIASLVAWLC  225 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCC--C------CCCCCHHHHHHHHHHHH
T ss_conf             999999999999999997021929999964889877666787779999985799--8------99849999999999993


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++++-.|
T Consensus       226 Sd~s~yiTG~~i~VDGG  242 (253)
T PRK12743        226 SEGASYTTGQSLIVDGG  242 (253)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             85225825864897868


No 178
>PRK08643 acetoin reductase; Validated
Probab=98.30  E-value=1.4e-05  Score=51.34  Aligned_cols=200  Identities=13%  Similarity=0.030  Sum_probs=104.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEE--EECCCCCCCHH------HHHHHCCCCEEE
Q ss_conf             999888-888999999999889889999679446345----56449828--98067864023------465411563278
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISP--FLFADQKINNL------LREKLYFTTHIV   69 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~--~~~~~~~~~~~------~~~~~~~~~~v~   69 (289)
                      +||||+ +=||..+++.|.++|++|....|+.+....    +...+...  +..|..+.++.      .......+|.++
T Consensus         5 alVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDiLV   84 (256)
T PRK08643          5 ALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFGDLNVVV   84 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99957578899999999998799999996988999999999985399099998058999999999999999829987999


Q ss_pred             EEECCCCCC----------CEEEC-CC------CCHHHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             761244433----------10001-22------10134432-0--12334333320102576212345321123431134
Q gi|254780595|r   70 QCIKPSSEG----------DPCII-SM------SKDFYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        70 ~~~~~~~~~----------~~~~~-~~------~~~~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      ++++-....          +..+. +.      .+...... +  +-.++|.+||.+.+-..           .....|+
T Consensus        85 NnAG~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~-----------~~~~~Y~  153 (256)
T PRK08643         85 NNAGLAPTTPIDTITEEQFKKVYGINVGGVIWGIQAAQEQFKKLGHGGKIINATSQAGVEGN-----------PGLSVYG  153 (256)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHCCCC-----------CCCHHHH
T ss_conf             89988999882559999999999997636899999999999982899279998321013589-----------9848999


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-CHHHHHHCC--CCCCCCC----CCCE-ECCHHHHHHHHHHHH
Q ss_conf             5544555543200123---456764203477778985-034443113--4543222----1100-010247777999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-NPFIKIRQK--NSLRLVK----KNQV-FNRIRVEDVARCVIF  198 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~~~~~~~~g--~~~~~~~----~~~~-~~~ihv~Dva~~i~~  198 (289)
                      .+|.....+.+..+.+   +|+.+-.+-|+.|-.|-- .......+.  .+.....    .... --+..-+|+++++.+
T Consensus       154 asKaav~~ltkslA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~ipl~R~g~pedia~~v~f  233 (256)
T PRK08643        154 STKFAVRGLTQTAARDLASEGITVNAYAPGIVKTPMMFDIAHEVGENAGKPDEWGMEQFAKDITLKRLSEPEDVANVVSF  233 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999998775918999960668870456677887876289758999999835999998689999999999


Q ss_pred             HHCCCC----CCCEECCCC
Q ss_conf             951355----786162684
Q gi|254780595|r  199 LMTHHL----GGIFNLSDD  213 (289)
Q Consensus       199 l~~~~~----~~iyni~~~  213 (289)
                      |.....    |++..+-.|
T Consensus       234 L~S~~s~~iTG~~i~VDGG  252 (256)
T PRK08643        234 LAGPDSDYITGQTIIVDGG  252 (256)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9593536935875996638


No 179
>PRK11559 garR tartronate semialdehyde reductase; Provisional
Probab=98.30  E-value=3.4e-06  Score=54.89  Aligned_cols=97  Identities=14%  Similarity=0.099  Sum_probs=68.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCE
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124443310
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDP   80 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   80 (289)
                      |||=++|.|-+|+.+++.|++.||+|++.+|++++...+...+...        .....+....+|.|+.|++.......
T Consensus         2 MkIgfIGlG~MG~~ma~~L~~~G~~v~v~dr~~~~~~~l~~~Ga~~--------~~s~~e~~~~~dvvi~~l~~~~~v~~   73 (295)
T PRK11559          2 MKVGFIGLGIMGKPMSKNLLKAGYSLVVYDRNPEAIADVIAAGAET--------ASTAKAIAEQCDVIITMLPNSPHVKE   73 (295)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCC--------CCCHHHHHHCCCEEEEECCCCCCHHH
T ss_conf             7899984057699999999978995899929999999999859920--------39999998438878996689810776


Q ss_pred             EECCCCCHHHHHHHCCCCCCCCCCEE
Q ss_conf             00122101344320123343333201
Q gi|254780595|r   81 CIISMSKDFYKFMPHVKWIGYLSSTS  106 (289)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~i~~SS~~  106 (289)
                      ++..- ..+......-+-+|=.||++
T Consensus        74 v~~g~-~gi~~~~~~g~iiid~sT~~   98 (295)
T PRK11559         74 VALGE-NGIIEGAKPGTVLIDMSSIA   98 (295)
T ss_pred             HHHCC-CCCHHCCCCCCEEEECCCCC
T ss_conf             63077-66011389998899899999


No 180
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=98.29  E-value=3.4e-06  Score=54.89  Aligned_cols=68  Identities=19%  Similarity=0.192  Sum_probs=52.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             939998888889999999998898899996794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||.|+|.|.||..|+..|.++|++|+|..|+++........++......+      + ..+..+|.|+.|.++.
T Consensus         2 mkI~IiGlGLIGgSla~al~~~~~~V~g~d~~~~~~~~A~~~g~id~~~~~------~-~~~~~aDliila~Pv~   69 (280)
T PRK07417          2 MNIGIVGLGLIGGSLGLDLRSLGHTVYGVSRRESTCERAIERGLVDEASTD------L-SLLKDCDLVILALPIG   69 (280)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEECCC------H-HHHCCCCEEEECCCHH
T ss_conf             789999318579999999996899799997999999999986997520278------7-4605799899879747


No 181
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=98.29  E-value=7.6e-06  Score=52.87  Aligned_cols=194  Identities=16%  Similarity=0.089  Sum_probs=104.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEE--EECCCCCCC---HHH---HHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----56449828--980678640---234---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISP--FLFADQKIN---NLL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~--~~~~~~~~~---~~~---~~~~~~~~~v   68 (289)
                      .+||||+ +=||..+++.|.++|.+|....|+.++...    +...+...  +..|..+..   ..+   .+....+|.+
T Consensus        13 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDil   92 (255)
T PRK06113         13 CAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAVSKLGKVDIL   92 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995887789999999999879999999698899999999999659908999836899999999999999981998899


Q ss_pred             EEEECCCCCC--CEEECCCC----CHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             8761244433--10001221----0134-------4320-----123343333201025762123453211234311345
Q gi|254780595|r   69 VQCIKPSSEG--DPCIISMS----KDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        69 ~~~~~~~~~~--~~~~~~~~----~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++.++.....  |.......    .++.       +..+     +-.++|.+||.+...           +......|+.
T Consensus        93 VnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~-----------~~~~~~~Y~a  161 (255)
T PRK06113         93 VNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAEN-----------KNINMTSYAS  161 (255)
T ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCC-----------CCCCCHHHHH
T ss_conf             98788789987759999999999996499999999999988871896799984465468-----------8998520899


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCH-----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             544555543200123---45676420347777898-503-----444311345432221100010247777999999951
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNP-----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~-----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      +|.+...+.+..+.+   +++.+-.+=|+.|--+. +..     ...+.+..+        .--+-.-+|+|+++.+|..
T Consensus       162 sKaav~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~P--------l~R~g~pediA~~v~fL~S  233 (255)
T PRK06113        162 SKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTP--------IRRLGQPQDIANAALFLCS  233 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999982649499998648898702220179999999985799--------8898299999999999948


Q ss_pred             CC----CCCCEECCCCC
Q ss_conf             35----57861626843
Q gi|254780595|r  202 HH----LGGIFNLSDDE  214 (289)
Q Consensus       202 ~~----~~~iyni~~~~  214 (289)
                      ..    -|+++.+-.|.
T Consensus       234 ~~a~~itG~~i~VDGG~  250 (255)
T PRK06113        234 PAASWVSGQILTVSGGG  250 (255)
T ss_pred             CHHCCCCCCEEEECCCC
T ss_conf             14279668869957896


No 182
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=98.29  E-value=4.9e-06  Score=53.96  Aligned_cols=76  Identities=17%  Similarity=0.161  Sum_probs=61.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCE
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124443310
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDP   80 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   80 (289)
                      |||=++|.|-+|+.+++.|+++||+|++..|++++...+...+....        ..+.+....+|.|+.|++.....+.
T Consensus         2 ~~Ig~IGlG~MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g~~~~--------~s~~e~~~~~dvIi~~l~~~~~v~~   73 (163)
T pfam03446         2 AKIGFIGLGVMGSPMALNLLKAGYTVTVYNRTPEKVEELVAEGAVAA--------ASPAEAAASADVVITMVPAGAAVDA   73 (163)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEC--------CCHHHHHHCCCEEEEECCCHHHHHE
T ss_conf             88999836798999999999779969999797887799998399553--------9999998619999992587145402


Q ss_pred             EECC
Q ss_conf             0012
Q gi|254780595|r   81 CIIS   84 (289)
Q Consensus        81 ~~~~   84 (289)
                      ++..
T Consensus        74 V~~~   77 (163)
T pfam03446        74 VIFG   77 (163)
T ss_pred             EECC
T ss_conf             2026


No 183
>PRK06484 short chain dehydrogenase; Validated
Probab=98.29  E-value=3.1e-05  Score=49.43  Aligned_cols=190  Identities=11%  Similarity=0.089  Sum_probs=99.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-CC--CEEEECCCCCCCHH---H---HHHHCCCCEEEEE
Q ss_conf             3999888-888999999999889889999679446345564-49--82898067864023---4---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KG--ISPFLFADQKINNL---L---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-~~--~~~~~~~~~~~~~~---~---~~~~~~~~~v~~~   71 (289)
                      .++|||+ +=||..+++.|.++|++|....|+.+....... .+  ...+..|..+....   +   .+....+|.++++
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLVNN   86 (530)
T PRK06484          7 VVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAERLGSRHVALQLDVSDEAQVEHAMDGLLQQFGRIDVLVNN   86 (530)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             99997836689999999999879999999688899999999709971799984899999999999999972999899989


Q ss_pred             ECCCCCC----CEEECCCC----CH----------HHHHH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             1244433----10001221----01----------34432-012334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEG----DPCIISMS----KD----------FYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~----~~~~~~~~----~~----------~~~~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++-....    +.......    .|          ....+ ++-..+|.+||.+-+-   +        ......|+.+|
T Consensus        87 AGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gg~IInisS~~g~~---~--------~~~~~~Y~asK  155 (530)
T PRK06484         87 AGIGPTMRATLDTPLEDFDRAIAVNLEGPYLVAREALRLMGRHGAAIVNVASLAGLV---A--------NPKRAAYSASK  155 (530)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCC---C--------CCCCHHHHHHH
T ss_conf             989988986100999999999998729999999999998776257389998331045---7--------99968899999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH--------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             4555543200123---456764203477778985034--------44311345432221100010247777999999951
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF--------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~--------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .....+.+..+.+   +++.+-.+-|+.|--|--..+        .++.+..+.    +    -+=.-+|+|+++.+|..
T Consensus       156 aal~~lTkslA~Ela~~gIRVNaVaPG~I~T~m~~~~~~~~~~~~~~~~~~iPl----g----R~g~PeeiA~~v~FLaS  227 (530)
T PRK06484        156 AGVISLTRSLACELAPKGIRVNAVAPGYVRTEMVAELERAGKLDRSAVRGRIPM----G----RLARPDEIAEAVHFLAS  227 (530)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHCCHHHHHHHHCCCCC----C----CCCCHHHHHHHHHHHCC
T ss_conf             999999999999863409499999637888711433310564479999717998----8----87899999999999768


Q ss_pred             CCC----CCCEEC
Q ss_conf             355----786162
Q gi|254780595|r  202 HHL----GGIFNL  210 (289)
Q Consensus       202 ~~~----~~iyni  210 (289)
                      ...    |+++.+
T Consensus       228 d~asyITG~~i~V  240 (530)
T PRK06484        228 AQASYITGSTLVV  240 (530)
T ss_pred             HHHCCCCCCEEEE
T ss_conf             3325888987998


No 184
>PRK07814 short chain dehydrogenase; Provisional
Probab=98.29  E-value=3.9e-05  Score=48.83  Aligned_cols=192  Identities=14%  Similarity=0.040  Sum_probs=103.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCE--EEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----5644982--89806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGIS--PFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~--~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .+||||+ +=||..++..|.++|.+|....|+.++...    +...+..  .+..|..+. +.+.       +....+|.
T Consensus        12 valITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~-~~v~~~v~~~~~~~G~iDi   90 (263)
T PRK07814         12 VAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHP-EATAGLAGQAVEAFGRLDI   90 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCCE
T ss_conf             899958966899999999998799899996989999999999985299289998158999-9999999999998299889


Q ss_pred             EEEEECCCCCC---CEEE----CCCCCH----------HHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433---1000----122101----------34432-0--123343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEG---DPCI----ISMSKD----------FYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~----~~~~~~----------~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++.....   +...    ..+..+          ....+ +  ...++|.+||...+-  .         ......
T Consensus        91 LVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IInisS~~~~~--~---------~~~~~~  159 (263)
T PRK07814         91 VVNNVGGTMPNPLLSTSTKDLADAFTFNVATAHALTRAAVPLMLEHSGGGSIINITSTMGRL--A---------GRGFAA  159 (263)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC--C---------CCCCHH
T ss_conf             99898667888445488999999999971999999999999999847994699981265477--8---------998488


Q ss_pred             HHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCC-------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             34554455554320012345--6764203477778985-------03444311345432221100010247777999999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKR-------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r-------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      |+.+|...+.+.+..+.+.+  +.+-.+-|+.+--+.-       .....+.+..+.        --+-..+|+|+++++
T Consensus       160 Y~asKaal~~ltk~lA~e~a~~IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~pedia~~v~F  231 (263)
T PRK07814        160 YGTAKAALAHYTRLAALDLCPRIRVNAIAPGSILTSALEVVAANDELRAPMEKATPL--------RRLGDPEDIAAAAVY  231 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHH
T ss_conf             999999999999999999779978999977988860454325999999999857998--------898099999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |....    -|++..+-.|
T Consensus       232 L~Sd~s~~iTG~~i~VDGG  250 (263)
T PRK07814        232 LASPAGSYLTGKTLEVDGG  250 (263)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9484325944882886879


No 185
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.29  E-value=3.5e-05  Score=49.06  Aligned_cols=193  Identities=12%  Similarity=0.108  Sum_probs=99.2

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHHHH---HHHH----HCCCEEEECCCCCCCHH------HHHHHCCC
Q ss_conf             3999888-8--889999999998898899996794463---4556----44982898067864023------46541156
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVSNL---LTLK----HKGISPFLFADQKINNL------LREKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~~~---~~l~----~~~~~~~~~~~~~~~~~------~~~~~~~~   65 (289)
                      .++|||| |  =||..+++.|.++|.+|....|+....   ..+.    ......+..|..+....      +.+....+
T Consensus         8 ~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~i   87 (256)
T PRK08594          8 TYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGERLEKEVRELAETLEQQESLVLPCDVTSDEEITACFETIKKEVGVI   87 (256)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89998999996399999999998799999974880669999999987079947999913899999999999999985886


Q ss_pred             CEEEEEECCCCCC-------CEEECCC----CCH---HH-------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             3278761244433-------1000122----101---34-------4320123343333201025762123453211234
Q gi|254780595|r   66 THIVQCIKPSSEG-------DPCIISM----SKD---FY-------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        66 ~~v~~~~~~~~~~-------~~~~~~~----~~~---~~-------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      |.++++++.....       +.....+    ..+   +.       ..+.+-..+|.+||.+..           .+...
T Consensus        88 d~lv~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsIv~iss~~~~-----------~~~~~  156 (256)
T PRK08594         88 HGVAHCIAFANKEDLRGEFLETSRDGFLLAQNISAYSLTAVAREAKKLMTEGGSIVTLTYLGGE-----------RVVQN  156 (256)
T ss_pred             CEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCE-----------ECCCC
T ss_conf             7466532102344445530018899999988554367778888887653578669985200111-----------12687


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHH
Q ss_conf             311345544555543200123---456764203477778985-------0344431134543222110001024777799
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR  194 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~  194 (289)
                      ...|+.+|...+.+.+.++.+   +|+++-.+.|+.|.-+..       ..+..+.+..+..        -+.--+|+|+
T Consensus       157 ~~~y~asKaal~~ltr~lA~ela~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~pediA~  228 (256)
T PRK08594        157 YNVMGVAKASLEASVKYLANDLGKDGIRVNAISAGPIRTLSAKGVGGFNSILKEIEERAPLR--------RTTTQEEVGD  228 (256)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCC--------CCCCHHHHHH
T ss_conf             41357789999999999999853888399998637787712331557399999999679999--------9969999999


Q ss_pred             HHHHHHCCC----CCCCEECCCC
Q ss_conf             999995135----5786162684
Q gi|254780595|r  195 CVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       195 ~i~~l~~~~----~~~iyni~~~  213 (289)
                      ++++|....    -|+++.+-.+
T Consensus       229 ~v~fL~Sd~s~~iTGq~i~VDGG  251 (256)
T PRK08594        229 TAAFLFSDLSRGVTGENIHVDSG  251 (256)
T ss_pred             HHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999584524855872897959


No 186
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=98.29  E-value=1.9e-05  Score=50.57  Aligned_cols=200  Identities=12%  Similarity=0.047  Sum_probs=103.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998898899996794463455644---98289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
                      .+||||+ +=||..+++.|.++|++|..+.|++++...+...   .+..+..|..+...   .+   ......+|.++++
T Consensus         8 ~alVTGas~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiLVnn   87 (263)
T PRK06200          8 VALITGGGSGIGRALVERFLAEGARVAVLERSAEKCASLRQRFGDDVLVVEGDVTSYADNQRAVAQTVDRFGKLDCFVGN   87 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89995866799999999999879999999799999999999818864687179999999999999999984998889975


Q ss_pred             ECCC------CCCCE-E----ECC-CCCHHH-------H----HHHCCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCCH
Q ss_conf             1244------43310-0----012-210134-------4----32012334333320102-5762123453211234311
Q gi|254780595|r   72 IKPS------SEGDP-C----IIS-MSKDFY-------K----FMPHVKWIGYLSSTSIY-GNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        72 ~~~~------~~~~~-~----~~~-~~~~~~-------~----~~~~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~~  127 (289)
                      ++..      .+.+. .    +.. +..++.       +    ..+.-..+|++||+.-+ +.            .....
T Consensus        88 AG~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~g~iI~~~S~~~~~~~------------~~~~~  155 (263)
T PRK06200         88 AGIWDYYTSLVDIPAETLDTAFDEIFRVNVKGYLLGAKAALPALKASGGSIIFTLSNSSFYPG------------GGGPL  155 (263)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHCCCC------------CCCHH
T ss_conf             754677776033997899999999999987999999999989886079779998220212588------------98567


Q ss_pred             HHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHH-HHHCC---CCCCCC---CCCCEEC-CHHHHHHHHHHH
Q ss_conf             34554455554320012345--67642034777789850344-43113---454322---2110001-024777799999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFI-KIRQK---NSLRLV---KKNQVFN-RIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~-~~~~g---~~~~~~---~~~~~~~-~ihv~Dva~~i~  197 (289)
                      |+.+|.+...+.+..+.+.+  +.+-.+.|+.|.-|-+.... .....   ......   ....... +...+|+|+++.
T Consensus       156 Y~asKaal~~ltr~lA~ela~~IrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dia~~v~  235 (263)
T PRK06200        156 YTASKHAVVGLVRQLAYELAPKIRVNGVAPGGTVTDLRGPASLGQGETSISDVPGLADMIAAITPLQFAPQPEDHTGPYV  235 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             89999999999999999977998899996288988864421121466542046889999971799899839999999999


Q ss_pred             HHHCCC-----CCCCEECCCC
Q ss_conf             995135-----5786162684
Q gi|254780595|r  198 FLMTHH-----LGGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~-----~~~iyni~~~  213 (289)
                      +|+..+     -|++..+-.+
T Consensus       236 fL~Sd~~s~~iTG~~i~vDGG  256 (263)
T PRK06200        236 LLASRRNSRALTGVVINADGG  256 (263)
T ss_pred             HHCCCCCCCCEECCEEEECCC
T ss_conf             980853236845867888936


No 187
>PRK06949 short chain dehydrogenase; Provisional
Probab=98.28  E-value=8.3e-06  Score=52.66  Aligned_cols=189  Identities=13%  Similarity=0.080  Sum_probs=102.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----564498--289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      .+||||+ +=||..++..|.++|.+|....|+.++...    +...+.  ..+..|..+. +...       .....+|.
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~-~~v~~~v~~~~~~~G~iDi   89 (258)
T PRK06949         11 VALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDY-QSIKAAVAHAETEAGTIDI   89 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHHCCCCE
T ss_conf             899958577999999999998799999996988999999999996599289998268999-9999999999998499989


Q ss_pred             EEEEECCCCCC---CE---EECC-CCCHH----------HH-HHHC---------CCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             78761244433---10---0012-21013----------44-3201---------2334333320102576212345321
Q gi|254780595|r   68 IVQCIKPSSEG---DP---CIIS-MSKDF----------YK-FMPH---------VKWIGYLSSTSIYGNREGQWVDEHS  120 (289)
Q Consensus        68 v~~~~~~~~~~---~~---~~~~-~~~~~----------~~-~~~~---------~~~~i~~SS~~VYg~~~g~~i~E~~  120 (289)
                      ++++++-....   +-   .+.. ...++          .. ....         ..++|++||.+...           
T Consensus        90 LVnnAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~mi~~~~~~~~~~~~G~IVni~S~~~~~-----------  158 (258)
T PRK06949         90 LVNNSGVSTTQKLVDVTPADFEFVFDTNTRGAFFVAQEVAKRMIARAKGAGNAKPQCRIINIASVAGLR-----------  158 (258)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHCC-----------
T ss_conf             998998899989265999999999998709999999999999998457998888983999983555476-----------


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHH-----HHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             1234311345544555543200123---45676420347777898-5034-----4431134543222110001024777
Q gi|254780595|r  121 FVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPF-----IKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       121 ~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~-----~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
                      +.-....|+.+|.....+.+..+.+   +++.+-.+-|+.|--|- +..+     .++....+      -+  -+-.-+|
T Consensus       159 ~~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~e~~~~~~~~~P------~~--R~g~ped  230 (258)
T PRK06949        159 VLPQIGLYCMSKAAVVHMTRAMALEWGRHGINVNAICPGYIDTEINHHHWETEQGQKLVSMLP------RK--RVGKPED  230 (258)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHCCCHHHHHHHHHCCC------CC--CCCCHHH
T ss_conf             899838999999999999999999962219799999657888700010057599999996499------99--9829999


Q ss_pred             HHHHHHHHHCCCC----CCCEEC
Q ss_conf             7999999951355----786162
Q gi|254780595|r  192 VARCVIFLMTHHL----GGIFNL  210 (289)
Q Consensus       192 va~~i~~l~~~~~----~~iyni  210 (289)
                      ++.++.+|.....    |++..+
T Consensus       231 ia~~v~fL~S~~s~~iTGq~i~V  253 (258)
T PRK06949        231 LDGLLLLLAADESQFINGAIISA  253 (258)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEE
T ss_conf             99999998387316736874784


No 188
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=98.28  E-value=5.9e-06  Score=53.48  Aligned_cols=72  Identities=15%  Similarity=0.136  Sum_probs=56.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH--CCCEEEECCCCCCCHHHHHHHCCCCEEEEEE
Q ss_conf             93999888888999999999889889999679446345564--4982898067864023465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH--KGISPFLFADQKINNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~--~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~   72 (289)
                      |++.|.|+|.+|..+++.|.+.||+|+.+.++++.......  .+...+..+..+.+......+..+|+++.+.
T Consensus         1 m~iiIiG~G~vG~~va~~L~~~g~~Vv~Id~d~~~~~~~~~~~~~~~~v~gd~t~~~~L~~agi~~aD~vva~t   74 (225)
T COG0569           1 MKIIIIGAGRVGRSVARELSEEGHNVVLIDRDEERVEEFLADELDTHVVIGDATDEDVLEEAGIDDADAVVAAT   74 (225)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCCEEEEEE
T ss_conf             98999898578899999998789908999768899998632000449999268898999867986389999980


No 189
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=98.28  E-value=8e-06  Score=52.75  Aligned_cols=200  Identities=17%  Similarity=0.101  Sum_probs=106.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345----564498--2898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.++...    +...+.  ..+..|..+.+..      ..+....+|.+
T Consensus         9 valVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   88 (262)
T PRK13394          9 TAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAERFGSVDIL   88 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995857789999999999879999999798899999999999629939999815899999999999999981999999


Q ss_pred             EEEECCCCCCC---EEECCC----C----------CHHHHHH---HCCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCCH
Q ss_conf             87612444331---000122----1----------0134432---012334333320102-5762123453211234311
Q gi|254780595|r   69 VQCIKPSSEGD---PCIISM----S----------KDFYKFM---PHVKWIGYLSSTSIY-GNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        69 ~~~~~~~~~~~---~~~~~~----~----------~~~~~~~---~~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~~  127 (289)
                      +++++......   ......    .          +.....+   .+-.++|++||...+ |.            .....
T Consensus        89 VnnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnisS~~~~~~~------------~~~~~  156 (262)
T PRK13394         89 VSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEAS------------PLKSA  156 (262)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC------------CCCHH
T ss_conf             989988999991659999999999997589999999999999983799689997457767679------------99768


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCC-HHHHHHCCCCCC-------CCCCCCEE-CCHHHHHHHHH
Q ss_conf             34554455554320012---34567642034777789850-344431134543-------22211000-10247777999
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRN-PFIKIRQKNSLR-------LVKKNQVF-NRIRVEDVARC  195 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~-~~~~~~~g~~~~-------~~~~~~~~-~~ihv~Dva~~  195 (289)
                      |+.+|...-.+.+..+.   .+++.+-.+-|+.+-.|... .+..........       ........ -+..-+|++++
T Consensus       157 Y~asKaal~~ltk~lA~E~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~g~p~dvA~~  236 (262)
T PRK13394        157 YVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGKTVDGVFTTVEDVAQT  236 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             99999999999999999852319699999758788702331365578763788589999998617998897299999999


Q ss_pred             HHHHHCCC----CCCCEECCCC
Q ss_conf             99995135----5786162684
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~  213 (289)
                      +.+|....    -|+++++-.|
T Consensus       237 v~fLaS~~a~~iTG~~i~VDGG  258 (262)
T PRK13394        237 VLFLSAFPSAALTGQSFVVSHG  258 (262)
T ss_pred             HHHHHCHHHCCCCCCEEEECCC
T ss_conf             9999385756916972898927


No 190
>PRK12747 short chain dehydrogenase; Provisional
Probab=98.28  E-value=2e-05  Score=50.48  Aligned_cols=195  Identities=13%  Similarity=0.059  Sum_probs=102.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHH----HHHHCCCEE--EECCCCCCC---HHHH---HHH-----
Q ss_conf             3999888-888999999999889889999-67944634----556449828--980678640---2346---541-----
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLL----TLKHKGISP--FLFADQKIN---NLLR---EKL-----   62 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~----~l~~~~~~~--~~~~~~~~~---~~~~---~~~-----   62 (289)
                      .+||||+ +=||..+++.|.++|++|... .|+.+...    .+...+...  +..|..+..   ....   ...     
T Consensus         6 valITGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~g   85 (252)
T PRK12747          6 VALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELQKRTG   85 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             99994847789999999999879999996599878999999999964995799833635679999999999999998428


Q ss_pred             -CCCCEEEEEECCCCCC---CEEECCC--------------CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             -1563278761244433---1000122--------------101344320123343333201025762123453211234
Q gi|254780595|r   63 -YFTTHIVQCIKPSSEG---DPCIISM--------------SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        63 -~~~~~v~~~~~~~~~~---~~~~~~~--------------~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                       ..+|.++++++.....   +......              .+.....+..-.++|.+||.+.+-   +        ...
T Consensus        86 ~~~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~g~IVnisS~~~~~---~--------~~~  154 (252)
T PRK12747         86 STKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRDNSRIINISSAATRI---S--------LPD  154 (252)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCC---C--------CCC
T ss_conf             99810899899999998813499999999999975689999999999997669750898511126---8--------897


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-H-----HHHHHCCCCCCCCCCCCEECCHHHHHHHHH
Q ss_conf             311345544555543200123---4567642034777789850-3-----444311345432221100010247777999
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-P-----FIKIRQKNSLRLVKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-~-----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~  195 (289)
                      ...|+.+|...+.+.+.++++   +|+.+-.+.|+.|--|-.. .     +........     +  .--+-..+|+|++
T Consensus       155 ~~~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~-----p--~~R~g~p~dvA~~  227 (252)
T PRK12747        155 FIAYSMTKGAINTMTFTLAKQLGARGITVNAILPGFIKTDMNAELLSDPMMKQYATTIS-----A--FNRLGEVEDIADT  227 (252)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHCCC-----C--CCCCCCHHHHHHH
T ss_conf             27789999999999999999973339599888777598732211127899999986478-----8--7998599999999


Q ss_pred             HHHHHCCC----CCCCEECCCCC
Q ss_conf             99995135----57861626843
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~~  214 (289)
                      +.+|....    -|+++.+-.|.
T Consensus       228 v~fL~S~~a~~iTG~~i~VDGG~  250 (252)
T PRK12747        228 AAFLASPDSRWVTGQLIDVSGGS  250 (252)
T ss_pred             HHHHHCCHHCCCCCCEEEECCCC
T ss_conf             99995844338228837489887


No 191
>PRK08628 short chain dehydrogenase; Provisional
Probab=98.27  E-value=2.2e-05  Score=50.19  Aligned_cols=201  Identities=12%  Similarity=0.053  Sum_probs=103.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH---HHHHCC--CEEEECCCCCCCH---HH---HHHHCCCCEEE
Q ss_conf             3999888-88899999999988988999967944634---556449--8289806786402---34---65411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL---TLKHKG--ISPFLFADQKINN---LL---REKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~---~l~~~~--~~~~~~~~~~~~~---~~---~~~~~~~~~v~   69 (289)
                      .++|||+ +=||..+++.|.++|..|..+.|+.....   .+...+  ...+..|..+.+.   .+   ......+|.++
T Consensus         9 valVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~v~~~~~~~g~iDiLV   88 (258)
T PRK08628          9 VVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPDDEFAEELRALQPRAEFVQVDLQDDAQCRDAVAQTVAKFGRIDGLV   88 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89992777789999999999879989998088023999999995399789999527999999999999999829988999


Q ss_pred             EEECCCCCC--CEEECCCC----CHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             761244433--10001221----013----------44-32012334333320102576212345321123431134554
Q gi|254780595|r   70 QCIKPSSEG--DPCIISMS----KDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        70 ~~~~~~~~~--~~~~~~~~----~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++++.....  +.....+.    .++          .. ..+.-.++|.+||..-.-   +        ......|+.+|
T Consensus        89 nnAGi~~~~~~e~~~e~~~~~~~~Nl~~~~~l~~~~~p~l~~~~GsIInisS~~a~~---~--------~~~~~~Y~asK  157 (258)
T PRK08628         89 NNAGVNDGVGLDAGRDAFVASLERNLIHYYVMAHYCLPHLKASRGAIVNISSKTALT---G--------QGGTSGYAAAK  157 (258)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHCCC---C--------CCCCHHHHHHH
T ss_conf             888227887778999999999998749999999999998885495499981221016---7--------99848899999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-HHHHHHCCCC-CCCCCCCCEE-C-CHHHHHHHHHHHHHHCCC--
Q ss_conf             4555543200123---4567642034777789850-3444311345-4322211000-1-024777799999995135--
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-PFIKIRQKNS-LRLVKKNQVF-N-RIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-~~~~~~~g~~-~~~~~~~~~~-~-~ihv~Dva~~i~~l~~~~--  203 (289)
                      .....+.+..+.+   +|+++-.+-|+.+.-|-.. .+........ .......... . +...+|+|+++.+|....  
T Consensus       158 aal~~ltr~lA~e~~~~gIRvNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~pl~~R~g~p~eiA~~v~FL~Sd~s~  237 (258)
T PRK08628        158 GAQLGLTREWAVALAKDGVRVNAVIPAEVMTPLYANWLATFDDPEAKLAKITRKIPLGHRMTTAEEIADTAVFLLSERAS  237 (258)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999996411959999987889876679887604786999999995499867882999999999999583434


Q ss_pred             --CCCCEECCCC
Q ss_conf             --5786162684
Q gi|254780595|r  204 --LGGIFNLSDD  213 (289)
Q Consensus       204 --~~~iyni~~~  213 (289)
                        .|+++.+-.|
T Consensus       238 ~iTG~~i~VDGG  249 (258)
T PRK08628        238 HTTGQWLFVDGG  249 (258)
T ss_pred             CCCCCEEEECCC
T ss_conf             933887997398


No 192
>PRK06194 hypothetical protein; Provisional
Probab=98.27  E-value=3.9e-05  Score=48.80  Aligned_cols=214  Identities=11%  Similarity=0.073  Sum_probs=108.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCCEE--EECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----556449828--98067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGISP--FLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~~~--~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|++|....|+.+.+.    .+...+...  +..|..+....      ..+....+|.+
T Consensus         8 vavITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~fG~iDiL   87 (301)
T PRK06194          8 VAVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERFGAVHLL   87 (301)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEE
T ss_conf             89992737799999999999879989999798899999999998459849999656899999999999999983993799


Q ss_pred             EEEECCCCCC---CEEEC----CCCCHH----------HHHH-HC-------CCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             8761244433---10001----221013----------4432-01-------2334333320102576212345321123
Q gi|254780595|r   69 VQCIKPSSEG---DPCII----SMSKDF----------YKFM-PH-------VKWIGYLSSTSIYGNREGQWVDEHSFVH  123 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~----~~~~~~----------~~~~-~~-------~~~~i~~SS~~VYg~~~g~~i~E~~~~~  123 (289)
                      +++++-....   +....    .+..|+          .-.+ ..       ..++|.+||.+-+-  .       .|  
T Consensus        88 VNNAGi~~~~~~~e~~~edw~~v~~VNl~G~~~~~r~~lP~M~~~~~~~~~~~G~IVNisSiaG~~--~-------~p--  156 (301)
T PRK06194         88 FNNAGVGAGGLLWENSLADWEWVLGVNLMGVIHGVRIFTPLMLAAAEKDPAYEGHIVNTASMAGLL--A-------PP--  156 (301)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCC--C-------CC--
T ss_conf             955766788873449999999999998199999999999999976887889864999945423235--8-------99--


Q ss_pred             CCCHHHHHHHHHHHHHHHCCC-----CCCCCCCCCCCCCC----CCCCCCHHHHHHCCCCCCCCC--CCC----E--ECC
Q ss_conf             431134554455554320012-----34567642034777----789850344431134543222--110----0--010
Q gi|254780595|r  124 PISCVATQRFNAEKEWLAITK-----KLNIKLAVLRLSGI----YGPKRNPFIKIRQKNSLRLVK--KNQ----V--FNR  186 (289)
Q Consensus       124 P~~~y~~~k~~~E~~~~~~~~-----~~~~~~~ilR~~~i----yGp~r~~~~~~~~g~~~~~~~--~~~----~--~~~  186 (289)
                      ....|+.+|.+...+-+....     ..++.+.++-|+.|    +-..|+.-.++....++.-..  ...    .  -..
T Consensus       157 ~~~~Y~ASK~AV~glT~sLa~EL~~~~~~IrV~~lcPG~V~T~i~~s~r~rp~~~~~~~~~~~~~~~~~~~~~~~~~~g~  236 (301)
T PRK06194        157 AMGVYNVSKHAVVSLTETLYQDLRLVTDQVGASVLCPYFVPTGIWQSHRNRPADLANDAPPTRSQLVAQAMSDKAVGSGK  236 (301)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             97078999999999999999999756979799999728887886745655822205678876337789999998987489


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24777799999995135578616268433338999999999955
Q gi|254780595|r  187 IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK  230 (289)
Q Consensus       187 ihv~Dva~~i~~l~~~~~~~iyni~~~~~~s~~e~~~~i~~~~g  230 (289)
                      +..+|||+.++..+.++.  -|.++.++  ....+-....+.+.
T Consensus       237 ~~~~~va~~v~~~i~~~~--f~I~~hp~--~~~~~~~r~~~i~~  276 (301)
T PRK06194        237 VSAADVAQLVFDAIAADR--FYIYSHPQ--ALASVQTRMEDIVQ  276 (301)
T ss_pred             CCHHHHHHHHHHHHHHCC--EEEECCCH--HHHHHHHHHHHHHH
T ss_conf             999999999999997097--79966806--67999999999982


No 193
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.27  E-value=1.8e-05  Score=50.74  Aligned_cols=195  Identities=16%  Similarity=0.112  Sum_probs=106.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHCCCEEEECCCCCCCHH------HHHHHCCCCEEEEEEC
Q ss_conf             3999888-88899999999988988999967944-63455644982898067864023------4654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NLLTLKHKGISPFLFADQKINNL------LREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~~~l~~~~~~~~~~~~~~~~~~------~~~~~~~~~~v~~~~~   73 (289)
                      .++|||+ +=||..+++.|.+.|.+|....++.+ ....+...+...+..|..+.++.      ..+....+|.++++++
T Consensus         9 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAG   88 (254)
T PRK06463          9 VALITGGSRGIGRAIAEKFLKEGAKVAILYNSSEDKAKELKEKGVETFKCDVSNRDQVRKAKEEIHKKLGRIDVLVNNAG   88 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89994847789999999999889999996499789999998669889997389999999999999998299989998997


Q ss_pred             CCCCC---CEE---EC-CCCCHH----------HHH-HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             44433---100---01-221013----------443-2012334333320102576212345321123431134554455
Q gi|254780595|r   74 PSSEG---DPC---II-SMSKDF----------YKF-MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        74 ~~~~~---~~~---~~-~~~~~~----------~~~-~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      -....   +..   +. .+..++          ... .++-.++|.+||..-++          .+......|+.+|...
T Consensus        89 ~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~G~IVnisS~~g~~----------~~~~~~~~Y~asKaav  158 (254)
T PRK06463         89 IWYLMPFEEFDEEKYNRMLDVNLNGTIYTTYEFLPDLKEENGVIINIASNAGIG----------TAAEGTTFYAITKAGI  158 (254)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEHHHCC----------CCCCCCHHHHHHHHHH
T ss_conf             789999155999999999999838999999999998876398699997575428----------7887617889999999


Q ss_pred             HHHHHHCCCC---CCCCCCCCCCCCCCCCC----CC--HHHHHH----CCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             5543200123---45676420347777898----50--344431----13454322211000102477779999999513
Q gi|254780595|r  136 EKEWLAITKK---LNIKLAVLRLSGIYGPK----RN--PFIKIR----QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       136 E~~~~~~~~~---~~~~~~ilR~~~iyGp~----r~--~~~~~~----~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      ..+.+..+.+   +|+.+-.+-|+.|--|-    +.  ...+++    ...+..        -+-.-+|+|+++.+|...
T Consensus       159 ~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~pl~--------R~g~pediA~~v~fLaSd  230 (254)
T PRK06463        159 IMLTKRLAFELGKYGIRVNAVAPGWIETDMTIGGKSPEEIEKLEEDFRSRTVLH--------TTGKPEDIANIVLFLASD  230 (254)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCC--------CCCCHHHHHHHHHHHHCC
T ss_conf             999999999970239599999868898765335688578999999998279978--------981999999999999584


Q ss_pred             C----CCCCEECCCCC
Q ss_conf             5----57861626843
Q gi|254780595|r  203 H----LGGIFNLSDDE  214 (289)
Q Consensus       203 ~----~~~iyni~~~~  214 (289)
                      .    -|+++.+-.|.
T Consensus       231 ~a~~iTG~~i~VDGG~  246 (254)
T PRK06463        231 DARYITGQVIVADGGR  246 (254)
T ss_pred             HHCCCCCCEEEECCCE
T ss_conf             4249158659963999


No 194
>PRK06227 consensus
Probab=98.27  E-value=1e-05  Score=52.10  Aligned_cols=197  Identities=13%  Similarity=0.069  Sum_probs=104.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH----HHHHHCCCEE--EECCCCCCCH---HH---HHHHCCCCEE
Q ss_conf             3999888-8889999999998898899996794463----4556449828--9806786402---34---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL----LTLKHKGISP--FLFADQKINN---LL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~----~~l~~~~~~~--~~~~~~~~~~---~~---~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+..    ..+...+...  +..|..+...   .+   .+....+|.+
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDiL   86 (256)
T PRK06227          7 VAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERYGGIDIL   86 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995866889999999999879999999698889999999999559918999816899999999999999982999799


Q ss_pred             EEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---100012----21013----------4432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-....   +.....    +..++          ...+  .+-.++|.+||...+-...           ....|+
T Consensus        87 VNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~-----------~~~~Y~  155 (256)
T PRK06227         87 INNAGIFSGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQSEP-----------NTEPYS  155 (256)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-----------CCHHHH
T ss_conf             989989999890349899999999998299999999999999984997799962255456899-----------868899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC--HHH---HHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             5544555543200123---4567642034777789850--344---4311345432221100010247777999999951
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN--PFI---KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~--~~~---~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .+|.....+.+..+.+   +++.+-.+-|+.|--|...  ...   .+........  +-  --+-.-+|+|+++.+|..
T Consensus       156 asKaav~~lTr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~--P~--gR~g~peeiA~~v~FL~S  231 (256)
T PRK06227        156 ASKGGIIALTHSLAVSLSKYKIRVVSISPGWIETSEWKKPPLRKKPQLTPLDHLQH--PA--GRVGKPEDVANLCLFLAS  231 (256)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHCC--CC--CCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999996202949999961869665000575102577788786268--87--798599999999999967


Q ss_pred             CC----CCCCEECCCC
Q ss_conf             35----5786162684
Q gi|254780595|r  202 HH----LGGIFNLSDD  213 (289)
Q Consensus       202 ~~----~~~iyni~~~  213 (289)
                      ..    -|+++.+-.+
T Consensus       232 d~as~iTG~~i~VDGG  247 (256)
T PRK06227        232 DEASFITGVNFIVDGG  247 (256)
T ss_pred             CHHCCCCCCEEEECCC
T ss_conf             6324925863896789


No 195
>PRK07985 oxidoreductase; Provisional
Probab=98.27  E-value=2.9e-05  Score=49.55  Aligned_cols=193  Identities=11%  Similarity=0.069  Sum_probs=103.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECC--HHHHH----HHHHCCCE--EEECCCCCCCHHHH-------HHHCCC
Q ss_conf             3999888-888999999999889889999679--44634----55644982--89806786402346-------541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRS--VSNLL----TLKHKGIS--PFLFADQKINNLLR-------EKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~--~~~~~----~l~~~~~~--~~~~~~~~~~~~~~-------~~~~~~   65 (289)
                      .+||||+ +=||..+++.|.+.|.+|....++  .....    .....+..  .+..|..+ .....       +....+
T Consensus        51 valVTGas~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~-~~~v~~lv~~~~~~fG~i  129 (294)
T PRK07985         51 KALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSD-EKFARSLVHEAHKALGGL  129 (294)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHHHHCCC
T ss_conf             7999172669999999999987999999429966678999999999729958999767899-999999999999985998


Q ss_pred             CEEEEEECCCCCCCE----EECCC----CCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             327876124443310----00122----101----------344320123343333201025762123453211234311
Q gi|254780595|r   66 THIVQCIKPSSEGDP----CIISM----SKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        66 ~~v~~~~~~~~~~~~----~~~~~----~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      |.++++++......+    ....+    ..+          ....+++-.++|.+||.+.+..           ......
T Consensus       130 DiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m~~gGsIInisS~~~~~~-----------~p~~~~  198 (294)
T PRK07985        130 DIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGASIITTSSIQAYQP-----------SPHLLD  198 (294)
T ss_pred             CEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-----------CCCCHH
T ss_conf             889980666668888365899999999998653478888876776424877999666465278-----------887307


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             345544555543200123---456764203477778985-------0344431134543222110001024777799999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      |+.+|...+.+.+..+.+   +|+.+-.+.|+.|.-+-.       ..+..+.+..+..        -+-.-+|+|+++.
T Consensus       199 Y~asKaav~~lTrslA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~--------R~g~peDIA~av~  270 (294)
T PRK07985        199 YAATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISGGQTQDKIPQFGQQTPMK--------RAGQPAELAPVYV  270 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHHH
T ss_conf             79999999999999999965339299999638787710202799999999998569988--------9939999999999


Q ss_pred             HHHCCC----CCCCEECCCCC
Q ss_conf             995135----57861626843
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~~  214 (289)
                      +|....    -|+++.+-.+.
T Consensus       271 fLaS~~a~~ITGq~i~VDGG~  291 (294)
T PRK07985        271 YLASQESSYVTAEVHGVCGGE  291 (294)
T ss_pred             HHHCCHHCCCCCCEEEECCCC
T ss_conf             995824367267227988760


No 196
>PRK12829 short chain dehydrogenase; Provisional
Probab=98.27  E-value=2.8e-05  Score=49.64  Aligned_cols=201  Identities=14%  Similarity=0.103  Sum_probs=105.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCEEEECCCCCCCH---HH---HHHHCCCCEEEE
Q ss_conf             3999888-88899999999988988999967944634556----4498289806786402---34---654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK----HKGISPFLFADQKINN---LL---REKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~----~~~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.+.|.+|....|+++......    ..+...+..|..+...   .+   .+....+|.+++
T Consensus        13 valVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVN   92 (264)
T PRK12829         13 RVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATAARLPGAKVTATVADVADPAQVERVFDTAVERFGGLDVLVN   92 (264)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             79994737689999999999879989999799899999999747997599996289999999999999997399989998


Q ss_pred             EECCCCCC----CEEECCCC----CHH----------HHHHHC---CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             61244433----10001221----013----------443201---2334333320102576212345321123431134
Q gi|254780595|r   71 CIKPSSEG----DPCIISMS----KDF----------YKFMPH---VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        71 ~~~~~~~~----~~~~~~~~----~~~----------~~~~~~---~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++-....    +-......    .++          ...+..   -+.+|.+||.+-..   +.        .....|+
T Consensus        93 NAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~~IinisS~~~~~---~~--------~~~~~Y~  161 (264)
T PRK12829         93 NAGIAGPTGGIDEITPEQWEQTLAVNLNGQFYFARAAVPLLRASGHGGVIIALSSVAGRL---GY--------PGRTPYA  161 (264)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCC---CC--------CCCHHHH
T ss_conf             998999999802399999999999984878999999999998739980899980265477---99--------8867899


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-HHHHHHCCCCCC-------CCCCCCEECCHHHHHHHHHHHH
Q ss_conf             5544555543200123---4567642034777789850-344431134543-------2221100010247777999999
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-PFIKIRQKNSLR-------LVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-~~~~~~~g~~~~-------~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      .+|.....+.+..+.+   +|+.+-.+-|+.|..|.-. .+..........       +...-..--+-..+|+|+++++
T Consensus       162 asKaal~~ltr~lA~E~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~F  241 (264)
T PRK12829        162 ASKWAVVGLVKSLAIELGPLGIRVNAILPGIVRGPRMRRVIEARAQQLGIGLDEMEQEYLEKISLGRMVEPEDIAATALF  241 (264)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999998540949998862888880254454656765378879999999807999997889999999999


Q ss_pred             HHCCC----CCCCEECCCC
Q ss_conf             95135----5786162684
Q gi|254780595|r  199 LMTHH----LGGIFNLSDD  213 (289)
Q Consensus       199 l~~~~----~~~iyni~~~  213 (289)
                      |....    .|+++.+-.+
T Consensus       242 LaSd~ss~iTG~~i~VDGG  260 (264)
T PRK12829        242 LASPAARYITGQAISVDGN  260 (264)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             9581645805877797878


No 197
>PRK06484 short chain dehydrogenase; Validated
Probab=98.26  E-value=2.8e-05  Score=49.67  Aligned_cols=191  Identities=14%  Similarity=0.094  Sum_probs=104.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HCCCE--EEECCCCCCCH---HH---HHHHCCCCEEEEEE
Q ss_conf             999888-88899999999988988999967944634556-44982--89806786402---34---65411563278761
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK-HKGIS--PFLFADQKINN---LL---REKLYFTTHIVQCI   72 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~-~~~~~--~~~~~~~~~~~---~~---~~~~~~~~~v~~~~   72 (289)
                      +||||+ +=||..+++.|.++|.+|....|+.+....+. ..+-+  .+..|..+...   .+   .+....+|.+++++
T Consensus       277 alVTGaa~GIG~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~fG~iDiLVNNA  356 (530)
T PRK06484        277 VCVTGGASGIGAAIADRFAALGDRVAIIDSDGEEAVKLREILGGEHLSWQVDITDEASVESAFAGIQGRLGPLDVLVNNA  356 (530)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99928767899999999998879899995888999999997399736999538999999999999999829988999897


Q ss_pred             CCCCCCCEE----ECCCC----CHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             244433100----01221----013----------44-320123343333201025762123453211234311345544
Q gi|254780595|r   73 KPSSEGDPC----IISMS----KDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF  133 (289)
Q Consensus        73 ~~~~~~~~~----~~~~~----~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~  133 (289)
                      +......+.    .....    .++          .. ....-.++|.+||.+...           +..+...|+.+|.
T Consensus       357 Gi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m~~~gG~IVnisS~~~~~-----------~~~~~~~Y~asKa  425 (530)
T PRK06484        357 GIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQMGAGGGVIVNLGSITSLL-----------ALPPRHAYGASKA  425 (530)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----------CCCCCHHHHHHHH
T ss_conf             78989998000999999999999719999999999997314897699971644365-----------8899579999999


Q ss_pred             HHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH--------HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             555543200123---45676420347777898503--------4443113454322211000102477779999999513
Q gi|254780595|r  134 NAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP--------FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       134 ~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~--------~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      ....+.+..+.+   +|+.+-.+-|+.|..|.-..        +..+.+..+.        --+-.-+|+++++.+|...
T Consensus       426 av~~lTr~lA~E~a~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~pediA~~v~fLaSd  497 (530)
T PRK06484        426 AITMLTRCLAAELAPHGIRVNTVAPGYILTPAVQALLASGRRDMNSIRRRIPL--------GRLGQPEEVAEAAYFLASP  497 (530)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999960439199989877788704544331357889999855998--------9977899999999998285


Q ss_pred             C----CCCCEECCC
Q ss_conf             5----578616268
Q gi|254780595|r  203 H----LGGIFNLSD  212 (289)
Q Consensus       203 ~----~~~iyni~~  212 (289)
                      .    .|+++.+-.
T Consensus       498 ~a~~iTG~~i~VDG  511 (530)
T PRK06484        498 AASYINGATLQVDG  511 (530)
T ss_pred             CCCCCCCCEEEECC
T ss_conf             00686688798596


No 198
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.26  E-value=3.3e-05  Score=49.20  Aligned_cols=194  Identities=16%  Similarity=0.029  Sum_probs=104.0

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-HHH----HHHHCCC--EEEECCCCCCCH---H---HHHHHCCCCEE
Q ss_conf             999888-88899999999988988999967944-634----5564498--289806786402---3---46541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-NLL----TLKHKGI--SPFLFADQKINN---L---LREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~~~----~l~~~~~--~~~~~~~~~~~~---~---~~~~~~~~~~v   68 (289)
                      .||||+ +=||..+++.|+++|++|..+.|+.+ ...    .+...+.  ..+..|..+.+.   .   ..+....+|.+
T Consensus         8 alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~fg~iDiL   87 (259)
T PRK12745          8 ALVTGGRRGIGLGIALALAAGGFDLAINDRPDAEKLAATQQELRALGVEVIFFPADVADLSAHEATLDAAQDAWGRIDCL   87 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968678999999999998799899997986678999999998449948999846899999999999999982998899


Q ss_pred             EEEECCC--CCC---CEEECC----CCCHH----------HHHHH-C-------CCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             8761244--433---100012----21013----------44320-1-------23343333201025762123453211
Q gi|254780595|r   69 VQCIKPS--SEG---DPCIIS----MSKDF----------YKFMP-H-------VKWIGYLSSTSIYGNREGQWVDEHSF  121 (289)
Q Consensus        69 ~~~~~~~--~~~---~~~~~~----~~~~~----------~~~~~-~-------~~~~i~~SS~~VYg~~~g~~i~E~~~  121 (289)
                      +++++..  ...   +-....    +..++          ...+. .       ...+|.+||...+-  . .       
T Consensus        88 VNNAG~~~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~q~~~~~m~~~~~~~~~~~gsIInisS~~a~~--~-~-------  157 (259)
T PRK12745         88 VNNAGVGVKKRGDLLDLTPESFDRCLAVNLRGTFFLTQAVAKRMLAQPKPEAELPRSIVTVSSVNAIM--L-S-------  157 (259)
T ss_pred             EECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCC--C-C-------
T ss_conf             98475366889981019999999999997389999999999999965268889970899977876557--7-8-------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH-H---H-HHHCCCCCCCCCCCCEECCHHHHHHH
Q ss_conf             234311345544555543200123---45676420347777898503-4---4-43113454322211000102477779
Q gi|254780595|r  122 VHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP-F---I-KIRQKNSLRLVKKNQVFNRIRVEDVA  193 (289)
Q Consensus       122 ~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~-~---~-~~~~g~~~~~~~~~~~~~~ihv~Dva  193 (289)
                       -....|+.+|...+.+.+.++.+   +|+.+-.+-|+.|-.+-... .   . .+..+.   +  +-+  -+-.-+|++
T Consensus       158 -~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~---~--P~~--R~g~p~dia  229 (259)
T PRK12745        158 -PNRGEYCISKAGLSMAAQLFALRLAEEGIGVYEVRPGLIKTDMTAPVTAKYDELIAKGL---V--PMG--RWGEPEDVA  229 (259)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHCC---C--CCC--CCCCHHHHH
T ss_conf             -88478899999999999999999855493999998615888763200354799998679---9--989--977999999


Q ss_pred             HHHHHHHCCC----CCCCEECCCCC
Q ss_conf             9999995135----57861626843
Q gi|254780595|r  194 RCVIFLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       194 ~~i~~l~~~~----~~~iyni~~~~  214 (289)
                      +++.+|....    .|+++.+-.|-
T Consensus       230 ~~v~fL~S~~a~yiTGq~i~VDGG~  254 (259)
T PRK12745        230 ATVAALAEGKLIYTTGQAIAIDGGL  254 (259)
T ss_pred             HHHHHHHCCCCCCCCCCEEEECCCC
T ss_conf             9999996780048758838889671


No 199
>PRK06198 short chain dehydrogenase; Provisional
Probab=98.26  E-value=1.2e-05  Score=51.78  Aligned_cols=190  Identities=17%  Similarity=0.119  Sum_probs=99.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCE-EEEEECCHHHHH----HHHHCCCEE--EECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-88899999999988988-999967944634----556449828--9806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVY-TCGTTRSVSNLL----TLKHKGISP--FLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~-V~~~~r~~~~~~----~l~~~~~~~--~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      .+||||+ +=||..+++.|.++|.+ |....|+.+...    .+...+.+.  +..|..+. +.+.       .....+|
T Consensus         8 ~alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~-~~v~~~~~~~~~~fG~iD   86 (268)
T PRK06198          8 IALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKAVFVQADLAKV-EDCRAVVAAADEAFGRLD   86 (268)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHHCCCC
T ss_conf             8999585778999999999987993899962988899999999995499679998268999-999999999999839998


Q ss_pred             EEEEEECCCCCC---CEE----ECCCCCHH----------HHHH-H-CC-CCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             278761244433---100----01221013----------4432-0-12-334333320102576212345321123431
Q gi|254780595|r   67 HIVQCIKPSSEG---DPC----IISMSKDF----------YKFM-P-HV-KWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~~---~~~----~~~~~~~~----------~~~~-~-~~-~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      .++++++-....   +..    ...+..++          ...+ . +. .++|.+||.+.+...           .-..
T Consensus        87 iLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~-----------~~~~  155 (268)
T PRK06198         87 ALVNAAGLTDRGTILDTSPELFDRMFAVNVRAPFFLMQEAIKLMRRRRAEGTIVNIGSMSAHGGQ-----------PFIA  155 (268)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCC-----------CCCH
T ss_conf             99989978999982659999999999987269999999999999975999279999154545689-----------9856


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCC---CCCEE-CCHHHHHHHHHHHHH
Q ss_conf             1345544555543200123---4567642034777789850344431134543222---11000-102477779999999
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK---KNQVF-NRIRVEDVARCVIFL  199 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~---~~~~~-~~ihv~Dva~~i~~l  199 (289)
                      .|+.+|.....+.+..+.+   +++.+-.+-|+.+--|....+.+-..+....+..   ..... -+..-+|+++++.+|
T Consensus       156 ~Y~asKaal~~ltkslA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~FL  235 (268)
T PRK06198        156 AYCASKGALATLTRNVAYALLRNRIRVNGLNIGWMASEGEDRIQREFHGAPDDWLEKAAATQPFGRLVDPDEVARAVAFL  235 (268)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             89999999999999999997056949998875778884267898873248799999998369988976999999999999


Q ss_pred             HCCC
Q ss_conf             5135
Q gi|254780595|r  200 MTHH  203 (289)
Q Consensus       200 ~~~~  203 (289)
                      ....
T Consensus       236 ~S~~  239 (268)
T PRK06198        236 LSDE  239 (268)
T ss_pred             HCCH
T ss_conf             6743


No 200
>PRK06398 aldose dehydrogenase; Validated
Probab=98.24  E-value=4.6e-06  Score=54.10  Aligned_cols=197  Identities=14%  Similarity=0.071  Sum_probs=101.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC---HHH---HHHHCCCCEEEEEECC
Q ss_conf             3999888-88899999999988988999967944634556449828980678640---234---6541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN---NLL---REKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~---~~~---~~~~~~~~~v~~~~~~   74 (289)
                      .++|||+ +=||..+++.|.++|.+|..+.|+......    ....+..|..+.+   ..+   .+....+|.++++++-
T Consensus         8 valVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~----~~~~i~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAG~   83 (256)
T PRK06398          8 VVIVTGGSSGIGLAIVSRFVDEGSKVVSISRSEPEDIN----KSDHIKCDVTNEDEVKNAINEISKKYGRIDVLVNNAGI   83 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCC----CCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             89996878789999999999869999999487512517----22389854799999999999999983999799989999


Q ss_pred             CCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4433---100012----21013----------4432--012334333320102576212345321123431134554455
Q gi|254780595|r   75 SSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA  135 (289)
Q Consensus        75 ~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~  135 (289)
                      ....   +.....    +..++          ...+  .+-.++|.+||.+.+...           .....|+.+|...
T Consensus        84 ~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~-----------~~~~~Y~asKaal  152 (256)
T PRK06398         84 EKYGSLHKTDSGTWRRIIDVNVNGVYYMSKEVIPHMLRSGTGSIVNISSVQADIAT-----------KNAAAYVTSKHAL  152 (256)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-----------CCCHHHHHHHHHH
T ss_conf             99999044999999999999736289999999999998399579998040207779-----------9968999999999


Q ss_pred             HHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCC-------CCCEEC-CHHHHHHHHHHHHHHCCC--
Q ss_conf             554320012345--67642034777789850344431134543222-------110001-024777799999995135--
Q gi|254780595|r  136 EKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK-------KNQVFN-RIRVEDVARCVIFLMTHH--  203 (289)
Q Consensus       136 E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~-------~~~~~~-~ihv~Dva~~i~~l~~~~--  203 (289)
                      ..+.+..+.+.+  +.+-.+-|+.|--|--........+.......       ...... +-.-+|+|+++.+|....  
T Consensus       153 ~~ltrslA~ela~~IrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~FLaSd~as  232 (256)
T PRK06398        153 IGLTKSIAVDYAPLIRCNAVCPGTIDTPLVDKAAELEVGKDPEAIERKILEWGNLHPMGRIGRPEEVASVVAFLASDESS  232 (256)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999997799889999737888616676766432689899999999764578988977899999999999484533


Q ss_pred             --CCCCEECCCC
Q ss_conf             --5786162684
Q gi|254780595|r  204 --LGGIFNLSDD  213 (289)
Q Consensus       204 --~~~iyni~~~  213 (289)
                        .|+++++-.|
T Consensus       233 ~iTG~~i~VDGG  244 (256)
T PRK06398        233 FITGTCLYVDGG  244 (256)
T ss_pred             CCCCCEEEECCC
T ss_conf             833861778939


No 201
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.23  E-value=4.8e-05  Score=48.29  Aligned_cols=193  Identities=13%  Similarity=0.067  Sum_probs=99.6

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCEEEEEECCH-----------HHH----HHHHHCCCEE--EECCCCCCCH-----
Q ss_conf             39998888---889999999998898899996794-----------463----4556449828--9806786402-----
Q gi|254780595|r    2 HLMIFGAG---YTGKFIADAALKVGVYTCGTTRSV-----------SNL----LTLKHKGISP--FLFADQKINN-----   56 (289)
Q Consensus         2 kIlI~GaG---~iG~~l~~~L~~~g~~V~~~~r~~-----------~~~----~~l~~~~~~~--~~~~~~~~~~-----   56 (289)
                      .+||||++   =||..+++.|.+.|++|....++.           ...    ..+...+...  +..|..+.+.     
T Consensus         8 valVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dl~~~~~~~~~i   87 (257)
T PRK12859          8 VAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDAPKELI   87 (257)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             89992889998629999999998799899983652011123453757999999999954985999983589999999999


Q ss_pred             -HHHHHHCCCCEEEEEECCCCCCC-------EEECCCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCC
Q ss_conf             -34654115632787612444331-------0001221013----------4432--01233433332010257621234
Q gi|254780595|r   57 -LLREKLYFTTHIVQCIKPSSEGD-------PCIISMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWV  116 (289)
Q Consensus        57 -~~~~~~~~~~~v~~~~~~~~~~~-------~~~~~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i  116 (289)
                       .+.+.....|.++++++......       .....+..++          ....  ..-.++|.+||.+.+..      
T Consensus        88 ~~~~~~~g~iDilVnnAg~~~~~~~~~~~~e~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~------  161 (257)
T PRK12859         88 NKVTEQLGYPHILINNAAYSTNNDFSNLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRIVNMTSGQFQGP------  161 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCC------
T ss_conf             99999829998999899999999905599999999999983578999999999875537953999942686076------


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-C-CHHHHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             53211234311345544555543200123---45676420347777898-5-0344431134543222110001024777
Q gi|254780595|r  117 DEHSFVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-R-NPFIKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       117 ~E~~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r-~~~~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
                           ......|+.+|.+.+.+.+.++.+   +|+.+-.+-|+.+--+- . .....+....+.    +    -+.--+|
T Consensus       162 -----~~~~~~Y~asKaal~~ltrslA~ela~~gIrVN~V~PG~~~T~~~~~~~~~~~~~~~Pl----~----R~g~ped  228 (257)
T PRK12859        162 -----MVGELAYATTKGAIDALTSTLSAEVAHLGITVNAINPGPTDTGWMTEEIKQGLKPMFPF----G----RIGEPKD  228 (257)
T ss_pred             -----CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCHHHHHHHHHCCCC----C----CCCCHHH
T ss_conf             -----87617789999999999999999985519189999768789787799999989857998----9----9859999


Q ss_pred             HHHHHHHHHCCCC----CCCEECCCC
Q ss_conf             7999999951355----786162684
Q gi|254780595|r  192 VARCVIFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       192 va~~i~~l~~~~~----~~iyni~~~  213 (289)
                      +|+++.+|.....    |++..+-.|
T Consensus       229 iA~~v~FL~S~~a~~iTGq~i~VDGG  254 (257)
T PRK12859        229 AARLIKFLVSEEAEWITGQVIHSEGG  254 (257)
T ss_pred             HHHHHHHHHCCHHCCEECCEEEECCC
T ss_conf             99999999585525861875896879


No 202
>PRK12746 short chain dehydrogenase; Provisional
Probab=98.23  E-value=2.4e-05  Score=50.00  Aligned_cols=196  Identities=17%  Similarity=0.135  Sum_probs=101.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHH----HHHHCCCEE--EECCCCCCCH---HHH---HHH-----
Q ss_conf             3999888-888999999999889889999-67944634----556449828--9806786402---346---541-----
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLL----TLKHKGISP--FLFADQKINN---LLR---EKL-----   62 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~----~l~~~~~~~--~~~~~~~~~~---~~~---~~~-----   62 (289)
                      .++|||+ +=||..+++.|.++|++|... .|+.+...    .+...+...  +..|..+.+.   .+.   ...     
T Consensus         8 valITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~~~~~g   87 (254)
T PRK12746          8 VALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNELQIRVG   87 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             89994847689999999999879999996599989999999999855992899975779999999999999999866416


Q ss_pred             -CCCCEEEEEECCCCCC---CEEECC----C----------CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             -1563278761244433---100012----2----------101344320123343333201025762123453211234
Q gi|254780595|r   63 -YFTTHIVQCIKPSSEG---DPCIIS----M----------SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        63 -~~~~~v~~~~~~~~~~---~~~~~~----~----------~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                       ..+|.++++++.....   +.....    .          .+.....++.-.++|.+||....-           +...
T Consensus        88 ~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m~~~G~IVnisS~~~~~-----------~~~~  156 (254)
T PRK12746         88 TSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLLRAEGRVINISSAEVRL-----------GFTG  156 (254)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCC-----------CCCC
T ss_conf             89851899799788999914499999999999853468999999999986169669992432335-----------7887


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCC-CHH--HHHHCCCCCCCCCCCCEEC-CHHHHHHHHHHH
Q ss_conf             3113455445555432001234---56764203477778985-034--4431134543222110001-024777799999
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKKL---NIKLAVLRLSGIYGPKR-NPF--IKIRQKNSLRLVKKNQVFN-RIRVEDVARCVI  197 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~~---~~~~~ilR~~~iyGp~r-~~~--~~~~~g~~~~~~~~~~~~~-~ihv~Dva~~i~  197 (289)
                      ...|+.+|.....+.+.++.+.   |+.+-.+=|+.+-.|-. ..+  ..++...     ....... +-..+|+++++.
T Consensus       157 ~~~Y~asKaal~~ltr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~-----~~~~~lgR~g~p~dia~~v~  231 (254)
T PRK12746        157 SIAYGLSKGALNTMTLPLAKHLGERGITVNTIMPGYTKTDINAKLLDDPEIRNFA-----TNSSVFGRIGQVEDIADAVA  231 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHH-----HHCCCCCCCCCHHHHHHHHH
T ss_conf             3778999999999999999996513989999878989863343304999999999-----72799789759999999999


Q ss_pred             HHHCCC----CCCCEECCCC
Q ss_conf             995135----5786162684
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~  213 (289)
                      +|....    .|+++.+..|
T Consensus       232 FL~S~~s~~iTG~~l~VDGG  251 (254)
T PRK12746        232 FLASSDSRWVTGQIIDVSGG  251 (254)
T ss_pred             HHHCCHHCCEECCEEEECCC
T ss_conf             99586323840885887958


No 203
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=98.23  E-value=6.9e-06  Score=53.09  Aligned_cols=204  Identities=12%  Similarity=0.027  Sum_probs=97.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCC---CCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             3999888-888999999999889889999679446345564498289806786---402346541156327876124443
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQK---INNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~---~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      .+||||+ +=||..+++.|.++|.+|+++.|+......     ...+..|..+   .+.........+|.+++++.....
T Consensus         7 ~alVTG~s~GIG~aia~~la~~GA~V~~~d~~~~~~~~-----~~~~~~D~~~~~~v~~~v~~~~g~id~lvn~Ag~~~~   81 (261)
T PRK12428          7 TIVVTGVASGIGAEVARLLRFLGARVIGLDRRPPGMTL-----DGFHQADLGDPASIDAAVAALPGRIDALFNVAGVPGT   81 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCC-----CCEEECCCCCHHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89997857799999999999869999999688554561-----3176737899999999999837988789986777875


Q ss_pred             CCEE--EC-------CCCCHHHHHHHCCCCCCCCCCEEECC--CCCC---CC-----CC------CCCCCCCCCHHHHHH
Q ss_conf             3100--01-------22101344320123343333201025--7621---23-----45------321123431134554
Q gi|254780595|r   78 GDPC--II-------SMSKDFYKFMPHVKWIGYLSSTSIYG--NREG---QW-----VD------EHSFVHPISCVATQR  132 (289)
Q Consensus        78 ~~~~--~~-------~~~~~~~~~~~~~~~~i~~SS~~VYg--~~~g---~~-----i~------E~~~~~P~~~y~~~k  132 (289)
                      .+..  ..       ...+.+......-..++.++|..-..  ....   ..     +.      -..+......|+.+|
T Consensus        82 ~~~~~~~~vn~~g~~~~~~~~~~~~~~~~~ivn~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~asK  161 (261)
T PRK12428         82 GPPELVARVNFLGLRHLTEALLPRLAPGGAIVNVSSLAGAGWPERLELHKALAATASFDEGLAWLAEHPVALGTGYQLSK  161 (261)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             42889998988999999999999865287599960123311211014565553002124567888634776535899999


Q ss_pred             HHHHHHH----HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCC-CCCCEE-CCHHHHHHHHHHHHHHCCC---
Q ss_conf             4555543----200123456764203477778985034443113454322-211000-1024777799999995135---
Q gi|254780595|r  133 FNAEKEW----LAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV-KKNQVF-NRIRVEDVARCVIFLMTHH---  203 (289)
Q Consensus       133 ~~~E~~~----~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~-~~~~~~-~~ihv~Dva~~i~~l~~~~---  203 (289)
                      .+...+.    ..+...+|+.+-.+-|+.+.-|-   +..+......... ...... -+-.-+|+++++.+|....   
T Consensus       162 ~al~~~t~~~a~~~l~~~gIRvNaV~PG~i~T~~---~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~fLaSd~as~  238 (261)
T PRK12428        162 EALILWTMRQAQPWFGARGIRVNCVAPGPVETPI---LGQFRSMLGQERVDSDAKRLGRPATADEQAAVLVFLCSDAARW  238 (261)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHH---HHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             9999999999999974649779887406577755---7988865339899743067689809999999999994963257


Q ss_pred             -CCCCEECCCC
Q ss_conf             -5786162684
Q gi|254780595|r  204 -LGGIFNLSDD  213 (289)
Q Consensus       204 -~~~iyni~~~  213 (289)
                       -|+++++-.+
T Consensus       239 iTG~~i~VDGG  249 (261)
T PRK12428        239 INGVNLPVDGG  249 (261)
T ss_pred             CCCCEEECCCC
T ss_conf             36842882916


No 204
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=98.22  E-value=8.7e-06  Score=52.53  Aligned_cols=192  Identities=12%  Similarity=0.022  Sum_probs=101.3

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEE-CCHHHH----HHHHHCCCEE--EECCCCCCCH------HHHHHHCCCCEE
Q ss_conf             999888-8889999999998898899996-794463----4556449828--9806786402------346541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTT-RSVSNL----LTLKHKGISP--FLFADQKINN------LLREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~-r~~~~~----~~l~~~~~~~--~~~~~~~~~~------~~~~~~~~~~~v   68 (289)
                      .||||+ +=||..+++.|.++|++|+... |+..+.    ......+...  +..|..+.+.      .+......+|.+
T Consensus         6 alVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~idiL   85 (246)
T PRK12938          6 AYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVGEIDVL   85 (246)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99918586999999999998799899947998178999999998459978999678799999999999999975999899


Q ss_pred             EEEECCCCCC---C---EEECC-CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1---00012-21013----------4432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---D---PCIIS-MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~---~~~~~-~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++++-....   +   ..+.. +..++          ...+  .+-.++|.+||.+.+..           ......|+
T Consensus        86 VNNAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~-----------~~~~~~Y~  154 (246)
T PRK12938         86 VNNAGITRDVVFRKMTREDWTAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKG-----------QFGQTNYS  154 (246)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHHCCC-----------CCCCHHHH
T ss_conf             9898889998803499999999999985639999999998610328818999833664668-----------88863779


Q ss_pred             HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             5544555543200123---4567642034777789850-----3444311345432221100010247777999999951
Q gi|254780595|r  130 TQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .+|.....+.+.++.+   +|+.+-.+-|+.|--+-..     .+.++....+.        --+-.-+|+|+++.+|..
T Consensus       155 asKaal~~ltk~lA~Ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~~Pl--------~R~g~p~diA~~v~fL~S  226 (246)
T PRK12938        155 TAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPV--------RRLGSPEEIGSIVAWLAS  226 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHCCHHHHHHHHHCCCC--------CCCCCHHHHHHHHHHHHC
T ss_conf             999999999999999960439899999668798703011299999999846998--------898499999999999948


Q ss_pred             CC----CCCCEECCCC
Q ss_conf             35----5786162684
Q gi|254780595|r  202 HH----LGGIFNLSDD  213 (289)
Q Consensus       202 ~~----~~~iyni~~~  213 (289)
                      ..    .|+++.+-.+
T Consensus       227 ~~a~yiTG~~i~VdGG  242 (246)
T PRK12938        227 EESGFSTGADFSLNGG  242 (246)
T ss_pred             CHHCCCCCCEEEECCC
T ss_conf             1435964872887878


No 205
>PRK05876 short chain dehydrogenase; Provisional
Probab=98.21  E-value=2.8e-05  Score=49.65  Aligned_cols=196  Identities=12%  Similarity=0.044  Sum_probs=101.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCC--EEEECCCCCCCHH---H---HHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----5564498--2898067864023---4---6541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGI--SPFLFADQKINNL---L---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~--~~~~~~~~~~~~~---~---~~~~~~~~~v   68 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+...    .+...+.  ..+..|..+.++.   .   .+....+|.+
T Consensus         8 vavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~G~iDil   87 (275)
T PRK05876          8 GAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLLGHVDVV   87 (275)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79992826699999999999879989999798899999999998269847999788899999999999999984898851


Q ss_pred             EEEECCCCCC------CEEECC-CCCH----------HHH-HHH--CCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCCH
Q ss_conf             8761244433------100012-2101----------344-320--12334333320102-5762123453211234311
Q gi|254780595|r   69 VQCIKPSSEG------DPCIIS-MSKD----------FYK-FMP--HVKWIGYLSSTSIY-GNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        69 ~~~~~~~~~~------~~~~~~-~~~~----------~~~-~~~--~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~~  127 (289)
                      ++.++-....      +..+.. ..-|          +.- ..+  .-.+++++||.+-+ +.            -....
T Consensus        88 vnNAGi~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~lP~m~~~g~~G~IvntsS~agl~~~------------~~~~~  155 (275)
T PRK05876         88 FSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPN------------AGLGA  155 (275)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC------------CCCHH
T ss_conf             215744689872329999999987641389999999999999981999499996867753899------------99746


Q ss_pred             HHHHHHHHH----HHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC---CCCCCCCC---CEECCHHHHHHHHHHH
Q ss_conf             345544555----5432001234567642034777789850344431134---54322211---0001024777799999
Q gi|254780595|r  128 VATQRFNAE----KEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN---SLRLVKKN---QVFNRIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E----~~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~---~~~~~~~~---~~~~~ihv~Dva~~i~  197 (289)
                      |+.+|....    .+..++ ..+|+.+.++-|+.|-=|--..-.+.+...   ........   ..-..+-.+++|+.++
T Consensus       156 Y~asK~av~~lte~La~El-~~~gI~V~~l~Pg~V~T~m~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~vA~~v~  234 (275)
T PRK05876        156 YGVAKYGVVGLAETLAREV-TADGIGVSVLCPMVVETNLVANSERIRGAACAQSSTTGSPGPLPLQDDNLGVDDIAQLTA  234 (275)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHH
T ss_conf             9999999999999999985-112938999971889943466865236753454443345432011026999999999999


Q ss_pred             HHHCCCCCCCEECCC
Q ss_conf             995135578616268
Q gi|254780595|r  198 FLMTHHLGGIFNLSD  212 (289)
Q Consensus       198 ~l~~~~~~~iyni~~  212 (289)
                      ..++++  +-|.+..
T Consensus       235 ~~i~~~--~f~Il~h  247 (275)
T PRK05876        235 DAILAN--RLYVLPH  247 (275)
T ss_pred             HHHHCC--CEEEECC
T ss_conf             999609--8599884


No 206
>PRK08278 short chain dehydrogenase; Provisional
Probab=98.20  E-value=2.2e-05  Score=50.26  Aligned_cols=185  Identities=12%  Similarity=0.070  Sum_probs=96.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----------HHHHHHCCCEE--EECCCCCCCH---HHH---HH
Q ss_conf             3999888-888999999999889889999679446-----------34556449828--9806786402---346---54
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----------LLTLKHKGISP--FLFADQKINN---LLR---EK   61 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----------~~~l~~~~~~~--~~~~~~~~~~---~~~---~~   61 (289)
                      .+||||+ +=||..+++.|.++|++|....|+.+.           ...+...+.+.  +..|..+.+.   .+.   +.
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~   87 (273)
T PRK08278          8 TLFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAVAKTVER   87 (273)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             89994876599999999999879989999677222133454899999999974990899971179999999999999998


Q ss_pred             HCCCCEEEEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             11563278761244433---100012----21013----------4432--01233433332010257621234532112
Q gi|254780595|r   62 LYFTTHIVQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFV  122 (289)
Q Consensus        62 ~~~~~~v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~  122 (289)
                      ...+|.++++++.....   +.....    ...|+          ...+  .+-.++|.+||..-..   +.      ..
T Consensus        88 ~G~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~~~~~---~~------~~  158 (273)
T PRK08278         88 FGGIDICVNNASAINLTGTEDTPMKRFDLMQGINVRGTFLVSQACLPHLKKSANPHILTLSPPLNLD---PK------WF  158 (273)
T ss_pred             HCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---CC------CC
T ss_conf             5996299987866667507775189999999983559999998765676657997899988878746---87------77


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             34311345544555543200123---456764203477778985034443113454322211000102477779999999
Q gi|254780595|r  123 HPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       123 ~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      .+...|+.+|...+.+.+..+.+   +|+.+-.+-|.+...+  ..+.....+.. .+..      +---+|+|+++++|
T Consensus       159 ~~~~aY~asKaal~~ltrslA~Ela~~gIrVNaVaP~~~~~t--~~~~~~~~~~~-~l~R------~g~PediA~av~FL  229 (273)
T PRK08278        159 APHTAYTMAKYGMSLCTLGLAEEFREDGIAVNALWPRTMIAT--AAVQNLLGGDE-AMRR------SRTPEIMADAAHAI  229 (273)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCC--HHHHHHCCCCC-HHHC------CCCHHHHHHHHHHH
T ss_conf             884799999999999999999996030989999727981768--99984104721-2214------67889999999999


Q ss_pred             HCCCC
Q ss_conf             51355
Q gi|254780595|r  200 MTHHL  204 (289)
Q Consensus       200 ~~~~~  204 (289)
                      .....
T Consensus       230 ~Sd~a  234 (273)
T PRK08278        230 LTRPA  234 (273)
T ss_pred             HCCHH
T ss_conf             38753


No 207
>PRK06128 oxidoreductase; Provisional
Probab=98.20  E-value=8.2e-05  Score=46.98  Aligned_cols=193  Identities=11%  Similarity=0.065  Sum_probs=104.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH--HH----HHHHHCCCEEE--ECCCCCCCHHH-------HHHHCCC
Q ss_conf             3999888-88899999999988988999967944--63----45564498289--80678640234-------6541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS--NL----LTLKHKGISPF--LFADQKINNLL-------REKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~--~~----~~l~~~~~~~~--~~~~~~~~~~~-------~~~~~~~   65 (289)
                      .+||||+ .=||..++..|.+.|.+|....++.+  ..    ..+...+....  ..|.. +....       ......+
T Consensus        57 vAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvs-d~~~~~~~v~~~~~~~G~i  135 (300)
T PRK06128         57 KALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLK-DEAFCRQLVERAVKELGGL  135 (300)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCC-CHHHHHHHHHHHHHHHCCC
T ss_conf             589917366999999999998699999942995567899999999965981899974789-9999999999999980999


Q ss_pred             CEEEEEECCCCCCCEE----ECC----CCCHH----------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             3278761244433100----012----21013----------44320123343333201025762123453211234311
Q gi|254780595|r   66 THIVQCIKPSSEGDPC----IIS----MSKDF----------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        66 ~~v~~~~~~~~~~~~~----~~~----~~~~~----------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      |.++++++......+.    ...    +..|+          ...++.-.++|.+||...|...           .....
T Consensus       136 DiLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m~~gGsIInisSi~~~~~~-----------~~~~~  204 (300)
T PRK06128        136 DILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHLPPGASIINTGSIQSYQPS-----------PTLLD  204 (300)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCC-----------CCCHH
T ss_conf             9899899997789991779999999998661158999999999987538714787421240578-----------86177


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC----C---HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             345544555543200123---456764203477778985----0---344431134543222110001024777799999
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR----N---PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r----~---~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      |+.+|.+...+.+..+.+   +|+.+-.+-|+.|.-|-.    .   .+..+....+  +.      -+-.-+|+|.+++
T Consensus       205 Y~asKaav~~lTrslA~ela~~gIRVNaVaPG~i~T~l~~~~~~~~e~~~~~~~~~P--lg------R~g~PeEIA~~v~  276 (300)
T PRK06128        205 YASTKAAIVNFTKGLAQQVAEKGIRVNAVAPGPVWTPLQPSGGQPPEKIPDFGSETP--MK------RAGQPVEMAPLYV  276 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCC--CC------CCCCHHHHHHHHH
T ss_conf             899999999999999999741697999996188987120016999999999983699--89------9839999999999


Q ss_pred             HHHCCC----CCCCEECCCCC
Q ss_conf             995135----57861626843
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~~  214 (289)
                      +|....    .|+++++-.|-
T Consensus       277 FLaSd~asyiTGq~i~VDGG~  297 (300)
T PRK06128        277 LLASQESSYVTGEVFGATGGL  297 (300)
T ss_pred             HHHCCHHCCCCCCEEEECCCH
T ss_conf             995824258558548968683


No 208
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.19  E-value=8.2e-05  Score=46.96  Aligned_cols=201  Identities=14%  Similarity=0.056  Sum_probs=101.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCH-HHH----HHHHHCCC--EEEECCCCCCCHH------HHHHHCCCCE
Q ss_conf             3999888-8889999999998898899996794-463----45564498--2898067864023------4654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSV-SNL----LTLKHKGI--SPFLFADQKINNL------LREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~-~~~----~~l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~   67 (289)
                      .+||||+ .=||..++.+|.++|++|....++. +..    ..+...+.  ..+..|..+.++.      ..+....+|.
T Consensus         5 valITGgs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iDi   84 (249)
T PRK06077          5 VVVVTGSGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEGIGVLADVSTREGCRTLAKAALDNFGVVDI   84 (249)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89992636789999999999879989998488768999999999975995899984799999999999999998199888


Q ss_pred             EEEEECCCCCC---CEEECC----CCCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             78761244433---100012----2101----------344320123343333201025762123453211234311345
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----MSKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++++++.....   +.....    +..+          ....+..-.++|.+||..-+-           +......|+.
T Consensus        85 LVnNAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~IInisS~~~~~-----------~~~~~~~Y~a  153 (249)
T PRK06077         85 LVNNAGLGLFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVMREGGEIINIASIAGIR-----------PFVGLSIYGA  153 (249)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHCC-----------CCCCCHHHHH
T ss_conf             99857757887501099999999998862189999999999961697899826765456-----------8999778999


Q ss_pred             HHHHHHHHHHHCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEE-CCHHHHHHHHHHHHHHCCC--CC
Q ss_conf             54455554320012345--6764203477778985034443113454322211000-1024777799999995135--57
Q gi|254780595|r  131 QRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHH--LG  205 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~~~--~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~-~~ihv~Dva~~i~~l~~~~--~~  205 (289)
                      +|.....+.+..+.+.+  +++..+=|+.|--|-...+.................. -+...+|+++++.+|....  -|
T Consensus       154 sKaal~~ltr~lA~ela~~IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~R~~~peeia~~v~fLas~~~iTG  233 (249)
T PRK06077        154 MKAAVINLTQYLALELAPRIRVNAVAPGVVKTKMGESLVKLLGMTEEEFAKKHTLTGKILDPEDVAELVWALVKIESITG  233 (249)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999999999986998899998468987425555540486789998607987897399999999999964589998


Q ss_pred             CCEECCCC
Q ss_conf             86162684
Q gi|254780595|r  206 GIFNLSDD  213 (289)
Q Consensus       206 ~iyni~~~  213 (289)
                      +++.+-.+
T Consensus       234 q~i~VDGG  241 (249)
T PRK06077        234 QVIVIDSG  241 (249)
T ss_pred             CEEEECCC
T ss_conf             83886826


No 209
>PRK12744 short chain dehydrogenase; Provisional
Probab=98.18  E-value=6.3e-05  Score=47.63  Aligned_cols=198  Identities=12%  Similarity=0.059  Sum_probs=97.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH----H----HHHHHCCCEE--EECCCCCCCHHHH-------HHHC
Q ss_conf             3999888-888999999999889889999679446----3----4556449828--9806786402346-------5411
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN----L----LTLKHKGISP--FLFADQKINNLLR-------EKLY   63 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~----~----~~l~~~~~~~--~~~~~~~~~~~~~-------~~~~   63 (289)
                      .+||||+ +=||..+++.|.++|.+|..+.++.+.    .    ..++..+...  +..|..+. ..+.       +...
T Consensus        10 valVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~-~~v~~~~~~~~~~~G   88 (257)
T PRK12744         10 VVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTA-AAVEKLFDDAKAAFG   88 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCC
T ss_conf             8999288758999999999987998999937874368999999999997399289997688999-999999999999809


Q ss_pred             CCCEEEEEECCCCCC---CEEECC----CCCH----------HHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             563278761244433---100012----2101----------34432012334333320102576212345321123431
Q gi|254780595|r   64 FTTHIVQCIKPSSEG---DPCIIS----MSKD----------FYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        64 ~~~~v~~~~~~~~~~---~~~~~~----~~~~----------~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      .+|.++++++.....   +.....    ...+          ....+..-.++|.++|++.-..         .|  ...
T Consensus        89 ~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~ii~i~ss~~~~~---------~~--~~~  157 (257)
T PRK12744         89 RPDIAINTVGKVLKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHLNDNGKIVTLVTSLLGAF---------TP--FYS  157 (257)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC---------CC--CHH
T ss_conf             9889997664456772333228888889888876699999999998741894999981154467---------89--518


Q ss_pred             HHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCC---CCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             134554455554320012---345676420347777898---50344431134543222110001024777799999995
Q gi|254780595|r  127 CVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPK---RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~---r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      .|+.+|...+.+.+..+.   .+|+.+-.+-|+.|--|-   ...-.............+-...-+...+|++.++.+|.
T Consensus       158 ~Y~asKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pedia~~v~fLa  237 (257)
T PRK12744        158 AYAGSKAPVEHFTRAASKEFGARGISVTAVGPGPMDTPFFYPQEGAEAVAYHKTAAALSPFSKTGLTDIEDIVPFIRFLV  237 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             89999999999999999996544969999963889877657655704577777888628768899999999999999994


Q ss_pred             CCC---CCCCEECC
Q ss_conf             135---57861626
Q gi|254780595|r  201 THH---LGGIFNLS  211 (289)
Q Consensus       201 ~~~---~~~iyni~  211 (289)
                      ...   -|+++.+-
T Consensus       238 Sda~~iTGq~i~VD  251 (257)
T PRK12744        238 TDGWWITGQTILIN  251 (257)
T ss_pred             CCCCCCCCCEEEEC
T ss_conf             75888329838979


No 210
>PRK12937 short chain dehydrogenase; Provisional
Probab=98.17  E-value=3.8e-05  Score=48.86  Aligned_cols=191  Identities=11%  Similarity=0.017  Sum_probs=101.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-H----HHHHHCCC--EEEECCCCCCCHH------HHHHHCCCCE
Q ss_conf             3999888-888999999999889889999679446-3----45564498--2898067864023------4654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-L----LTLKHKGI--SPFLFADQKINNL------LREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-~----~~l~~~~~--~~~~~~~~~~~~~------~~~~~~~~~~   67 (289)
                      .+||||+ +=||..++++|.++|++|....++.+. .    ..+...+.  ..+..|..+.+..      ..+....+|.
T Consensus         7 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~~g~iDi   86 (245)
T PRK12937          7 VAIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETAFGRIDV   86 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89994857789999999999879999997699868999999999965995899983789999999999999998199889


Q ss_pred             EEEEECCCCCC---CEEECC----C----------CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             78761244433---100012----2----------101344320123343333201025762123453211234311345
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----M----------SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~----------~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++++++.....   +.....    .          .+.....+.+-.++|.+||......           ......|+.
T Consensus        87 lVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~G~IInisS~~~~~~-----------~~~~~~Y~a  155 (245)
T PRK12937         87 LVNSAGIMPLAPIADGDLEGFDRTIAVNLRGAFNVLGEAARHLRRGGRIINLSTSVIARA-----------LPGYGPYAA  155 (245)
T ss_pred             EEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCCC-----------CCCCHHHHH
T ss_conf             998054899988134999999999999859999999999999972882999973000578-----------999488999


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-C-----CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             544555543200123---45676420347777898-5-----03444311345432221100010247777999999951
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-R-----NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r-----~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      +|...+.+.+..+.+   +++.+-.+-|+.+--+- .     .....+.+..+        .--+..-+|+++++.+|..
T Consensus       156 sKaav~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~e~~~~~~~~~P--------l~R~g~pedia~~v~fL~S  227 (245)
T PRK12937        156 SKAAVEGLVHVLANELRGRGITVNAVAPGPTATELFFNGKSPEQIDQLARLAP--------LERLGEPDEIAAAVAFLAG  227 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCC--------CCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999960519299999764588755436799999999985699--------9998399999999999968


Q ss_pred             CC----CCCCEECC
Q ss_conf             35----57861626
Q gi|254780595|r  202 HH----LGGIFNLS  211 (289)
Q Consensus       202 ~~----~~~iyni~  211 (289)
                      ..    -|+++.+-
T Consensus       228 ~~a~~iTG~~i~VD  241 (245)
T PRK12937        228 PDGAWVNGQVLRVN  241 (245)
T ss_pred             CHHCCCCCCEEEEC
T ss_conf             70249138736857


No 211
>PRK05854 short chain dehydrogenase; Provisional
Probab=98.17  E-value=3.5e-05  Score=49.10  Aligned_cols=158  Identities=9%  Similarity=0.000  Sum_probs=86.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHH----H----HCCCEEEECCCCCCCHH------HHHHHCCCC
Q ss_conf             3999888-8889999999998898899996794463455----6----44982898067864023------465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTL----K----HKGISPFLFADQKINNL------LREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l----~----~~~~~~~~~~~~~~~~~------~~~~~~~~~   66 (289)
                      .++|||+ .=||...++.|.++|++|+...|+.++....    .    ...+..+..|..+.+..      +......+|
T Consensus        16 ~~vITGa~sGIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~~~~lD   95 (314)
T PRK05854         16 LAVVTGASSGLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAEGRPIH   95 (314)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             89990688299999999999784989999799999999999999868998569996463168999999998753068752


Q ss_pred             EEEEEECCCC--CC----CEEECCCCCH----------HHHH-HHCCCCCCCCCCEEECCCC-CCCCCCCCCCCCCCCHH
Q ss_conf             2787612444--33----1000122101----------3443-2012334333320102576-21234532112343113
Q gi|254780595|r   67 HIVQCIKPSS--EG----DPCIISMSKD----------FYKF-MPHVKWIGYLSSTSIYGNR-EGQWVDEHSFVHPISCV  128 (289)
Q Consensus        67 ~v~~~~~~~~--~~----~~~~~~~~~~----------~~~~-~~~~~~~i~~SS~~VYg~~-~g~~i~E~~~~~P~~~y  128 (289)
                      .+++.++-..  ..    |..-..+..|          +... ...-.|+|.+||.+.+... .-..++-+....|...|
T Consensus        96 iLInNAGv~~~~~~~~T~dG~E~~f~vN~LghflLt~~Llp~l~~~~~RIV~vsS~~~~~~~i~~~dl~~~~~y~~~~aY  175 (314)
T PRK05854         96 LLINNAGVMTPPERQTTADGFELQFGTNHLGHFALTAHLLPLLRAGRARVTSQSSIAARRGRINFDDLNFERSYAPMTAY  175 (314)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             78726766658865405776366555345778889887787632578705664342011577654568864568861888


Q ss_pred             HHHHHHHHHHHHHCCCC---C--CCCCCCCCCCCCC
Q ss_conf             45544555543200123---4--5676420347777
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---L--NIKLAVLRLSGIY  159 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~--~~~~~ilR~~~iy  159 (289)
                      +.+|++.--...+..+.   .  ++.+..+.|+.+.
T Consensus       176 ~~SKlanilf~~eLarr~~~~~~~v~~~~vhPG~v~  211 (314)
T PRK05854        176 GQSKLAVLMFALELDRRSRAAGWGITSNAAHPGLAK  211 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             899999999999998652406989799997998435


No 212
>PRK06123 short chain dehydrogenase; Provisional
Probab=98.16  E-value=9.4e-05  Score=46.64  Aligned_cols=193  Identities=16%  Similarity=0.151  Sum_probs=101.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEEC-CHHHHH----HHHHCCCEE--EECCCCCCCH------HHHHHHCCCCEE
Q ss_conf             999888-88899999999988988999967-944634----556449828--9806786402------346541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTR-SVSNLL----TLKHKGISP--FLFADQKINN------LLREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r-~~~~~~----~l~~~~~~~--~~~~~~~~~~------~~~~~~~~~~~v   68 (289)
                      +||||+ +=||..+++.|.++|++|....| +.+...    .+...+...  +..|..+.+.      ...+....+|.+
T Consensus         6 alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDiL   85 (249)
T PRK06123          6 MIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDRELGRLDAL   85 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968687999999999998799899980898789999999999649909999847999999999999999982998789


Q ss_pred             EEEECCCCCC---CEE-ECCC----CCHH----------HHHHH--C---CCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8761244433---100-0122----1013----------44320--1---233433332010257621234532112343
Q gi|254780595|r   69 VQCIKPSSEG---DPC-IISM----SKDF----------YKFMP--H---VKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        69 ~~~~~~~~~~---~~~-~~~~----~~~~----------~~~~~--~---~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      +++++.....   +.. ....    ..++          ...+.  +   ...+|.+||..-.  . +.       +...
T Consensus        86 VnNAG~~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~~~~~~~m~~~~~g~~g~IInisS~~~~--~-~~-------~~~~  155 (249)
T PRK06123         86 VNNAGILEAQMRLEQMDAARLTRIFATNVVGSFLCAREAVKRMSTRHGGRGGAIVNVSSMAAR--L-GS-------PGEY  155 (249)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC--C-CC-------CCCH
T ss_conf             988855789997212999999999854069999999999999999708998379997447656--5-89-------8306


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             11345544555543200123---456764203477778985------034443113454322211000102477779999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      ..|+.+|...+.+.+.++++   +|+.+-.+-|+.|.-+-.      ....++....+..        -+-..+|+|+++
T Consensus       156 ~~Y~asKaav~~ltr~lA~ela~~gIrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~ipl~--------R~g~pedvA~~v  227 (249)
T PRK06123        156 IDYAASKGAIDTMTIGLAKEVAAEGIRVNAVRPGVIYTEIHASGGEPGRVDRVKAGIPMG--------RGGTAEEVARAI  227 (249)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHH
T ss_conf             878999999999999999998655969999986789774321259979999998579989--------983999999999


Q ss_pred             HHHHCCC----CCCCEECCCC
Q ss_conf             9995135----5786162684
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~~  213 (289)
                      .+|....    -|++..+-.|
T Consensus       228 ~fL~S~~s~~iTGq~i~VdGG  248 (249)
T PRK06123        228 LWLLSDEASYTTGTFIDVSGG  248 (249)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999686225865855784899


No 213
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=98.15  E-value=3.7e-05  Score=48.98  Aligned_cols=158  Identities=13%  Similarity=0.086  Sum_probs=85.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH------CCCEEEECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             3999888-888999999999889889999679446345564------4982898067864023------46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH------KGISPFLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~------~~~~~~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      .|+|||+ .=||...++.|.++|++|+...|+.++......      ..++.+..|..+...+      +......+|.+
T Consensus         8 TvvITGansGIG~eta~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~~~~lDLssl~SVr~~a~~~~~~~~~lDiL   87 (322)
T PRK07453          8 TVLITGASSGVGLYAAKALAKRGWHVIMACRSLKKAEAAAQELGIPPDSYTIIHIDLGDLDSVRRFVDDFRALGKPLDAL   87 (322)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             39996888689999999999789989999799999999999961889877999898899999999999999865984089


Q ss_pred             EEEECC---C-C----CCCEEECCCCCH----------HHHHHH----CCCCCCCCCCEEECCCC-CCCC-----CC---
Q ss_conf             876124---4-4----331000122101----------344320----12334333320102576-2123-----45---
Q gi|254780595|r   69 VQCIKP---S-S----EGDPCIISMSKD----------FYKFMP----HVKWIGYLSSTSIYGNR-EGQW-----VD---  117 (289)
Q Consensus        69 ~~~~~~---~-~----~~~~~~~~~~~~----------~~~~~~----~~~~~i~~SS~~VYg~~-~g~~-----i~---  117 (289)
                      ++.++-   . .    ..|-.-..+..|          +...+.    ...|+|.+||..-.... .+..     .|   
T Consensus        88 InNAGv~~p~~~~~~~T~dG~E~~f~vNhLghFlLt~lLlp~L~~s~~~~~RIV~vsS~~h~~~~~~~~~~~p~~~d~~d  167 (322)
T PRK07453         88 VCNAAVYKPLLKEPLRSPQGYELSMATNHLGHFLLCNLLLEDLKKSPAPDPRLVILGTVTANPKELGGKIPIPAPADLGD  167 (322)
T ss_pred             EECCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHCCCCCCCCCCCCCCCCCCH
T ss_conf             86565446556787345887634543105889999998899997278999818998122432302377556677777202


Q ss_pred             ---------------CCCCCCCCCHHHHHHHHHHHHHHHCC----CCCCCCCCCCCCCCCC
Q ss_conf             ---------------32112343113455445555432001----2345676420347777
Q gi|254780595|r  118 ---------------EHSFVHPISCVATQRFNAEKEWLAIT----KKLNIKLAVLRLSGIY  159 (289)
Q Consensus       118 ---------------E~~~~~P~~~y~~~k~~~E~~~~~~~----~~~~~~~~ilR~~~iy  159 (289)
                                     +.....|...|+++|++.=-...++.    +..++.+..+-|+.|.
T Consensus       168 l~~~~~~~~~~~~~~~~~~y~~~~aY~~SKlanilf~~eL~rrl~~~~~i~~~a~hPG~V~  228 (322)
T PRK07453        168 LSGFEAGFKAPISMADGKKFKPGKAYKDSKLCNMLTMRELHRRYHESTGITFSSLYPGCVA  228 (322)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCEE
T ss_conf             3455531467310125775780878999999999999999986124789379971782411


No 214
>PRK07063 short chain dehydrogenase; Provisional
Probab=98.15  E-value=1.5e-05  Score=51.19  Aligned_cols=200  Identities=14%  Similarity=0.049  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HH-HCCC--EEEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----56-4498--289806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LK-HKGI--SPFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~-~~~~--~~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.++...    +. ..+.  ..+..|..+. ..+.       +....+|
T Consensus         9 valVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dvt~~-~~v~~~v~~~~~~~G~iD   87 (259)
T PRK07063          9 VALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARVLALPADVTRA-ASVRAAVARAEAAFGPLD   87 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCC
T ss_conf             8999587878999999999987998999979878999999999885099189998368999-999999999999819988


Q ss_pred             EEEEEECCCCCCCE------EEC-CCCCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             27876124443310------001-221013-------44320-----123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEGDP------CII-SMSKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~~~------~~~-~~~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      .++++++.......      .+. .+..++       .+..+     +-.++|.+||..-+-   +        ......
T Consensus        88 iLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~---~--------~~~~~~  156 (259)
T PRK07063         88 VLVNNAGINVFADPLAMTDEDWRRCFAVDLDGAWNCCRAVLPGMVERGRGSIVNIASTHAFK---I--------IPGCFP  156 (259)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---C--------CCCCHH
T ss_conf             99989977899990449999999999875288999999999999986996699987766567---7--------999667


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC-CHHHHHHC--CCCCCCCCCCCEE-CCHHHHHHHHHHHHHH
Q ss_conf             34554455554320012---3456764203477778985-03444311--3454322211000-1024777799999995
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR-NPFIKIRQ--KNSLRLVKKNQVF-NRIRVEDVARCVIFLM  200 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r-~~~~~~~~--g~~~~~~~~~~~~-~~ihv~Dva~~i~~l~  200 (289)
                      |+.+|.....+.+..+.   .+|+.+-.+-|+.|.-|-- ..+.....  ....... ..... -+-.-+|+|+++++|.
T Consensus       157 Y~asKaav~~lTr~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~-~~~Pl~R~g~peeiA~~v~FLa  235 (259)
T PRK07063        157 YPVAKHGLLGLTRALGIEYAARNVRVNAIAPGYIETQLTEDWWNAQPDPAAARAETL-ALQPMKRIGRPEEVAMTAVFLA  235 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHH-HCCCCCCCCCHHHHHHHHHHHH
T ss_conf             999999999999999999714192999897677987768988752799899999998-2799999778999999999995


Q ss_pred             CCC----CCCCEECCCCC
Q ss_conf             135----57861626843
Q gi|254780595|r  201 THH----LGGIFNLSDDE  214 (289)
Q Consensus       201 ~~~----~~~iyni~~~~  214 (289)
                      ...    -|+++.+-.+.
T Consensus       236 Sd~as~iTG~~i~VDGG~  253 (259)
T PRK07063        236 SDEAPFINATCITIDGGR  253 (259)
T ss_pred             CCHHCCCCCCEEEECCCH
T ss_conf             865258248718988196


No 215
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=98.12  E-value=8.7e-05  Score=46.83  Aligned_cols=193  Identities=13%  Similarity=0.105  Sum_probs=100.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHH----HHHHCCCEE--EECCCCCCCHH------HHHHHCCCCEE
Q ss_conf             999888-888999999999889889999-67944634----556449828--98067864023------46541156327
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLL----TLKHKGISP--FLFADQKINNL------LREKLYFTTHI   68 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~----~l~~~~~~~--~~~~~~~~~~~------~~~~~~~~~~v   68 (289)
                      ++|||+ +=||..+++.|.++|++|... .|+.+...    .++..+...  +..|..+....      .......+|.+
T Consensus         9 alVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iD~l   88 (252)
T PRK06947          9 VLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAFGRLDAL   88 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99938835899999999998799899980898789999999999649928999847999999999999999984998899


Q ss_pred             EEEECCCCCCCE----EECCCC----CHH----------HHHHHC-----CCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             876124443310----001221----013----------443201-----233433332010257621234532112343
Q gi|254780595|r   69 VQCIKPSSEGDP----CIISMS----KDF----------YKFMPH-----VKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        69 ~~~~~~~~~~~~----~~~~~~----~~~----------~~~~~~-----~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      +++++......+    ....+.    .++          ...+..     ..++|++||....-   +.       +.+.
T Consensus        89 VnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~~~~g~IinisS~~~~~---~~-------~~~~  158 (252)
T PRK06947         89 VNNAGIVAPSMPLADMDAARLRRMFDTNVLGAYLCAREAARRLSTDRGGRGGAIVNVSSIASRL---GS-------PNEY  158 (252)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCC---CC-------CCCH
T ss_conf             9876435799981239999999999998579999999999999984579985899985665455---88-------8730


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             11345544555543200123---456764203477778985------034443113454322211000102477779999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      ..|+.+|...+.+.+.++.+   +|+.+-.+-|+.|--|-.      ....++....+..        -+-..+|+++++
T Consensus       159 ~~Y~~sK~al~~ltr~lA~e~a~~gIrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~--------R~g~p~dIa~~v  230 (252)
T PRK06947        159 VDYAGSKGAVDTLTLGLAKELGPHGVRVNAVRPGLIETEIHASGGQPGRAARLGAQTPLG--------RAGEADEVAEAI  230 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC--------CCCCHHHHHHHH
T ss_conf             667999999999999999997462928998971158775422369969999998379999--------981999999999


Q ss_pred             HHHHCCCC----CCCEECCCC
Q ss_conf             99951355----786162684
Q gi|254780595|r  197 IFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       197 ~~l~~~~~----~~iyni~~~  213 (289)
                      .+|+....    |++..+-.|
T Consensus       231 ~fL~Sd~s~~iTGq~i~VdGG  251 (252)
T PRK06947        231 VWLLSDAASYVTGALLDVGGG  251 (252)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999687114865853784899


No 216
>PRK07069 short chain dehydrogenase; Validated
Probab=98.11  E-value=1.9e-05  Score=50.62  Aligned_cols=201  Identities=14%  Similarity=0.123  Sum_probs=100.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH-H----HHHHCC---C-EEEECCCCCCCH------HHHHHHCCC
Q ss_conf             3999888-8889999999998898899996794463-4----556449---8-289806786402------346541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL-L----TLKHKG---I-SPFLFADQKINN------LLREKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~-~----~l~~~~---~-~~~~~~~~~~~~------~~~~~~~~~   65 (289)
                      |-||||+ +=||..+++.|.++|.+|....|+.++. .    .+....   . ..+..|..+.+.      ........+
T Consensus         1 ~AlVTGgs~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~i   80 (251)
T PRK07069          1 RAFITGAAGGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAAHGEGVAFAAVQDVTDEAQWQALLAQAADAMGGL   80 (251)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             97998557889999999999869999999689435899999999861599639999577999999999999999982999


Q ss_pred             CEEEEEECCCCCCC-------EEECCCCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             32787612444331-------0001221013----------44320--12334333320102576212345321123431
Q gi|254780595|r   66 THIVQCIKPSSEGD-------PCIISMSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        66 ~~v~~~~~~~~~~~-------~~~~~~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      |.++++++-.....       .....+..++          ...+.  ...++|.+||..-+-...           -..
T Consensus        81 DilVNnAGi~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~-----------~~~  149 (251)
T PRK07069         81 SVLVNNAGVGSFGAIEQIELDEWRRVMAINVESIVLGCKHALPYLRASQPASIVNISSVAAFKAEP-----------DYT  149 (251)
T ss_pred             CEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-----------CCH
T ss_conf             899989999999990349999999999999789999999999999966997899928675457799-----------966


Q ss_pred             HHHHHHHHHHHHHHHCCCCC---CCCC--CCCCCCCCCCCCCCH-HHHHHCCCCCCCCCCCCEECC-HHHHHHHHHHHHH
Q ss_conf             13455445555432001234---5676--420347777898503-444311345432221100010-2477779999999
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKKL---NIKL--AVLRLSGIYGPKRNP-FIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFL  199 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~~---~~~~--~ilR~~~iyGp~r~~-~~~~~~g~~~~~~~~~~~~~~-ihv~Dva~~i~~l  199 (289)
                      .|+.+|.....+.+..+.+.   |+.+  -.+-|+.+-.|--.. +..+................+ -..+|+++++.+|
T Consensus       150 ~Y~asKaal~~ltk~lA~el~~~gi~IrvN~i~Pg~i~T~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL  229 (251)
T PRK07069        150 AYNASKAAVASLTKSIALDCARRGLDVRCNSIHPAFIRTGIVDPIFRRLGEEEATRKLARGIPLGRLGEPDDVAHAVLYL  229 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             89999999999999999998771996899998868688635578876138499999998579999985899999999999


Q ss_pred             HCCCC----CCCEECCCC
Q ss_conf             51355----786162684
Q gi|254780595|r  200 MTHHL----GGIFNLSDD  213 (289)
Q Consensus       200 ~~~~~----~~iyni~~~  213 (289)
                      .....    |++.++-.|
T Consensus       230 ~Sd~s~~iTG~~i~VDGG  247 (251)
T PRK07069        230 ASDESRFVTGAELVIDGG  247 (251)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             585424825861773824


No 217
>PRK08226 short chain dehydrogenase; Provisional
Probab=98.10  E-value=4.1e-05  Score=48.70  Aligned_cols=200  Identities=14%  Similarity=0.023  Sum_probs=104.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH---HHHHHCCC--EEEECCCCCCCH---HH---HHHHCCCCEEE
Q ss_conf             3999888-8889999999998898899996794463---45564498--289806786402---34---65411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL---LTLKHKGI--SPFLFADQKINN---LL---REKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~---~~l~~~~~--~~~~~~~~~~~~---~~---~~~~~~~~~v~   69 (289)
                      .+||||+ +=||..+++.|.+.|.+|....|+++..   ..+...+.  ..+..|..+.+.   .+   .+....+|.++
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLV   87 (263)
T PRK08226          8 TALITGALQGIGEGIARVFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKEGRIDILV   87 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89994737799999999999879989999698799999999983699179999417999999999999999839986999


Q ss_pred             EEECCCCCC---C---EEEC-CCCCHH----------HHHH--HCCCCCCCCCCEE-ECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             761244433---1---0001-221013----------4432--0123343333201-02576212345321123431134
Q gi|254780595|r   70 QCIKPSSEG---D---PCII-SMSKDF----------YKFM--PHVKWIGYLSSTS-IYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        70 ~~~~~~~~~---~---~~~~-~~~~~~----------~~~~--~~~~~~i~~SS~~-VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      ++++.....   +   ..+. .+..++          ...+  .+-.++|.+||.. .+.   +.        .....|+
T Consensus        88 NNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~g~~~---~~--------~~~~~Y~  156 (263)
T PRK08226         88 NNAGVCRLGNFLDMSDEDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMV---AD--------PGETAYA  156 (263)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCC---CC--------CCCHHHH
T ss_conf             899778999901299999999999972999999999999999838998999976533044---89--------9738899


Q ss_pred             HHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCC--------CCCCCCEECCHHHHHHHHHHHH
Q ss_conf             554455554320012---34567642034777789850344431134543--------2221100010247777999999
Q gi|254780595|r  130 TQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR--------LVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~--------~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      .+|.....+.+..+.   .+|+.+-.+-|+.|--|-   ...+.......        +.+.-..--+-..+|+++++.+
T Consensus       157 asKaav~~lTr~lA~Ela~~gIrVNaVaPG~i~T~~---~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~F  233 (263)
T PRK08226        157 LTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPM---AESIARQSNPEDPESVLTEMAKAIPLRRLADPLEVGELAAF  233 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHH---HHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             999999999999999962429599999758898768---99998632754689999999847999997789999999999


Q ss_pred             HHCCC----CCCCEECCCCCH
Q ss_conf             95135----578616268433
Q gi|254780595|r  199 LMTHH----LGGIFNLSDDEP  215 (289)
Q Consensus       199 l~~~~----~~~iyni~~~~~  215 (289)
                      |....    -|+++.+-.+..
T Consensus       234 LaSd~a~yiTG~~i~VDGG~t  254 (263)
T PRK08226        234 LASDESSYLTGTQNVIDGGST  254 (263)
T ss_pred             HHCCHHCCCCCCEEEECCCCC
T ss_conf             958363480488288588830


No 218
>PRK08589 short chain dehydrogenase; Validated
Probab=98.10  E-value=8e-05  Score=47.05  Aligned_cols=197  Identities=15%  Similarity=0.084  Sum_probs=102.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH---HHHHHHCC--CEEEECCCCCCCHH------HHHHHCCCCEEE
Q ss_conf             3999888-888999999999889889999679446---34556449--82898067864023------465411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN---LLTLKHKG--ISPFLFADQKINNL------LREKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~---~~~l~~~~--~~~~~~~~~~~~~~------~~~~~~~~~~v~   69 (289)
                      .+||||+ +=||..+++.|.++|.+|....++...   ...+...+  ...+..|..+....      ..+....+|.++
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~~~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLV   87 (272)
T PRK08589          8 VAVITGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQFGHIDVLF   87 (272)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89997825699999999999869999998382789999999995599489999607999999999999999829987899


Q ss_pred             EEECCCCCC----CEEECCCC----CHH----------HH-HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             761244433----10001221----013----------44-320123343333201025762123453211234311345
Q gi|254780595|r   70 QCIKPSSEG----DPCIISMS----KDF----------YK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        70 ~~~~~~~~~----~~~~~~~~----~~~----------~~-~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++++-....    +.......    .++          .. ..++-.++|.+||.+-+.   +        ......|+.
T Consensus        88 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gG~IVnisS~~g~~---~--------~~~~~~Y~a  156 (272)
T PRK08589         88 NNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLMMEQGGSIINTSSFSGQA---A--------DLYRSGYNA  156 (272)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC---C--------CCCCHHHHH
T ss_conf             89866788887100999999999999829999999999999997599079991234367---7--------898668999


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH---------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHH
Q ss_conf             544555543200123---456764203477778985034---------44311345432221100010247777999999
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF---------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF  198 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~---------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~  198 (289)
                      +|.....+.+..+.+   +|+.+-.+-|+.|.-|--..+         ..++.......+-+    -+-.-+|+|+++.+
T Consensus       157 sKaal~~lTr~lA~E~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~Plg----R~g~peeiA~~v~F  232 (272)
T PRK08589        157 AKGAVINFTKSIAIEYGRDGIRANAIAPGTIETPLVDKLTGTSEDEAGKTFRENQKWMTPLG----RLGKPEEVAKLVVF  232 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCC----CCCCHHHHHHHHHH
T ss_conf             99999999999999972259399999648898645766534774788999998754478978----97789999999999


Q ss_pred             HHCCCC----CCCEECCCC
Q ss_conf             951355----786162684
Q gi|254780595|r  199 LMTHHL----GGIFNLSDD  213 (289)
Q Consensus       199 l~~~~~----~~iyni~~~  213 (289)
                      |.....    |+++.+-.+
T Consensus       233 LaSd~asyiTG~~i~VDGG  251 (272)
T PRK08589        233 LASDDSSFITGETIRIDGG  251 (272)
T ss_pred             HHCCHHCCCCCCEEEECCC
T ss_conf             8185217836854898908


No 219
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=98.09  E-value=4.9e-05  Score=48.28  Aligned_cols=191  Identities=15%  Similarity=0.068  Sum_probs=99.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEEC-CHHHHH----HHHHCCC--EEEECCCCCCCH---HH---HHHHCCCCE
Q ss_conf             3999888-88899999999988988999967-944634----5564498--289806786402---34---654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTR-SVSNLL----TLKHKGI--SPFLFADQKINN---LL---REKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r-~~~~~~----~l~~~~~--~~~~~~~~~~~~---~~---~~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|.+|....+ +.+...    .+...+.  ..+..|..+.+.   .+   .+....+|.
T Consensus         8 valVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~~G~iDi   87 (247)
T PRK12935          8 VAIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNHFGKVDI   87 (247)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89991727689999999999879989997699989999999999843995899985799999999999999998399989


Q ss_pred             EEEEECCCCCCC---EEECC----CCCHH---H----HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             787612444331---00012----21013---4----4320-----1233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPSSEGD---PCIIS----MSKDF---Y----KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~~~~~---~~~~~----~~~~~---~----~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++-.....   -....    ...++   .    +..+     +-.++|.+||..-.  ..         ......|
T Consensus        88 LVNNAGi~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~--~g---------~~~~~~Y  156 (247)
T PRK12935         88 LVNNAGITRDRTFKKLNREDWERVIDVNLSSVFNTTSAVLPYITEAEEGRIISISSIIGQ--AG---------GFGQTNY  156 (247)
T ss_pred             EEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--CC---------CCCCHHH
T ss_conf             998998899999044999999999999769999999997687422799528995554645--68---------9985899


Q ss_pred             HHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-C----HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             45544555543200123---456764203477778985-0----344431134543222110001024777799999995
Q gi|254780595|r  129 ATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-N----PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~----~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +.+|.....+.+.++.+   +++.+-.+-|+.|--|-- .    ...++....+    -+    -+-..+|+++++.+|.
T Consensus       157 ~asKaal~~ltk~lA~Ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~iP----l~----R~g~pediA~~v~fLa  228 (247)
T PRK12935        157 SAAKAGMLGFTKSLALELAKTNVTVNAICPGFIDTEMVAEVPEEVRQKIVAKIP----KK----RFGQADEIAKGVVYLC  228 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHCCHHHHHHHHHCCC----CC----CCCCHHHHHHHHHHHH
T ss_conf             999999999999999997140969999962778873223068999999985699----98----9859999999999995


Q ss_pred             CCCC---CCCEECC
Q ss_conf             1355---7861626
Q gi|254780595|r  201 THHL---GGIFNLS  211 (289)
Q Consensus       201 ~~~~---~~iyni~  211 (289)
                      ....   |+++.+-
T Consensus       229 sd~ayiTG~~i~VD  242 (247)
T PRK12935        229 RDGAYITGQQLNIN  242 (247)
T ss_pred             CCCCCCCCCEEEEC
T ss_conf             79765547858858


No 220
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=98.09  E-value=1.9e-05  Score=50.58  Aligned_cols=73  Identities=16%  Similarity=0.170  Sum_probs=50.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCC----CHHHHHHHCCCCEEEEEEC
Q ss_conf             939998888889999999998898899996794463455644982898067864----0234654115632787612
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI----NNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~----~~~~~~~~~~~~~v~~~~~   73 (289)
                      |||+|+|+|=||+.++..|.+.|++|+.+.|+++....+...|......+....    ...-.......|.|+.+..
T Consensus         1 MkI~IiGaGaiG~~~a~~L~~ag~~V~li~r~~~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~~~~~~D~iiv~vK   77 (307)
T PRK06522          1 MKIAILGAGAIGGLFGARLAQAGHDVTLVARGATLAEALNENGLRLLEGGEVFVVPVPAADDPAELGPQDLVILAVK   77 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCEEEECCCCEEECCCCCCCCHHHCCCCCEEEEECC
T ss_conf             98999991499999999998489988999788889999996893995289769805503488667489888999806


No 221
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=98.08  E-value=3.1e-05  Score=49.35  Aligned_cols=193  Identities=15%  Similarity=0.098  Sum_probs=102.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH--H-HHHHHHCCC--EEEECCCCCCCHH---H---HHHHCCCCEEE
Q ss_conf             3999888-88899999999988988999967944--6-345564498--2898067864023---4---65411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS--N-LLTLKHKGI--SPFLFADQKINNL---L---REKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~--~-~~~l~~~~~--~~~~~~~~~~~~~---~---~~~~~~~~~v~   69 (289)
                      .++|||+ +=||..+++.|.++|.+|....|+.+  . ...+...+.  ..+..|..+.+..   +   .+....+|.++
T Consensus        17 valVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~~~~~G~iDiLV   96 (258)
T PRK06935         17 VAIVTGGNTGLGQGYAVALAKAGADIIITTHGTNWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEALEKFGKIDILV   96 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             89994857589999999999879999997299789999999996699379999048999999999999999749999999


Q ss_pred             EEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             761244433---100012----21013----------4432--0123343333201025762123453211234311345
Q gi|254780595|r   70 QCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        70 ~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      ++++.....   +.....    +..++          ....  .+-.++|.+||..-+  ...       +  ....|+.
T Consensus        97 NNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~--~g~-------~--~~~~Y~a  165 (258)
T PRK06935         97 NNAGTIRRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKVMAKQGSGKIINIASMLSF--QGG-------K--FVPPYTA  165 (258)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHC--CCC-------C--CCHHHHH
T ss_conf             8999999998023999999999998647899999999999998389818999532016--788-------8--8766999


Q ss_pred             HHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             54455554320012---3456764203477778985034-------4431134543222110001024777799999995
Q gi|254780595|r  131 QRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       131 ~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +|.....+.+.++.   .+|+.+-.+-|+.|.-|....+       ..+....+    -+    -+-..+|+|+++.+|.
T Consensus       166 sKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~iP----lg----R~g~peeiA~~v~FLa  237 (258)
T PRK06935        166 SKHGVAGLTKAFANELAAYNIQVNAIAPGYIKTANTAPIRADKARNAEILKRIP----AG----RWGEPDDLMGAAVFLA  237 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCC----CC----CCCCHHHHHHHHHHHH
T ss_conf             999999999999999722698999985488978650112479999999995599----99----9778999999999983


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++.+-.|
T Consensus       238 Sd~s~~iTG~~i~VDGG  254 (258)
T PRK06935        238 SRASDYVNGHILAVDGG  254 (258)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84326912872897858


No 222
>PRK12367 short chain dehydrogenase; Provisional
Probab=98.08  E-value=1.5e-05  Score=51.23  Aligned_cols=72  Identities=18%  Similarity=0.119  Sum_probs=51.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888-88899999999988988999967944634556449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      +|.|||| |=+|++|.++|+++|.+|+|++.+..........+-...+.........+...+..+|.++...+
T Consensus        19 tIgITGAsGaLG~AL~k~f~~~GakVIalTh~~~~~~~~~~~~p~~wi~W~cG~E~~L~~~LkkiDILILNHG   91 (250)
T PRK12367         19 RIGITGASGALGKALTKLFRAKGAKVIGLTHSKINNSEISDESPNEWVSWECGKESSLDKTLAKIDVLILNHG   91 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHCCEEEECCC
T ss_conf             7999678738999999999988998999836888875455678952898434998999999875889998387


No 223
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=98.06  E-value=8.6e-05  Score=46.87  Aligned_cols=197  Identities=14%  Similarity=0.019  Sum_probs=103.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-HHHH----HHHHHCCCEE--EECCCCCCCHHH------HHHHCCCCE
Q ss_conf             3999888-888999999999889889999679-4463----4556449828--980678640234------654115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRS-VSNL----LTLKHKGISP--FLFADQKINNLL------REKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~-~~~~----~~l~~~~~~~--~~~~~~~~~~~~------~~~~~~~~~   67 (289)
                      .+||||+ +=||..+++.|.++|.+|....|. .+..    ..++..+.+.  +..|..+.+...      .+....+|.
T Consensus         9 valVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDi   88 (261)
T PRK08936          9 VVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKEFGTLDV   88 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89996847789999999999879999997289878999999999965993899982799999999999999998299889


Q ss_pred             EEEEECCCCCCCE---EECCC--------------CCHHHHHH-HC--CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             7876124443310---00122--------------10134432-01--23343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEGDP---CIISM--------------SKDFYKFM-PH--VKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~~~---~~~~~--------------~~~~~~~~-~~--~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++.......   .....              .+...... +.  ..++|.+||.+-..           +..+...
T Consensus        89 LVNNAg~~~~~~~~~~~~e~w~~~~~iNl~~~f~~~k~~~~~m~~~~~~G~IInisS~~~~~-----------~~~~~~~  157 (261)
T PRK08936         89 MINNAGIENAVPSHEMPLEDWNKVINTNLTGAFLGSREAIKYFVEHDIKGSIINMSSVHEQI-----------PWPLFVH  157 (261)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHCCC-----------CCCCCCH
T ss_conf             99899789998813399999999999971649999999999999818861478873310057-----------8998600


Q ss_pred             HHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-CHHH--HHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             345544555543200123---456764203477778985-0344--4311345432221100010247777999999951
Q gi|254780595|r  128 VATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-NPFI--KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-~~~~--~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      |+.+|...+.+.+..+.+   +|+.+-.+-|+.+-.|-. ..+.  ..+......++-+    -+-.-+|++.++.+|..
T Consensus       158 Y~asKaav~~ltk~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~----R~g~p~dIa~~v~FL~S  233 (261)
T PRK08936        158 YAASKGGVKLMTETLAMEYAPKGIRVNNIGPGAINTPINAEKFADPKQRADVESMIPMG----YIGKPEEIAAVAAWLAS  233 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHHC
T ss_conf             79999999999999999973539599999789898701211148999999998579989----98399999999999827


Q ss_pred             CCC----CCCEECCCC
Q ss_conf             355----786162684
Q gi|254780595|r  202 HHL----GGIFNLSDD  213 (289)
Q Consensus       202 ~~~----~~iyni~~~  213 (289)
                      ...    |+++.+-.|
T Consensus       234 ~~asyiTG~~i~VDGG  249 (261)
T PRK08936        234 SEASYVTGITLFADGG  249 (261)
T ss_pred             CHHCCCCCCEEEECCC
T ss_conf             4326833873887958


No 224
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=98.06  E-value=2.7e-05  Score=49.76  Aligned_cols=101  Identities=13%  Similarity=0.171  Sum_probs=60.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHH-----------HHCCCCEEE
Q ss_conf             939998888889999999998898899996794463455644982898067864023465-----------411563278
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE-----------KLYFTTHIV   69 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~v~   69 (289)
                      +||-|+|.||+|..++..|.+.||+|+|+.-++++...+..... ++.  ....+..+..           ....+|.++
T Consensus         4 kkI~ViGlGYVGL~~a~~lA~~G~~Vig~D~d~~kv~~l~~g~~-p~~--Ep~l~~ll~~~~~~~~l~~t~~~~~ad~ii   80 (415)
T PRK11064          4 ETISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINRGEI-HIV--EPDLDMVVKAAVEGGYLRATTTPVPADAFL   80 (415)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCC-CCC--CCCHHHHHHHHHHCCCCEEECCHHHCCEEE
T ss_conf             87999886877899999999688948999899999999978689-988--989899999998659836525746789999


Q ss_pred             EEECCCCCC--CEEE---CCCCCHHHHHHHCCCCCCCCCC
Q ss_conf             761244433--1000---1221013443201233433332
Q gi|254780595|r   70 QCIKPSSEG--DPCI---ISMSKDFYKFMPHVKWIGYLSS  104 (289)
Q Consensus        70 ~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~~~i~~SS  104 (289)
                      .|++-+...  .+.+   ....+.+....+.-.-+|.-||
T Consensus        81 I~V~TP~~~~~~~Dls~i~~a~~~I~~~l~~~~lVIi~ST  120 (415)
T PRK11064         81 IAVPTPFKGDHEPDLSYVEAAAKSIAPVLKKGDLVILEST  120 (415)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             9889997899972020188899999975268867996378


No 225
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=98.06  E-value=2.2e-05  Score=50.29  Aligned_cols=72  Identities=18%  Similarity=0.168  Sum_probs=56.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHH----CCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             9998888889999999998898--89999679446345564----4982898067864023465411563278761244
Q gi|254780595|r    3 LMIFGAGYTGKFIADAALKVGV--YTCGTTRSVSNLLTLKH----KGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         3 IlI~GaG~iG~~l~~~L~~~g~--~V~~~~r~~~~~~~l~~----~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||+|||++|+.++..|.+.+.  +|+..+|+.++...+..    ..+.....|..+... +...+...|.|++++++.
T Consensus         1 IlvlGaG~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~-l~~~~~~~diVv~~~p~~   78 (384)
T pfam03435         1 VLIIGAGGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAPKLGLRFIAIAVDADNYEA-LAALLKEGDLVINLAPPF   78 (384)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHH-HHHHHHCCCEEEECCCHH
T ss_conf             989897787999999997289988699998988998987752369853899957789999-999871289999998434


No 226
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.06  E-value=0.00012  Score=46.13  Aligned_cols=193  Identities=14%  Similarity=0.044  Sum_probs=101.4

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCEEEEEECCHHHH---------------HHHHHCCCEE--EECCCCCCCH-----
Q ss_conf             39998888---889999999998898899996794463---------------4556449828--9806786402-----
Q gi|254780595|r    2 HLMIFGAG---YTGKFIADAALKVGVYTCGTTRSVSNL---------------LTLKHKGISP--FLFADQKINN-----   56 (289)
Q Consensus         2 kIlI~GaG---~iG~~l~~~L~~~g~~V~~~~r~~~~~---------------~~l~~~~~~~--~~~~~~~~~~-----   56 (289)
                      .+||||++   =||..+++.|.++|++|....|+....               ..+...+...  +..|..+...     
T Consensus         7 valVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~~   86 (257)
T PRK12748          7 IAIVTGASRLNGIGAAICRVLAQKGIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSYSPNRLF   86 (257)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             89992889998549999999998799999970752554434234606799999999965982899984689999999999


Q ss_pred             -HHHHHHCCCCEEEEEECCCCCC---CEEE----CCCCCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCC
Q ss_conf             -3465411563278761244433---1000----1221013----------4432--01233433332010257621234
Q gi|254780595|r   57 -LLREKLYFTTHIVQCIKPSSEG---DPCI----ISMSKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWV  116 (289)
Q Consensus        57 -~~~~~~~~~~~v~~~~~~~~~~---~~~~----~~~~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i  116 (289)
                       ...+....+|.++++++.....   +...    ..+..++          ....  .+-.++|.+||.....       
T Consensus        87 ~~~~~~~G~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~m~~~~~G~IInisS~~~~~-------  159 (257)
T PRK12748         87 YMVSERLGDPSILINNAAYSTHTRIEELDVEQLDKHYAVNVRATMLLSSLFAKQFASKTGGRIINLTSGQSLG-------  159 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC-------
T ss_conf             9999974999899989988999990559999999999998389999999999988653892799982278606-------


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCC-C-CHHHHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             532112343113455445555432001234---5676420347777898-5-0344431134543222110001024777
Q gi|254780595|r  117 DEHSFVHPISCVATQRFNAEKEWLAITKKL---NIKLAVLRLSGIYGPK-R-NPFIKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       117 ~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~---~~~~~ilR~~~iyGp~-r-~~~~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
                          |.-....|+.+|.+.+.+.+.++.+.   ++.+-.+-|+.+.-+. . .....+....+    -+    -+-..+|
T Consensus       160 ----~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~P----lg----R~g~ped  227 (257)
T PRK12748        160 ----PMPDELAYAATKGAIEAFTKSLAPVLAEKGITVNAVNPGPTDTGWITEELKHHLVPKFP----QG----RVGEPVD  227 (257)
T ss_pred             ----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCHHHHHHHHHCCC----CC----CCCCHHH
T ss_conf             ----48760486999999999999999997230949999977878988889899999985799----89----9859999


Q ss_pred             HHHHHHHHHCCC----CCCCEECCCC
Q ss_conf             799999995135----5786162684
Q gi|254780595|r  192 VARCVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       192 va~~i~~l~~~~----~~~iyni~~~  213 (289)
                      +++++.+|....    -|+++.+-.|
T Consensus       228 ia~~v~fL~S~~a~~iTG~~i~VDGG  253 (257)
T PRK12748        228 AARLIAFLASEEAKWITGQVIHSEGG  253 (257)
T ss_pred             HHHHHHHHHCCHHCCEECCEEEECCC
T ss_conf             99999999485534840855897758


No 227
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=98.05  E-value=5.3e-05  Score=48.07  Aligned_cols=193  Identities=13%  Similarity=0.053  Sum_probs=102.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH--HHHHHCCC--EEEECCCCCCCH---HH---HHHHCCCCEEEE
Q ss_conf             3999888-8889999999998898899996794463--45564498--289806786402---34---654115632787
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL--LTLKHKGI--SPFLFADQKINN---LL---REKLYFTTHIVQ   70 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~--~~l~~~~~--~~~~~~~~~~~~---~~---~~~~~~~~~v~~   70 (289)
                      .+||||+ +=||..+++.|.+.|.+|..+.++....  ..++..+.  ..+..|..+.+.   .+   .+....+|.+++
T Consensus        10 valVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDilVN   89 (251)
T PRK12481         10 VAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMGHIDILIN   89 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89994867689999999999869999997898719999999975994799991279999999999999998199989998


Q ss_pred             EECCCCCCC---EEECCC----CCH----------HHH-HHH--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             612444331---000122----101----------344-320--123343333201025762123453211234311345
Q gi|254780595|r   71 CIKPSSEGD---PCIISM----SKD----------FYK-FMP--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        71 ~~~~~~~~~---~~~~~~----~~~----------~~~-~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      +++-....+   ......    ..+          ... ..+  +-.++|.+||...+-  ..         .....|+.
T Consensus        90 NAG~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~q~~~~~m~~~~~~G~IVnisS~~~~~--~~---------~~~~~Y~a  158 (251)
T PRK12481         90 NAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQ--GG---------IRVPSYTA  158 (251)
T ss_pred             CCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC--CC---------CCCCHHHH
T ss_conf             99899999903499999999999983779999999999999856993487402133336--88---------98714799


Q ss_pred             HHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             544555543200123---456764203477778985034-------4431134543222110001024777799999995
Q gi|254780595|r  131 QRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      +|.....+.+..+.+   +++.+-.+-|+.+--|....+       ..+.+..+.    +    -+---+|+++++.+|.
T Consensus       159 sKaav~~ltr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl----~----R~g~pedia~~v~fL~  230 (251)
T PRK12481        159 SKSAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPA----S----RWGTPDDLAGPAIFLS  230 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHCCCCHHHHHHHHHCCCC----C----CCCCHHHHHHHHHHHH
T ss_conf             9999999999999997030969999952888777521103799999999955999----9----9868999999999993


Q ss_pred             CCCC----CCCEECCCC
Q ss_conf             1355----786162684
Q gi|254780595|r  201 THHL----GGIFNLSDD  213 (289)
Q Consensus       201 ~~~~----~~iyni~~~  213 (289)
                      ....    |++..+-.|
T Consensus       231 S~~a~~iTG~~i~VDGG  247 (251)
T PRK12481        231 SSASDYVTGYTLAVDGG  247 (251)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             82535904855897846


No 228
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.04  E-value=0.00024  Score=44.34  Aligned_cols=193  Identities=14%  Similarity=0.129  Sum_probs=99.1

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHHH---HHHH-HHCCCEE-EECCCCCCC---H---HHHHHHCCCCE
Q ss_conf             3999888-8--88999999999889889999679446---3455-6449828-980678640---2---34654115632
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVSN---LLTL-KHKGISP-FLFADQKIN---N---LLREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~~---~~~l-~~~~~~~-~~~~~~~~~---~---~~~~~~~~~~~   67 (289)
                      ++||||+ |  =||..+++.|.++|.+|....|+...   ...+ ...+... +..|..+.+   .   .+.+....+|.
T Consensus         9 ~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~~~~~g~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDi   88 (271)
T PRK06505          9 RGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAESLGSDLVLPCDVEDIASVDAVFEALEKKWGKLDF   88 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79997999985499999999998699999981866889999999996498189983799999999999999998399878


Q ss_pred             EEEEECCCCCC-------CEEECCCCCH----H---HHH-------HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             78761244433-------1000122101----3---443-------2012334333320102576212345321123431
Q gi|254780595|r   68 IVQCIKPSSEG-------DPCIISMSKD----F---YKF-------MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~~~-------~~~~~~~~~~----~---~~~-------~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ++++++.....       +.....+...    +   ...       ..+..++|.+||.+.-.           +.-..+
T Consensus        89 LVnnAG~~~~~~~~~~~~d~~~e~~~~~~~~n~~~~~~~~~~~~~~~~~~Gsii~iss~~~~~-----------~~p~~~  157 (271)
T PRK06505         89 VVHAIGFSDKNELKGRYADTTRENFSRTMVISCFSFTEIAKRAAKLMPDGGSMLTLTYGGSTR-----------VMPNYN  157 (271)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-----------CCCCCC
T ss_conf             985664467544445412267999999999997999999998600126788602463254344-----------578741


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC-------CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHH
Q ss_conf             1345544555543200123---456764203477778985-------034443113454322211000102477779999
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR-------NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV  196 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r-------~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i  196 (289)
                      .|+.+|...+.+.+.++.+   +|+++-.+-|+.|--+..       ..+.......+  +  +    -+.-.+|++.++
T Consensus       158 ~Y~asKaal~~ltr~lA~e~a~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~P--l--~----R~g~~ediA~~v  229 (271)
T PRK06505        158 VMGVAKAALEASVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAMFSYQQRNSP--L--R----RTVTIDEVGGSA  229 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCC--C--C----CCCCHHHHHHHH
T ss_conf             3478787799999999999702398999997577765542447767999999986889--8--9----996999999999


Q ss_pred             HHHHCCC----CCCCEECCCC
Q ss_conf             9995135----5786162684
Q gi|254780595|r  197 IFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       197 ~~l~~~~----~~~iyni~~~  213 (289)
                      ++|....    -|+++.+=.+
T Consensus       230 ~fL~Sd~s~~iTGq~i~VDGG  250 (271)
T PRK06505        230 LYLLSDLSSGVTGEIHFVDSG  250 (271)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999575424745870897969


No 229
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=98.03  E-value=5.7e-05  Score=47.88  Aligned_cols=144  Identities=13%  Similarity=0.060  Sum_probs=82.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCC-EEEEEECCHHH-------HHHHHHCCC--EEEECCCCCCC---HHHH---HHHCC
Q ss_conf             3999888-8889999999998898-89999679446-------345564498--28980678640---2346---54115
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGV-YTCGTTRSVSN-------LLTLKHKGI--SPFLFADQKIN---NLLR---EKLYF   64 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~-~V~~~~r~~~~-------~~~l~~~~~--~~~~~~~~~~~---~~~~---~~~~~   64 (289)
                      -++|||+ |=||..+++.|.++|. .|..++|++..       ...+...+.  ..+..|..+..   ..+.   +....
T Consensus         2 tvlVTGas~GIG~~~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~~~~~g~~v~~~~~Dv~~~~~~~~~v~~~~~~~g~   81 (180)
T smart00822        2 TYLITGGLGGLGLELARWLAERGARHLVLLSRSGPDAPGAAELLAELEALGAEVTVVACDVADRAALAAALAAIPARLGP   81 (180)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             99997878799999999999879988999868987818899999999956996999980268867766677767997398


Q ss_pred             CCEEEEEECCCCCC---CEEECCCCC----------HHHHHH--HCCCCCCCCCCEEE-CCCCCCCCCCCCCCCCCCCHH
Q ss_conf             63278761244433---100012210----------134432--01233433332010-257621234532112343113
Q gi|254780595|r   65 TTHIVQCIKPSSEG---DPCIISMSK----------DFYKFM--PHVKWIGYLSSTSI-YGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        65 ~~~v~~~~~~~~~~---~~~~~~~~~----------~~~~~~--~~~~~~i~~SS~~V-Yg~~~g~~i~E~~~~~P~~~y  128 (289)
                      +|.++|+++-....   +.....+.+          .+.+..  ....++|++||.+- +|.            -....|
T Consensus        82 id~lvn~AG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~~~~~iV~~SSiag~~g~------------~g~~~Y  149 (180)
T smart00822       82 LRGVIHAAGVLDDGLLANLTPERFAAVLAPKVDGAWNLHELTRDLPLDFFVLFSSVAGVLGN------------PGQANY  149 (180)
T ss_pred             EEEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCC------------CCCHHH
T ss_conf             37999424666997725599999999999999999999998336788569997658765789------------986899


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             455445555432001234567642034777
Q gi|254780595|r  129 ATQRFNAEKEWLAITKKLNIKLAVLRLSGI  158 (289)
Q Consensus       129 ~~~k~~~E~~~~~~~~~~~~~~~ilR~~~i  158 (289)
                      +.+|...|.+.++.. ..|+++..+-|+.+
T Consensus       150 ~Aak~~l~~la~~~~-~~g~~v~~i~pg~w  178 (180)
T smart00822      150 AAANAFLDALAAHRR-ARGLPATSINWGAW  178 (180)
T ss_pred             HHHHHHHHHHHHHHH-HCCCCEEEEECCCC
T ss_conf             999999999999998-56992999847886


No 230
>PRK06197 short chain dehydrogenase; Provisional
Probab=98.03  E-value=6.3e-05  Score=47.61  Aligned_cols=156  Identities=8%  Similarity=-0.037  Sum_probs=82.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHH----CCCEEEECCCCCCCHH------HHHHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----564----4982898067864023------465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKH----KGISPFLFADQKINNL------LREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~----~~~~~~~~~~~~~~~~------~~~~~~~~~   66 (289)
                      -++|||+ .=||...++.|.++|++|+...|+.++...    +..    ..+..+..|..+....      +......+|
T Consensus        18 ~~lITGa~sGIG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~~~~~~~~~lD   97 (306)
T PRK06197         18 VAVVTGANTGLGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAADALRAAYPRID   97 (306)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99991689599999999999784989999798999999999999768998579997664307789999999996189876


Q ss_pred             EEEEEECCCCC----C-CEEECCCCCH----------HHHHHH--CCCCCCCCCCEEEC-CCCCC-CCCCCCCCCCCCCH
Q ss_conf             27876124443----3-1000122101----------344320--12334333320102-57621-23453211234311
Q gi|254780595|r   67 HIVQCIKPSSE----G-DPCIISMSKD----------FYKFMP--HVKWIGYLSSTSIY-GNREG-QWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~----~-~~~~~~~~~~----------~~~~~~--~~~~~i~~SS~~VY-g~~~g-~~i~E~~~~~P~~~  127 (289)
                      .+++.++-...    . |..-..+..|          +...+.  .-.|+|.+||..-+ +..-. .-++.+....+...
T Consensus        98 vLinNAGi~~~~~~~T~dG~E~~f~vN~lghflLt~lLl~~l~~~~~~RIV~vsS~~h~~~~~~~~ddl~~~~~y~~~~a  177 (306)
T PRK06197         98 LLINNAGVMYTPKQTTADGFELQFGTNHLGHFALTGLLLDRLLPVPGSRVVTVSSGGHRIRAAIHFDDLQWERRYNRVAA  177 (306)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHCCCCCCCCCCCCCCCCCHHHH
T ss_conf             89977844568872267653333333136888888877787531578826999445760577888424576567874788


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCC--CCCC
Q ss_conf             34554455554320012---345676420--3477
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVL--RLSG  157 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~il--R~~~  157 (289)
                      |+.+|++.--...+.++   ..+.+++++  -|+.
T Consensus       178 Y~~SKLanilft~eL~rrl~~~~~~v~~~a~hPG~  212 (306)
T PRK06197        178 YGQSKLANLLFTYELQRRLAAAGATTIAVAAHPGV  212 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             88889999999999999876059986999927986


No 231
>KOG1610 consensus
Probab=98.03  E-value=7.5e-05  Score=47.20  Aligned_cols=143  Identities=13%  Similarity=0.171  Sum_probs=79.9

Q ss_pred             EEEECC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC----CCEEEECCCCCCCHHHHHHH---------CCCCE
Q ss_conf             999888--8889999999998898899996794463455644----98289806786402346541---------15632
Q gi|254780595|r    3 LMIFGA--GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK----GISPFLFADQKINNLLREKL---------YFTTH   67 (289)
Q Consensus         3 IlI~Ga--G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~----~~~~~~~~~~~~~~~~~~~~---------~~~~~   67 (289)
                      ||||||  || |..|+++|.++|+.|.+---+.+....+...    ....+..|.... +.+.+..         .+...
T Consensus        32 VlITGCDSGf-G~~LA~~l~~~Gf~V~Agclt~~gae~L~~~~~s~rl~t~~LDVT~~-esi~~a~~~V~~~l~~~gLwg  109 (322)
T KOG1610          32 VLITGCDSGF-GRLLAKKLDKKGFRVFAGCLTEEGAESLRGETKSPRLRTLQLDVTKP-ESVKEAAQWVKKHLGEDGLWG  109 (322)
T ss_pred             EEEECCCCHH-HHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHCCCCCEEEEECCCCH-HHHHHHHHHHHHHCCCCCCEE
T ss_conf             9983477177-79999999865887888720670589876323387402475325887-899999999998646655135


Q ss_pred             EEEEECCC---CCCCEE-ECCC----CCH----------HHHHH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78761244---433100-0122----101----------34432-01233433332010257621234532112343113
Q gi|254780595|r   68 IVQCIKPS---SEGDPC-IISM----SKD----------FYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCV  128 (289)
Q Consensus        68 v~~~~~~~---~~~~~~-~~~~----~~~----------~~~~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y  128 (289)
                      ++++++-.   ...+.. ....    ..|          +.-.. ..-.|++++||++  |...         .--..+|
T Consensus       110 lVNNAGi~~~~g~~ewl~~~d~~~~l~vNllG~irvT~~~lpLlr~arGRvV~v~S~~--Gr~~---------~p~~g~Y  178 (322)
T KOG1610         110 LVNNAGISGFLGPDEWLTVEDYRKVLNVNLLGTIRVTKAFLPLLRRARGRVVNVSSVL--GRVA---------LPALGPY  178 (322)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCC--CCCC---------CCCCCCC
T ss_conf             7733664556685111529999998865305489999988877776057089950445--6766---------7656652


Q ss_pred             HHHHHHHHHHH---HHCCCCCCCCCCCCCCCCCC
Q ss_conf             45544555543---20012345676420347777
Q gi|254780595|r  129 ATQRFNAEKEW---LAITKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       129 ~~~k~~~E~~~---~~~~~~~~~~~~ilR~~~iy  159 (289)
                      ..+|.+.|...   +......|+++.|+-|+ .|
T Consensus       179 ~~SK~aVeaf~D~lR~El~~fGV~VsiiePG-~f  211 (322)
T KOG1610         179 CVSKFAVEAFSDSLRRELRPFGVKVSIIEPG-FF  211 (322)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEECCC-CC
T ss_conf             0329999999999998877528679996467-55


No 232
>PRK06114 short chain dehydrogenase; Provisional
Probab=98.00  E-value=0.00012  Score=46.14  Aligned_cols=193  Identities=12%  Similarity=0.046  Sum_probs=101.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----HHHHHHCCCE--EEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-888999999999889889999679446-----3455644982--89806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----LLTLKHKGIS--PFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----~~~l~~~~~~--~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      .++|||+ +=||..+++.|.+.|.+|....|+.+.     ...+...+..  .+..|..+ ...+.       .....+|
T Consensus        18 valVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~-~~~v~~~v~~~~~~~G~iD   96 (262)
T PRK06114         18 VAFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTS-KSDLAAAVARTEAELGALT   96 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHHHCCCCC
T ss_conf             899968478999999999998799899995897469999999999659958999816899-9999999999999819998


Q ss_pred             EEEEEECCCCCC---CEEECC----CCCHH----------HHHH--HCCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCCC
Q ss_conf             278761244433---100012----21013----------4432--012334333320102-576212345321123431
Q gi|254780595|r   67 HIVQCIKPSSEG---DPCIIS----MSKDF----------YKFM--PHVKWIGYLSSTSIY-GNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~--~~~~~~i~~SS~~VY-g~~~g~~i~E~~~~~P~~  126 (289)
                      .++++++-....   +-....    ...++          ...+  .+-.++|.+||.+-. +. .+         .+..
T Consensus        97 iLVNnAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IVnisS~~g~~~~-~g---------~~~~  166 (262)
T PRK06114         97 LAVNAAGIANANPAEEMEEEQWQTVMDINLTGVFLSCQAEARAMLENGGGSIVNIASMSGVIVN-RG---------LLQA  166 (262)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCC-CC---------CCHH
T ss_conf             9998998999988155999999999999736699999999999997289789997862230478-88---------5318


Q ss_pred             HHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCC------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             134554455554320012---34567642034777789850------344431134543222110001024777799999
Q gi|254780595|r  127 CVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRN------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      .|+.+|.....+.+..+.   .+|+++-.+-|+.+--|-..      ....+....+  +  +    -+-.-+|+|++++
T Consensus       167 ~Y~asKaav~~lTr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~P--l--g----R~g~peeiA~~v~  238 (262)
T PRK06114        167 HYNASKAGVIHMSKSLAMEWVGRGIRVNTISPGYTATPMNTRPEMVHQTKLFEEQTP--M--Q----RMADVDEMVGPAV  238 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCC--C--C----CCCCHHHHHHHHH
T ss_conf             899999999999999999967059399999758898876667464899999985799--8--9----9868999999999


Q ss_pred             HHHCCCC----CCCEECCCC
Q ss_conf             9951355----786162684
Q gi|254780595|r  198 FLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       198 ~l~~~~~----~~iyni~~~  213 (289)
                      +|.....    |+++.+-.|
T Consensus       239 FLaSd~as~iTG~~i~VDGG  258 (262)
T PRK06114        239 FLLSDAASFVTGVDLLVDGG  258 (262)
T ss_pred             HHHCCHHCCCCCCEEEECCC
T ss_conf             99576324755862897953


No 233
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.00  E-value=0.00028  Score=43.97  Aligned_cols=192  Identities=11%  Similarity=0.063  Sum_probs=96.5

Q ss_pred             EEEEECC-CH--HHHHHHHHHHHCCCEEEEEECCHHHH---HHHHH-CCCEE-EECCCCCCCHHH-------HHHHCCCC
Q ss_conf             3999888-88--89999999998898899996794463---45564-49828-980678640234-------65411563
Q gi|254780595|r    2 HLMIFGA-GY--TGKFIADAALKVGVYTCGTTRSVSNL---LTLKH-KGISP-FLFADQKINNLL-------REKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~--iG~~l~~~L~~~g~~V~~~~r~~~~~---~~l~~-~~~~~-~~~~~~~~~~~~-------~~~~~~~~   66 (289)
                      ++||||+ |=  ||..+++.|.+.|.+|....|+....   ..+.. .+... +..|..+ ...+       .+....+|
T Consensus         8 ~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~-~~~v~~~~~~~~~~~G~iD   86 (254)
T PRK07533          8 RGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKARPYVEPLAEELDAPLLMPLDVRE-PGQLEAVFARIAEEWGRLD   86 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCC-HHHHHHHHHHHHHHHCCCC
T ss_conf             899968889808999999999987999999828877899999999745981899916999-9999999999999849977


Q ss_pred             EEEEEECCC--CCC-----CEEECCCCC----H---HH-------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             278761244--433-----100012210----1---34-------43201233433332010257621234532112343
Q gi|254780595|r   67 HIVQCIKPS--SEG-----DPCIISMSK----D---FY-------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        67 ~v~~~~~~~--~~~-----~~~~~~~~~----~---~~-------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      .++|+++..  ...     |.....+..    +   ..       ..+.+-..++.+||.+..   .        .....
T Consensus        87 ilVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~gG~iv~iss~~~~---~--------~~~~~  155 (254)
T PRK07533         87 FVLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPLMTNGGSLLTMSYYGAE---K--------VVENY  155 (254)
T ss_pred             EEEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEHHHC---C--------CCCCC
T ss_conf             897422126601114760149999999999998599999999988886517831567320011---4--------67773


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC-------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHH
Q ss_conf             11345544555543200123---4567642034777789850-------3444311345432221100010247777999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN-------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARC  195 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~-------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~  195 (289)
                      +.|+.+|.+.+.+.+.++.+   +|+.+-.+.|+.|.-+...       .+..+....+    -    --+.-.+|++++
T Consensus       156 ~~y~~aKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~P----~----~R~~~pedvA~~  227 (254)
T PRK07533        156 NLMGPVKAALESSVRYLAAELGPRGIRVHAISPGPLKTRAASGIDDFDALLEDARERAP----L----HRLVDIDDVGAV  227 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCCCCCHHHHHHHHHHCCC----C----CCCCCHHHHHHH
T ss_conf             15788999999999999998376687999986577766232068875999999996599----8----999899999999


Q ss_pred             HHHHHCCC----CCCCEECCCC
Q ss_conf             99995135----5786162684
Q gi|254780595|r  196 VIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       196 i~~l~~~~----~~~iyni~~~  213 (289)
                      +.+|....    -|+++.+-.+
T Consensus       228 v~fL~Sd~a~~iTG~~i~vDGG  249 (254)
T PRK07533        228 AAFLASDAARALTGNTLYIDGG  249 (254)
T ss_pred             HHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999588324855881787939


No 234
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=97.99  E-value=4.7e-05  Score=48.33  Aligned_cols=181  Identities=15%  Similarity=0.148  Sum_probs=97.3

Q ss_pred             EEECC-CHHHHHHHHHHHHCCCEEEEEEC--CHHHHH-HHHHCCCEE-----EECCCCCCC------HHHHHHHCCCCEE
Q ss_conf             99888-88899999999988988999967--944634-556449828-----980678640------2346541156327
Q gi|254780595|r    4 MIFGA-GYTGKFIADAALKVGVYTCGTTR--SVSNLL-TLKHKGISP-----FLFADQKIN------NLLREKLYFTTHI   68 (289)
Q Consensus         4 lI~Ga-G~iG~~l~~~L~~~g~~V~~~~r--~~~~~~-~l~~~~~~~-----~~~~~~~~~------~~~~~~~~~~~~v   68 (289)
                      ||||+ |=||+.+|++|.++||+|.+.-+  +.++.. ++.+.++..     +.+|..+.+      ..+...+-.+|.+
T Consensus         4 LVTGg~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lGpvDvL   83 (244)
T TIGR01829         4 LVTGGTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELGPVDVL   83 (244)
T ss_pred             EEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             88578774468999999875988988178982589999998626985147898727677789999999999711953689


Q ss_pred             EEEECCCCCCC----------EE-------ECCCCCHHHHHH-H-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             87612444331----------00-------012210134432-0-12334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEGD----------PC-------IISMSKDFYKFM-P-HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~~----------~~-------~~~~~~~~~~~~-~-~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
                      +++|.=+.+.-          .+       +-+.++-+...+ . .--|+|-+||.-  |. +|++        ..+-|+
T Consensus        84 VNNAGITRD~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eRGwGRIiNISSvN--G~-KGQf--------GQtNYS  152 (244)
T TIGR01829        84 VNNAGITRDKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRERGWGRIINISSVN--GQ-KGQF--------GQTNYS  152 (244)
T ss_pred             EECCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEC--CC-CCCC--------CHHHHH
T ss_conf             868864403031249984688898631324415540014766216884168841214--77-5654--------304589


Q ss_pred             HHHHHH---HHHHHHCCCCCCCCCCCCCCCCCCCC-----CCCHHHH-HHCCCCC-CCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             554455---55432001234567642034777789-----8503444-3113454-322211000102477779999999
Q gi|254780595|r  130 TQRFNA---EKEWLAITKKLNIKLAVLRLSGIYGP-----KRNPFIK-IRQKNSL-RLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       130 ~~k~~~---E~~~~~~~~~~~~~~~ilR~~~iyGp-----~r~~~~~-~~~g~~~-~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      .+|.=.   -+++-......|+-|=++=|+.|==|     ..+.+.. +..+-|. +++.|+         -+|.++.+|
T Consensus       153 AAKAG~iGFTkALA~E~A~kGvTVN~i~PGYi~T~MV~A~redVl~~rIva~IP~~RLg~Pe---------EIA~aV~fL  223 (244)
T TIGR01829       153 AAKAGMIGFTKALAQEGARKGVTVNVIAPGYIATDMVMAVREDVLQSRIVAQIPVKRLGRPE---------EIAAAVAFL  223 (244)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH---------HHHHHHHHH
T ss_conf             88621567779999721103856754558898866778636888740577889832157815---------788899886


Q ss_pred             HCCCC
Q ss_conf             51355
Q gi|254780595|r  200 MTHHL  204 (289)
Q Consensus       200 ~~~~~  204 (289)
                      ...+.
T Consensus       224 ase~a  228 (244)
T TIGR01829       224 ASEEA  228 (244)
T ss_pred             HHHCC
T ss_conf             54103


No 235
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=97.99  E-value=0.00036  Score=43.33  Aligned_cols=193  Identities=12%  Similarity=0.085  Sum_probs=97.9

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECC------HHHHHHHHHCCC--EEEECCCCCCC---HHH---HHHHCC
Q ss_conf             3999888-8--88999999999889889999679------446345564498--28980678640---234---654115
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRS------VSNLLTLKHKGI--SPFLFADQKIN---NLL---REKLYF   64 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~------~~~~~~l~~~~~--~~~~~~~~~~~---~~~---~~~~~~   64 (289)
                      ++||||| |  =||..+++.|.+.|.+|....++      ......+...+.  ..+..|..+..   ..+   .+....
T Consensus         9 ~alVTGaag~~GiG~aia~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~   88 (259)
T PRK07370          9 KALVTGIANNRSIAWGIAQQLHAAGAELGITYLPDEKGRFEKKVRELTEPLNPSLFLPCNVQDDAQIEEVFETIKQKWGQ   88 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             89997989985799999999998699999994787013589999999841286489991289999999999999998589


Q ss_pred             CCEEEEEECCCCCC-------CEEECCCCC----HH---H-------HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             63278761244433-------100012210----13---4-------432012334333320102576212345321123
Q gi|254780595|r   65 TTHIVQCIKPSSEG-------DPCIISMSK----DF---Y-------KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVH  123 (289)
Q Consensus        65 ~~~v~~~~~~~~~~-------~~~~~~~~~----~~---~-------~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~  123 (289)
                      +|.++|+++.....       +.....+..    ++   .       .....-.++|.+||.+..  ..         ..
T Consensus        89 iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~~~~~g~Ii~iss~~~~--~~---------~~  157 (259)
T PRK07370         89 LDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPLMSEGGSIVTLTYLGGV--RA---------IP  157 (259)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCC--CC---------CC
T ss_conf             87798630114643367992559999999999998799999999998860458853127874135--46---------78


Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC----H---HHHHHCCCCCCCCCCCCEECCHHHHHHH
Q ss_conf             4311345544555543200123---4567642034777789850----3---4443113454322211000102477779
Q gi|254780595|r  124 PISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN----P---FIKIRQKNSLRLVKKNQVFNRIRVEDVA  193 (289)
Q Consensus       124 P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~----~---~~~~~~g~~~~~~~~~~~~~~ihv~Dva  193 (289)
                      -...|+.+|...+.+.+.++.+   +++.+-.+.|+.|.-+...    .   ...+.+..+.    +    -+..-+|++
T Consensus       158 ~~~~y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl----~----R~g~peeiA  229 (259)
T PRK07370        158 NYNVMGVAKAALEASVRYLAAELGPENIRVNAISAGPIRTLASSAVGGILDMIHHVEEKAPL----R----RTVTQTEVG  229 (259)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHCCCCCHHHHHHHHHCCCC----C----CCCCHHHHH
T ss_conf             85205889999999999999983718879999863668551222036729999999857998----9----993999999


Q ss_pred             HHHHHHHCCCC----CCCEECCCC
Q ss_conf             99999951355----786162684
Q gi|254780595|r  194 RCVIFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       194 ~~i~~l~~~~~----~~iyni~~~  213 (289)
                      +++++|.....    |+++.+-.+
T Consensus       230 ~~v~FL~Sd~s~~iTG~~i~VDGG  253 (259)
T PRK07370        230 NTAAFLLSDLASGITGQTIYVDAG  253 (259)
T ss_pred             HHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999584525743871897969


No 236
>pfam08643 DUF1776 Fungal family of unknown function (DUF1776). This is a fungal family of unknown function. One of the proteins in this family has been localized to the mitochondria.
Probab=97.98  E-value=0.0005  Score=42.48  Aligned_cols=53  Identities=19%  Similarity=0.219  Sum_probs=42.6

Q ss_pred             EEEECC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCEEEECCCCCCC
Q ss_conf             999888--8889999999998898899996794463455644---9828980678640
Q gi|254780595|r    3 LMIFGA--GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---GISPFLFADQKIN   55 (289)
Q Consensus         3 IlI~Ga--G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---~~~~~~~~~~~~~   55 (289)
                      |+|+|+  -=||+.++..|.++||.|++..|+.+....++..   ++.++..|+.+.+
T Consensus         6 Vli~Gs~~~pi~R~iA~dL~rrGf~Vfa~~r~~~~~~~l~~~~~~~i~~L~lDvt~~~   63 (296)
T pfam08643         6 VLVAGSPTEPLTRSIALDLERRGFIVFVTVTSAEEYKTVESEQREDIRPLWLDDTAPS   63 (296)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCHH
T ss_conf             9996699974589999999968978999957778899998624478852774078826


No 237
>PRK05855 short chain dehydrogenase; Validated
Probab=97.97  E-value=4.8e-05  Score=48.29  Aligned_cols=193  Identities=11%  Similarity=0.123  Sum_probs=101.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCCEE--EECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----56449828--9806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGISP--FLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~~~--~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      -++|||| .=||..++..|.++|.+|....|+.+....    +...|...  +..|..+ ...+.       +....+|.
T Consensus       317 vAvVTGA~sGIGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~~~~~DVtd-~~av~al~~~v~~~~G~iDI  395 (582)
T PRK05855        317 LVVVTGAGSGIGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAHAYRVDVSD-ADAMEALAEWVGAEHGVPDI  395 (582)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCC-HHHHHHHHHHHHHHCCCCCE
T ss_conf             89995875789999999999779999996079999999999999519848999755899-99999999999997699999


Q ss_pred             EEEEECCCCCC---CEEECC----CCCH----------HHH-HHHC--CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             78761244433---100012----2101----------344-3201--23343333201025762123453211234311
Q gi|254780595|r   68 IVQCIKPSSEG---DPCIIS----MSKD----------FYK-FMPH--VKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~~~~~~---~~~~~~----~~~~----------~~~-~~~~--~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      ++++++-....   +.....    +..|          +.. ..+.  ..++|.+||.+-|-           +.-....
T Consensus       396 LVNNAGI~~~g~~~d~s~e~w~~v~dVNl~Gv~~~~ra~lp~M~~rg~gG~IVNiSSiag~~-----------~~p~~~a  464 (582)
T PRK05855        396 VVNNAGIGMAGGFLDTSAEEWDRVLDVNLWGVIHGCRLFGRQMVERGTGGHIVNVASAAAYA-----------PSRSLPA  464 (582)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCC-----------CCCCCHH
T ss_conf             99898758997803299999999998864999999999999999649980899967864577-----------8988646


Q ss_pred             HHHHHHHHH----HHHHHCCCCCCCCCCCCCCCCCCCC-CCC-HHHHHHCCCCC-CCCCCCCEE--CCHHHHHHHHHHHH
Q ss_conf             345544555----5432001234567642034777789-850-34443113454-322211000--10247777999999
Q gi|254780595|r  128 VATQRFNAE----KEWLAITKKLNIKLAVLRLSGIYGP-KRN-PFIKIRQKNSL-RLVKKNQVF--NRIRVEDVARCVIF  198 (289)
Q Consensus       128 y~~~k~~~E----~~~~~~~~~~~~~~~ilR~~~iyGp-~r~-~~~~~~~g~~~-~~~~~~~~~--~~ihv~Dva~~i~~  198 (289)
                      |+.+|.+..    .+-.++ ..+|+.++.+.|+.|-=+ -++ .+......... .....+..+  ...--+++|++|+.
T Consensus       465 Y~ASKaAV~gftesLr~EL-a~~GI~V~aVcPG~I~T~I~~~a~~~g~~~~~~~~~~~~~~~~~~~~~~~Pe~vA~~Il~  543 (582)
T PRK05855        465 YATSKAAVLMLSECLRAEL-AEAGIGVTAICPGFVDTNIVATTRFAGADAEDEARRRKRADKLYARRGYGPEKVAKAIVS  543 (582)
T ss_pred             HHHHHHHHHHHHHHHHHHH-CCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             8999999999999999985-302977999931846467555566478760256778887766654059999999999999


Q ss_pred             HHCCCCCCC
Q ss_conf             951355786
Q gi|254780595|r  199 LMTHHLGGI  207 (289)
Q Consensus       199 l~~~~~~~i  207 (289)
                      .++++...+
T Consensus       544 aV~rnr~~v  552 (582)
T PRK05855        544 AVKRNKAVV  552 (582)
T ss_pred             HHHCCCCEE
T ss_conf             985599889


No 238
>PRK08655 prephenate dehydrogenase; Provisional
Probab=97.97  E-value=3.1e-05  Score=49.38  Aligned_cols=66  Identities=15%  Similarity=0.077  Sum_probs=49.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-CCCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             93999888-888999999999889889999679446345564-498289806786402346541156327876124
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KGISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||.|+|. |.+|+.+++.|...||+|+.+.|++++...... .|+..        .....+.+..+|.|+.++|.
T Consensus         1 mkI~IIGG~G~MG~~Fa~~f~~sGyeV~I~gRd~~k~~~va~~LGv~~--------~~~~~e~~~~advVIvsVPI   68 (441)
T PRK08655          1 MKISIIGGTGGLGKWFARFLKDKGYEVIVWGRDPKKGKEVAKELGVEY--------ASDNIDAAKDGDIVIVSVPI   68 (441)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCC--------CCCHHHHHHCCCEEEEECCH
T ss_conf             979999479817799999998679889998157313567888738622--------24478897249999998488


No 239
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=97.96  E-value=8.8e-05  Score=46.81  Aligned_cols=145  Identities=14%  Similarity=0.066  Sum_probs=78.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH-----HHHHHH----CCCEEEECCCCC-CCH---HHH---HHHC
Q ss_conf             93999888-888999999999889889999679446-----345564----498289806786-402---346---5411
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN-----LLTLKH----KGISPFLFADQK-INN---LLR---EKLY   63 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~-----~~~l~~----~~~~~~~~~~~~-~~~---~~~---~~~~   63 (289)
                      +.+||||+ +=||..+++.|.++|++|+.+.|+...     ......    ..+.....|..+ ...   ...   ....
T Consensus         6 k~vlITGas~GiG~aia~~l~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~v~~~~~~~~~~~g   85 (251)
T COG1028           6 KVALVTGASSGIGRAIARALAREGARVVVAARRSEEEAAEALAAAIKEAGGGRAAAVAADVSDDEESVEALVAAAEEEFG   85 (251)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             88999898871899999999988997999967973516999999975457872799972089999999999999999719


Q ss_pred             CCCEEEEEECCCCC----CCEEECCC----CCHH-------HHHHHCCC--CCCCCCCEEECCCCCCCCCCCCCCCCC-C
Q ss_conf             56327876124443----31000122----1013-------44320123--343333201025762123453211234-3
Q gi|254780595|r   64 FTTHIVQCIKPSSE----GDPCIISM----SKDF-------YKFMPHVK--WIGYLSSTSIYGNREGQWVDEHSFVHP-I  125 (289)
Q Consensus        64 ~~~~v~~~~~~~~~----~~~~~~~~----~~~~-------~~~~~~~~--~~i~~SS~~VYg~~~g~~i~E~~~~~P-~  125 (289)
                      .+|.++++++....    .+......    ..++       ....+..+  ++|.+||..-+ ...           + .
T Consensus        86 ~idvlvnnAg~~~~~~~~~~~~~~~~~~~~~~n~~g~~~~~~~~~~~~~~~~Iv~isS~~~~-~~~-----------~~~  153 (251)
T COG1028          86 RIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLGAFLLTRAALPLMKKQRIVNISSVAGL-GGP-----------PGQ  153 (251)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC-CCC-----------CCC
T ss_conf             98799999867645787233799999999999839999999986366233589998852103-788-----------773


Q ss_pred             CHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCC
Q ss_conf             1134554455554320012---3456764203477
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITK---KLNIKLAVLRLSG  157 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~  157 (289)
                      ..|+.+|.+.+.+...+..   .+|+.+..+-|+.
T Consensus       154 ~~Y~~sK~al~~~~~~la~el~~~gI~v~~v~PG~  188 (251)
T COG1028         154 AAYAASKAALIGLTKALALELAPRGIRVNAVAPGY  188 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             07999999999999999998241687999996498


No 240
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=97.96  E-value=5.3e-05  Score=48.06  Aligned_cols=72  Identities=13%  Similarity=0.175  Sum_probs=48.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCC--------HHHHHHHCCCCEEEEEE
Q ss_conf             9399988888899999999988988999967944634556449828980678640--------23465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN--------NLLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~v~~~~   72 (289)
                      |||+|+|||=||+.+...|.+.||+|+.+.| .+....+...|......+..+..        ..-.......|.|+.+.
T Consensus         3 mkI~IiGaGAvG~~~a~~L~~aG~~V~lv~r-~~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~~~~~~~~~~D~viv~v   81 (341)
T PRK08229          3 ARICVLGAGSIGCYLGGRLAAAGADVTLIGR-ARIGDEIRAHGLRLTDYRGRDVRVPPDAIAFSTDPAALATADLVLVTV   81 (341)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEC-HHHHHHHHHCCCEEECCCCCEEEECCCEEEECCCHHHCCCCCEEEEEE
T ss_conf             7799989679999999999858998799956-789999996790996389976896366156148865658999899970


Q ss_pred             C
Q ss_conf             2
Q gi|254780595|r   73 K   73 (289)
Q Consensus        73 ~   73 (289)
                      -
T Consensus        82 K   82 (341)
T PRK08229         82 K   82 (341)
T ss_pred             C
T ss_conf             7


No 241
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=97.96  E-value=0.00018  Score=45.09  Aligned_cols=193  Identities=19%  Similarity=0.123  Sum_probs=100.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCHHHHH----HHHHC-CCE--EEECCCCCCCH------HHHHHHCCCC
Q ss_conf             3999888-888999999999889889999-67944634----55644-982--89806786402------3465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGT-TRSVSNLL----TLKHK-GIS--PFLFADQKINN------LLREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~-~r~~~~~~----~l~~~-~~~--~~~~~~~~~~~------~~~~~~~~~~   66 (289)
                      ++||||+ +=||..+++.|.+.|.+|... .++.+...    .+... ++.  .+..|..+.+.      .+.+....+|
T Consensus        10 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~iD   89 (260)
T PRK08416         10 TLVISGGTRGIGKAIVYEFAQSGVNIAFTYNSNVEEADKIAQDLEKKYGIKARAYPLNILEPETYKELFKKIDADFDRVD   89 (260)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89996734099999999999879999998599889999999999884198369997788999999999999999819978


Q ss_pred             EEEEEECCCC-----CCCEEE----CC----CCCHH----------HHHHH--CCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             2787612444-----331000----12----21013----------44320--123343333201025762123453211
Q gi|254780595|r   67 HIVQCIKPSS-----EGDPCI----IS----MSKDF----------YKFMP--HVKWIGYLSSTSIYGNREGQWVDEHSF  121 (289)
Q Consensus        67 ~v~~~~~~~~-----~~~~~~----~~----~~~~~----------~~~~~--~~~~~i~~SS~~VYg~~~g~~i~E~~~  121 (289)
                      .+++++.-..     ...+..    ..    +..++          .....  +-.++|++||.+..-           +
T Consensus        90 ilVnnA~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~GsIv~isS~~~~~-----------~  158 (260)
T PRK08416         90 FFISNAIISGRAVVGGYTKFMRLKPKGLNNIYTATVLAFVVGAQEAAKRMEKVGGGSIISLSSTGNLV-----------Y  158 (260)
T ss_pred             EEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCC-----------C
T ss_conf             99864342276423577746659899999999999899999999999999970990899976544566-----------7


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH-------HHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             234311345544555543200123---456764203477778985034-------4431134543222110001024777
Q gi|254780595|r  122 VHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF-------IKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       122 ~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~-------~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
                      ......|+.+|...+.+.+.++.+   +|+.+-.+-|+.+--+.-..+       ..+.+..+.        --+-..+|
T Consensus       159 ~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~ped  230 (260)
T PRK08416        159 IENYAGHGTSKAAVEAMVRYAATELGEKNIRVNAVSGGPIDTDALKAFTNYEEVKAKTEELSPL--------NRMGQPED  230 (260)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCC--------CCCCCHHH
T ss_conf             9851778988889999999999998455959999973779866665169849999999857998--------99819999


Q ss_pred             HHHHHHHHHCCCC----CCCEECCCC
Q ss_conf             7999999951355----786162684
Q gi|254780595|r  192 VARCVIFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       192 va~~i~~l~~~~~----~~iyni~~~  213 (289)
                      +++++.+|.....    |+++.+-.|
T Consensus       231 iA~~v~fL~S~~ss~iTG~~i~VDGG  256 (260)
T PRK08416        231 LAGACLFLCSEKASWLTGQTIIVDGG  256 (260)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999485426865983898977


No 242
>KOG1208 consensus
Probab=97.92  E-value=0.00014  Score=45.71  Aligned_cols=159  Identities=11%  Similarity=0.014  Sum_probs=89.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HH----HCCCEEEECCCCCCCHHH------HHHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----56----449828980678640234------65411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LK----HKGISPFLFADQKINNLL------REKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~----~~~~~~~~~~~~~~~~~~------~~~~~~~~   66 (289)
                      .++|||+ .=||...+++|..+|.+|+-..|+.++...    +.    ...+.....|..+.....      .......|
T Consensus        37 ~~vVTGansGIG~eta~~La~~Ga~Vv~~~R~~~~~~~~~~~i~~~~~~~~i~~~~lDLssl~SV~~fa~~~~~~~~~ld  116 (314)
T KOG1208          37 VALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAKEQIQKGKANQKIRVIQLDLSSLKSVRKFAEEFKKKEGPLD  116 (314)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             79995898843799999999579989998477788999999997108776369998799999999999999985178765


Q ss_pred             EEEEEECCCCC----C-CEEECCC----------CCHHHHHHHCC--CCCCCCCCEEECCC--CCCCCCCCCCC-CCCCC
Q ss_conf             27876124443----3-1000122----------10134432012--33433332010257--62123453211-23431
Q gi|254780595|r   67 HIVQCIKPSSE----G-DPCIISM----------SKDFYKFMPHV--KWIGYLSSTSIYGN--REGQWVDEHSF-VHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~----~-~~~~~~~----------~~~~~~~~~~~--~~~i~~SS~~VYg~--~~g~~i~E~~~-~~P~~  126 (289)
                      ++++.|+-...    . |..-..+          .+.+...+...  .|+|++||..- +.  .-+....|... .....
T Consensus       117 vLInNAGV~~~~~~~t~DG~E~~~~tN~lg~flLt~lLlp~lk~s~~~RIV~vsS~~~-~~~~~~~~l~~~~~~~~~~~~  195 (314)
T KOG1208         117 VLINNAGVMAPPFSLTKDGLELTFATNYLGHFLLTELLLPLLKRSAPSRIVNVSSILG-GGKIDLKDLSGEKAKLYSSDA  195 (314)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCC-CCCCCHHHCCCHHHCCCCHHH
T ss_conf             8986552236765456544113000232999999999999985378976799806534-676653323623313555067


Q ss_pred             HHHHHHHHHHHHHHHCCCCC--CCCCCCCCCCCCCCC
Q ss_conf             13455445555432001234--567642034777789
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKKL--NIKLAVLRLSGIYGP  161 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~~--~~~~~ilR~~~iyGp  161 (289)
                      .|+.+|++......++++..  |+.+..+.|+.+..+
T Consensus       196 ~Y~~SKla~~l~~~eL~k~l~~~V~~~~~hPG~v~t~  232 (314)
T KOG1208         196 AYALSKLANVLLANELAKRLKKGVTTYSVHPGVVKTT  232 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             8888699899999999988554966998678612154


No 243
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=97.92  E-value=5.1e-05  Score=48.15  Aligned_cols=75  Identities=15%  Similarity=0.110  Sum_probs=54.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEE-----CC-CCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             939998888889999999998898899996794463455644982898-----06-786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-----FA-DQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~-----~~-~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||.|+|||-.|++|+..|.+.||+|+...|+++....+......+..     +. .......+.+.+.++|.|+.+++.
T Consensus         1 kKI~IiGaG~wGtAla~~la~n~~~V~l~~r~~~~~~~i~~~~~n~~~lp~~~l~~~i~~~~dl~~a~~~adiIiiavps   80 (159)
T pfam01210         1 KKIAVLGAGSWGTALAKVLARNGHEVRLWGRDEELIEEINTTRENVKYLPGIKLPDNLRATTDLEEAIKGADIIVLAVPS   80 (159)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHCCCCCHHCCCCCCCCCEEECCCHHHHHHCCCEEEEECCH
T ss_conf             98999996999999999999879989999904366677886697821047864555305428899998379899991748


Q ss_pred             C
Q ss_conf             4
Q gi|254780595|r   75 S   75 (289)
Q Consensus        75 ~   75 (289)
                      .
T Consensus        81 ~   81 (159)
T pfam01210        81 Q   81 (159)
T ss_pred             H
T ss_conf             8


No 244
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.92  E-value=0.00069  Score=41.69  Aligned_cols=197  Identities=14%  Similarity=0.116  Sum_probs=99.0

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHH---HHHHHHHC-CCE-EEECCCCCCCH------HHHHHHCCCCE
Q ss_conf             3999888-8--8899999999988988999967944---63455644-982-89806786402------34654115632
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVS---NLLTLKHK-GIS-PFLFADQKINN------LLREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~---~~~~l~~~-~~~-~~~~~~~~~~~------~~~~~~~~~~~   67 (289)
                      ++||||| |  =||..+++.|.++|.+|....|+..   ....+... +.. .+..|..+.+.      .+.+....+|.
T Consensus         7 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~G~iDi   86 (274)
T PRK08415          7 KGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDLGEIDF   86 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999983799999999998699999984887899999999986299769990289999999999999998589888


Q ss_pred             EEEEECCCC--CC-----CEEECCCC----CHH----------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             787612444--33-----10001221----013----------4432012334333320102576212345321123431
Q gi|254780595|r   68 IVQCIKPSS--EG-----DPCIISMS----KDF----------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~--~~-----~~~~~~~~----~~~----------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ++++++...  ..     +.....+.    .++          ......-.++|.+||.+-.   .+        .-..+
T Consensus        87 lVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~iss~~~~---~~--------~p~~~  155 (274)
T PRK08415         87 IVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTLSYLGGV---KY--------VPHYN  155 (274)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC---CC--------CCCCH
T ss_conf             85335557643346873338999999999999999999999999874307987642202465---66--------66300


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             1345544555543200123---4567642034777789850---344431134543222110001024777799999995
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~---~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      .|+.+|.+.+.+.+..+.+   +|+++-.+-|+.|--+...   ......+......+-+    -+-..+|++.++++|.
T Consensus       156 ~y~asKaal~~ltk~lA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~----R~g~pediA~av~FLa  231 (274)
T PRK08415        156 VMGVAKAALESSVRYLAVDLGKKGIRVNAISAGPIKTLAASGIGDFRMILKWNEINAPLK----KNVSIEEVGNSAMYLL  231 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHH
T ss_conf             367778999999999999983549699998768777610013888999998787489978----9969999999999995


Q ss_pred             CCCC----CCCEECCCC
Q ss_conf             1355----786162684
Q gi|254780595|r  201 THHL----GGIFNLSDD  213 (289)
Q Consensus       201 ~~~~----~~iyni~~~  213 (289)
                      ....    |+++.+-.+
T Consensus       232 Sd~ss~iTG~~i~VDGG  248 (274)
T PRK08415        232 SDLASGVTGEIHYVDAG  248 (274)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84535736871577879


No 245
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.91  E-value=0.00051  Score=42.45  Aligned_cols=197  Identities=13%  Similarity=0.102  Sum_probs=96.4

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHHH---HHHHHHC-CCEEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-8--88999999999889889999679446---3455644-98289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVSN---LLTLKHK-GISPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~~---~~~l~~~-~~~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      ++||||+ +  =||..+++.|.+.|.+|....|+.+.   ...+... +.......|..+...+.       +.....|.
T Consensus         8 ~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iD~   87 (262)
T PRK07984          8 RILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKVWPKFDG   87 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999972599999999998799999982777899999999975498289988899999999999999998387788


Q ss_pred             EEEEECC--CCCCCE-EECCCCCH------------HHHHHHC-------CCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7876124--443310-00122101------------3443201-------233433332010257621234532112343
Q gi|254780595|r   68 IVQCIKP--SSEGDP-CIISMSKD------------FYKFMPH-------VKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        68 v~~~~~~--~~~~~~-~~~~~~~~------------~~~~~~~-------~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      ++|+++.  ....+. ........            +......       -..++.+||.+.+           .+.-..
T Consensus        88 lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~iss~~~~-----------~~~p~~  156 (262)
T PRK07984         88 FVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAE-----------RAIPNY  156 (262)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC-----------CCCCCC
T ss_conf             999502276322463178886099999999887899999999888751479759999504432-----------667872


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             11345544555543200123---4567642034777789850---34443113454322211000102477779999999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~---~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      ..|+.+|...+.+.+.++.+   +|+++-.+.|+.|--+...   .+...........  |  .--+...+|+|+++.+|
T Consensus       157 ~~y~~sKaal~~ltr~lA~el~~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~--P--l~R~g~pediA~~v~fL  232 (262)
T PRK07984        157 NVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVT--P--IRRTVTIEDVGNSAAFL  232 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHCCCCCHHHHHHHHHHCC--C--CCCCCCHHHHHHHHHHH
T ss_conf             0888888899999999999948588799998647765520014867799999998679--9--89995999999999999


Q ss_pred             HCCC----CCCCEECCCC
Q ss_conf             5135----5786162684
Q gi|254780595|r  200 MTHH----LGGIFNLSDD  213 (289)
Q Consensus       200 ~~~~----~~~iyni~~~  213 (289)
                      ....    .|+++++-.+
T Consensus       233 ~Sd~s~~iTG~~i~VDGG  250 (262)
T PRK07984        233 CSDLSAGISGEVVHVDGG  250 (262)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             686425843873896949


No 246
>KOG1205 consensus
Probab=97.90  E-value=0.00017  Score=45.14  Aligned_cols=184  Identities=15%  Similarity=0.060  Sum_probs=93.7

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCH---HHH-HHHHHC----CCEEEECCCCCCCHHH------HHHHCCCC
Q ss_conf             3999888-8889999999998898899996794---463-455644----9828980678640234------65411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSV---SNL-LTLKHK----GISPFLFADQKINNLL------REKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~---~~~-~~l~~~----~~~~~~~~~~~~~~~~------~~~~~~~~   66 (289)
                      .++|||| .=||.+++.+|.++|.++.-+.|..   ++. ..+...    .+....+|..+.++..      .....++|
T Consensus        14 vVvITGASsGIG~~lA~~la~~G~~l~lvar~~rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~~fg~vD   93 (282)
T KOG1205          14 VVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIRHFGRVD   93 (282)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             89995787178899999998677734774243202899999999747867647996765887889999999998658888


Q ss_pred             EEEEEECCCCCCCEE--------ECCCCCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             278761244433100--------01221013-------44320-----12334333320102576212345321123431
Q gi|254780595|r   67 HIVQCIKPSSEGDPC--------IISMSKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        67 ~v~~~~~~~~~~~~~--------~~~~~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ++++.++-.. ....        ...+..|+       .+..+     +-.+++.+||..-+  .       ..|..  .
T Consensus        94 vLVNNAG~~~-~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~m~~r~~GhIVvisSiaG~--~-------~~P~~--~  161 (282)
T KOG1205          94 VLVNNAGISL-VGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPSMKKRNDGHIVVISSIAGK--M-------PLPFR--S  161 (282)
T ss_pred             EEEECCCCCC-CCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC--C-------CCCCC--C
T ss_conf             8984686565-553344768988877100040248999999887663289749998061015--5-------78865--5


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC---C-HHHHHHCCCCCCCCCCCCEECCHHHHHHHH--HHHHHH
Q ss_conf             1345544555543200123456764203477778985---0-344431134543222110001024777799--999995
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---N-PFIKIRQKNSLRLVKKNQVFNRIRVEDVAR--CVIFLM  200 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp~r---~-~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~--~i~~l~  200 (289)
                      .|..+|.+.+.....+..+..-..++++.  +.-||-   . ....+......     .+.......+|++.  .+...+
T Consensus       162 ~Y~ASK~Al~~f~etLR~El~~~~~~i~i--~V~PG~V~Te~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~i  234 (282)
T KOG1205         162 IYSASKHALEGFFETLRQELIPLGTIIII--LVSPGPIETEFTGKELLGEEGK-----SQQGPFLRTEDVADPEAVAYAI  234 (282)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCEEEE--EEECCCEEECCCCHHHCCCCCC-----CCCCCHHHHHHHHHHHHHHHHH
T ss_conf             41567999999999999996405845999--9845815524502543365542-----2246313466542089999998


Q ss_pred             CCCC
Q ss_conf             1355
Q gi|254780595|r  201 THHL  204 (289)
Q Consensus       201 ~~~~  204 (289)
                      ..++
T Consensus       235 ~~~~  238 (282)
T KOG1205         235 STPP  238 (282)
T ss_pred             HCCC
T ss_conf             3585


No 247
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=97.90  E-value=8.7e-05  Score=46.83  Aligned_cols=67  Identities=16%  Similarity=0.193  Sum_probs=39.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             939998888889999999998898899996794463455644982898067864023465411563278761244433
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG   78 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~   78 (289)
                      |+|.|+|.-.=--+++++|.++|++|....-+...     . +     +..........+.+..+|.++--++...+.
T Consensus         3 ~~iaviGGD~Rq~~l~~~L~~~g~~V~~~gf~~~~-----~-~-----~~~~~~~~~~~~~~~~~d~iIlPvpg~~d~   69 (296)
T PRK08306          3 MHIAVIGGDARQLELIRKLVELGAKVSLVGFDQLD-----H-G-----FTGVAKCSSLEEALSDVDVIILPVPGTNDE   69 (296)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCC-----C-C-----CCCEEEECCHHHHHHCCCEEEECCCCCCCC
T ss_conf             48999787589999999999779979998357655-----5-6-----676177346788872399999788322589


No 248
>PRK07791 short chain dehydrogenase; Provisional
Probab=97.88  E-value=0.00027  Score=43.99  Aligned_cols=194  Identities=13%  Similarity=0.042  Sum_probs=96.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEEC---------CHHHH----HHHHHCCCEE--EECCCCCCCHHHH------
Q ss_conf             3999888-88899999999988988999967---------94463----4556449828--9806786402346------
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTR---------SVSNL----LTLKHKGISP--FLFADQKINNLLR------   59 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r---------~~~~~----~~l~~~~~~~--~~~~~~~~~~~~~------   59 (289)
                      .+||||+ +=||..++..|.++|.+|....+         +....    ..+...+.+.  +..|.. +.....      
T Consensus         8 valVTGas~GIG~aiA~~lA~~GA~Vvi~D~~~~~~~~~~~~~~a~~~~~ei~~~g~~~~~~~~Dvs-d~~~v~~~v~~~   86 (285)
T PRK07791          8 VVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPASGGAAQAVVDEITAAGGEAVANGDDIA-DWDQAANLVDAA   86 (285)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCC-CHHHHHHHHHHH
T ss_conf             7999286768999999999986999999837643122445679999999999974983999968999-999999999999


Q ss_pred             -HHHCCCCEEEEEECCCCCC---CEEECC----CCCHH----------HHHHH-C-------CCCCCCCCCEEECCCCCC
Q ss_conf             -5411563278761244433---100012----21013----------44320-1-------233433332010257621
Q gi|254780595|r   60 -EKLYFTTHIVQCIKPSSEG---DPCIIS----MSKDF----------YKFMP-H-------VKWIGYLSSTSIYGNREG  113 (289)
Q Consensus        60 -~~~~~~~~v~~~~~~~~~~---~~~~~~----~~~~~----------~~~~~-~-------~~~~i~~SS~~VYg~~~g  113 (289)
                       .....+|.++++++-....   +.....    +..++          ..... .       ..++|.+||.+-+-   +
T Consensus        87 ~~~fG~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~~g~~~~G~IInisS~~g~~---g  163 (285)
T PRK07791         87 VETFGGLDVLVNNAGILRDRMFANTSEEEWDAVIRVHLKGHFATLRHAAAYWRDQSKAGKAVDARIINTSSGAGLQ---G  163 (285)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHCC---C
T ss_conf             9983998699978866788875669999999999998388999999999999998645899845999966445377---9


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHH
Q ss_conf             23453211234311345544555543200123---456764203477778985034443113454322211000102477
Q gi|254780595|r  114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVE  190 (289)
Q Consensus       114 ~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~  190 (289)
                              ......|+.+|.....+.+..+.+   +|+.+-.+-|+..-......+.......       ...+....-+
T Consensus       164 --------~~~~~~Y~asKaav~~lTr~lA~Ela~~gIrVNaVaPg~~t~~~~~~~~~~~~~~-------~~~~~~~~Pe  228 (285)
T PRK07791        164 --------SVGQANYSAAKAGIAALTLVAAAELGRYGVTVNAIAPAARTRMTETVFADMMAKP-------EDGFDAMAPE  228 (285)
T ss_pred             --------CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHCC-------CCCCCCCCHH
T ss_conf             --------9986789999999999999999996312959999837788887633479987464-------0036888999


Q ss_pred             HHHHHHHHHHCCCC----CCCEECCCCC
Q ss_conf             77999999951355----7861626843
Q gi|254780595|r  191 DVARCVIFLMTHHL----GGIFNLSDDE  214 (289)
Q Consensus       191 Dva~~i~~l~~~~~----~~iyni~~~~  214 (289)
                      |+|.++++|.....    |+++++-.+.
T Consensus       229 dIA~~v~FLaSd~asyITGq~l~VDGG~  256 (285)
T PRK07791        229 NVSPLVVWLGSAESRDVTGKVFEVEGGK  256 (285)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEEECCCE
T ss_conf             9999999981740078778759977993


No 249
>PRK08507 prephenate dehydrogenase; Validated
Probab=97.88  E-value=6.5e-05  Score=47.53  Aligned_cols=67  Identities=16%  Similarity=0.110  Sum_probs=49.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             939998888889999999998898--899996794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGV--YTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~--~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||.|+|.|.||..++..|.+.+.  +|+|..++++........++.    +....    ...+..+|.|+.|.|+.
T Consensus         1 M~I~IiGlGLiGgSla~alk~~~~~~~V~g~d~~~~~~~~A~~~g~i----d~~~~----~~~i~~aDlVila~Pv~   69 (275)
T PRK08507          1 MKIGIIGLGLMGGSLGLALKENKLISCVYGYDHNEEHEKDALDLGLV----DEIVE----FEEIKECDVIFLAIPVD   69 (275)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCC----CCCCC----HHHCCCCCEEEEECCHH
T ss_conf             98999900878999999999509986799995999999999986998----61067----31236579899917699


No 250
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=97.88  E-value=8.9e-05  Score=46.76  Aligned_cols=44  Identities=25%  Similarity=0.264  Sum_probs=39.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC
Q ss_conf             93999888888999999999889889999679446345564498
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI   44 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~   44 (289)
                      |||.|+|+|=||+.+...|.+.|++|+.+.|++++...+...+.
T Consensus         3 MkI~IiGaGAiG~~~a~~L~~ag~dV~lv~r~~~~~~~~~~~g~   46 (305)
T PRK05708          3 MTWHILGAGSLGSLWACRLARAGLPVRLILRDRQRLAAYQQAGG   46 (305)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCC
T ss_conf             88999882399999999998489973999947899999997899


No 251
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]
Probab=97.87  E-value=5.4e-05  Score=48.00  Aligned_cols=97  Identities=14%  Similarity=0.114  Sum_probs=66.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             93999888888999999999889889999679446-34556449828980678640234654115632787612444331
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSN-LLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGD   79 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~   79 (289)
                      |||-.+|-|-.|..++..|+++||+|++.+|++++ ...+...+....        ....+....+|.|+.+++....-.
T Consensus         1 ~kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a--------~s~~eaa~~aDvVitmv~~~~~V~   72 (286)
T COG2084           1 MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVA--------ASPAEAAAEADVVITMLPDDAAVR   72 (286)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEC--------CCHHHHHHHCCEEEEECCCHHHHH
T ss_conf             907998573525999999997798789980885665689997298003--------889999961998999617989999


Q ss_pred             EEECCCCCHHHHHHHCCCCCCCCCCEE
Q ss_conf             000122101344320123343333201
Q gi|254780595|r   80 PCIISMSKDFYKFMPHVKWIGYLSSTS  106 (289)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~i~~SS~~  106 (289)
                      .++.. ..-+....+.-+-+|=.||++
T Consensus        73 ~V~~g-~~g~~~~~~~G~i~IDmSTis   98 (286)
T COG2084          73 AVLFG-ENGLLEGLKPGAIVIDMSTIS   98 (286)
T ss_pred             HHHHC-CCCHHHCCCCCCEEEECCCCC
T ss_conf             99818-533533378997899878999


No 252
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=97.83  E-value=7.3e-05  Score=47.25  Aligned_cols=133  Identities=13%  Similarity=-0.007  Sum_probs=71.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEE-EEEECCHH--HH----HHHHHCCC--EEEECCCCCCCHH------HHHHHCCC
Q ss_conf             3999888-888999999999889889-99967944--63----45564498--2898067864023------46541156
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYT-CGTTRSVS--NL----LTLKHKGI--SPFLFADQKINNL------LREKLYFT   65 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V-~~~~r~~~--~~----~~l~~~~~--~~~~~~~~~~~~~------~~~~~~~~   65 (289)
                      .+||||+ +=||..+++.|.++|..+ +...|+..  ..    ..+...+.  ..+..|..+.+..      +.+....+
T Consensus         2 T~lITGas~GIG~aia~~la~~Ga~~vv~~~r~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~i   81 (167)
T pfam00106         2 TVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVADRDALAALLAALPAALGPL   81 (167)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             89998978789999999999879948999659967689999999999559859999846999999999999999975997


Q ss_pred             CEEEEEECCCCCC---CEEECC----CCCHHH------H-HH-HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             3278761244433---100012----210134------4-32-0123343333201025762123453211234311345
Q gi|254780595|r   66 THIVQCIKPSSEG---DPCIIS----MSKDFY------K-FM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVAT  130 (289)
Q Consensus        66 ~~v~~~~~~~~~~---~~~~~~----~~~~~~------~-~~-~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~  130 (289)
                      |.++++++-....   +.....    +..++.      + .. ....++|++||.+-+-.           .-....|+.
T Consensus        82 D~linnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~~~G~Ii~isS~~g~~~-----------~~~~~~Y~a  150 (167)
T pfam00106        82 DGVVHNAGVLDDGPLEELTPERFERVLAPKVTGAWNLHELTLDLDLGAFVLFSSVAGVLG-----------SPGQANYAA  150 (167)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC-----------CCCCHHHHH
T ss_conf             399988712689865652699999999998699999999975535895799935111378-----------999778999


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             544555543200123
Q gi|254780595|r  131 QRFNAEKEWLAITKK  145 (289)
Q Consensus       131 ~k~~~E~~~~~~~~~  145 (289)
                      +|...+.+.+..+.+
T Consensus       151 sKaal~~lt~~La~E  165 (167)
T pfam00106       151 ANAALDALAEHRRAE  165 (167)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999976


No 253
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.81  E-value=0.00075  Score=41.50  Aligned_cols=197  Identities=14%  Similarity=0.086  Sum_probs=99.3

Q ss_pred             EEEEECC--CH-HHHHHHHHHHHCCCEEEEEECCHH---HHHHHHHC-CCEEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888--88-899999999988988999967944---63455644-98289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA--GY-TGKFIADAALKVGVYTCGTTRSVS---NLLTLKHK-GISPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga--G~-iG~~l~~~L~~~g~~V~~~~r~~~---~~~~l~~~-~~~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      ++||||+  |. ||..+++.+.+.|.+|....|+..   ....+... +...+..-|..+.+.+.       +....+|.
T Consensus        10 ~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDi   89 (260)
T PRK06603         10 KGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDIKEKWGSFDF   89 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998999966899999999998799999966867999999999984383769865799999999999999998699778


Q ss_pred             EEEEECCCCCC-------CEEECCCCCHH--------------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             78761244433-------10001221013--------------4432012334333320102576212345321123431
Q gi|254780595|r   68 IVQCIKPSSEG-------DPCIISMSKDF--------------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~~~-------~~~~~~~~~~~--------------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ++|.++.....       +.....+...+              .....+-.++|.+||.+...   +        .-...
T Consensus        90 LVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m~~~GsIi~iss~~~~~---~--------~p~~~  158 (260)
T PRK06603         90 LLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEK---V--------IPNYN  158 (260)
T ss_pred             EEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC---C--------CCCCC
T ss_conf             996442377765677510298999999999998999999999778741797302342210013---4--------78642


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH---HHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             1345544555543200123---456764203477778985034---4431134543222110001024777799999995
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNPF---IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~~---~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
                      .|+.+|.+.+.+.+.++.+   +++++-.+.|+.|.-+....+   ....+......  |  .--+...+|+++++++|.
T Consensus       159 ~Y~asKaal~~ltr~lA~ela~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~--P--l~R~g~pedia~~~~FLa  234 (260)
T PRK06603        159 VMGVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATA--P--LKRNTTQEDVGGAAVYLF  234 (260)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHCCCHHHHHHHHHHCC--C--CCCCCCHHHHHHHHHHHH
T ss_conf             006659999999999999966348089997327765642220467799999998579--9--899959999999999996


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
                      ...    -|+++.+=.+
T Consensus       235 Sd~s~~iTG~~i~vDGG  251 (260)
T PRK06603        235 SELSKGVTGEIHYVDCG  251 (260)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             68223725871788979


No 254
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated
Probab=97.81  E-value=0.00014  Score=45.64  Aligned_cols=75  Identities=17%  Similarity=0.170  Sum_probs=54.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEE-----CC-CCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             939998888889999999998898899996794463455644982898-----06-786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-----FA-DQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~-----~~-~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||.|+|+|--|++|+..|.+.+|+|+...|+++....+......+-.     +. .......+.+.+.++|.|+.++|.
T Consensus         2 mkI~ViGaGawGtAlA~~la~n~~~V~lw~r~~~~~~~In~~~~n~~ylp~i~L~~nI~~t~dl~~~l~~ad~iiiavPs   81 (325)
T PRK00094          2 MKIAVLGAGSWGTALAILLARNGHDVVLWGRDPEHAAEINTDRENPRYLPGIKLPDNLRATSDLAEALADADLILVAVPS   81 (325)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCHHHHHHCCCEEEEECCH
T ss_conf             88999898999999999999789978999838999999996498865689785899838978999998379849994576


Q ss_pred             C
Q ss_conf             4
Q gi|254780595|r   75 S   75 (289)
Q Consensus        75 ~   75 (289)
                      .
T Consensus        82 ~   82 (325)
T PRK00094         82 H   82 (325)
T ss_pred             H
T ss_conf             9


No 255
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.80  E-value=0.0011  Score=40.61  Aligned_cols=193  Identities=16%  Similarity=0.093  Sum_probs=95.5

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHH---HHHHHHHC-CC-EEEECCCCCCCHHH-------HHHHCCCC
Q ss_conf             3999888-8--8899999999988988999967944---63455644-98-28980678640234-------65411563
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVS---NLLTLKHK-GI-SPFLFADQKINNLL-------REKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~---~~~~l~~~-~~-~~~~~~~~~~~~~~-------~~~~~~~~   66 (289)
                      ++||||+ |  =||..+++.|.++|.+|....|+..   +...+... +. .....|..+ ...+       .+....+|
T Consensus        12 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvtd-~~~v~~~v~~~~~~~G~iD   90 (272)
T PRK08159         12 RGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELGAFVVGHCDVTD-EASIDAVFETLEKKWGKLD   90 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHHHHHHHHHHCCCC
T ss_conf             999988999868999999999986999999748668999999999864981899837899-9999999999999869978


Q ss_pred             EEEEEECCCCCC-------CEEECCCCC----HH---HH-------HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             278761244433-------100012210----13---44-------3201233433332010257621234532112343
Q gi|254780595|r   67 HIVQCIKPSSEG-------DPCIISMSK----DF---YK-------FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        67 ~v~~~~~~~~~~-------~~~~~~~~~----~~---~~-------~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~  125 (289)
                      .++++++.....       +.....+..    ++   ..       ...+-..+|.+||.+...   .      .|  ..
T Consensus        91 iLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~iss~~~~~---~------~p--~~  159 (272)
T PRK08159         91 FVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTLTYYGAEK---V------MP--HY  159 (272)
T ss_pred             EEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCC---C------CC--CC
T ss_conf             8985354466644566543288999999998886899999988765404787034787541233---4------77--52


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCCCCCCEE-CCHHHHHHHHHHHH
Q ss_conf             11345544555543200123---4567642034777789850---34443113454322211000-10247777999999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIF  198 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~---~~~~~~~g~~~~~~~~~~~~-~~ihv~Dva~~i~~  198 (289)
                      +.|+.+|.+.+.+.+.++.+   +|+++-.+-|+.+.-+-..   .+..+.+...     ..... -....+|+++++++
T Consensus       160 ~~y~~sKaAl~~ltr~lA~elg~~gIRVNaVaPG~i~T~~~~~~~~~~~~~~~~~-----~~~pl~R~g~pedvA~av~f  234 (272)
T PRK08159        160 NVMGVAKAALEASVRYLAVDLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNE-----YNAPLRRTVTIEEVGDSALY  234 (272)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHCCCCCHHHHHHHHH-----HCCCCCCCCCHHHHHHHHHH
T ss_conf             0256789999999999999757899899998637777710004877899998687-----37997898499999999999


Q ss_pred             HHCCCC----CCCEECC
Q ss_conf             951355----7861626
Q gi|254780595|r  199 LMTHHL----GGIFNLS  211 (289)
Q Consensus       199 l~~~~~----~~iyni~  211 (289)
                      |.....    |++..+-
T Consensus       235 L~Sd~s~~iTGq~l~VD  251 (272)
T PRK08159        235 LLSDLSRGVTGEVHHVD  251 (272)
T ss_pred             HHCCHHCCCCCCEEEEC
T ss_conf             95862158548708879


No 256
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=97.79  E-value=9.9e-05  Score=46.52  Aligned_cols=77  Identities=12%  Similarity=0.146  Sum_probs=55.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECC------------CCCCCHHHHHHHCCCCEE
Q ss_conf             93999888888999999999889889999679446345564498289806------------786402346541156327
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA------------DQKINNLLREKLYFTTHI   68 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~v   68 (289)
                      |||-|+|+||+|......|.+.||+|+++.-++++...+++...-.+.-.            ...............+.+
T Consensus         1 MkI~viGtGYVGLv~g~~lA~~GHeVv~vDid~~KV~~ln~g~~PI~EpgLe~ll~~~~~~gRl~fTtd~~~a~~~adv~   80 (414)
T COG1004           1 MKITVIGTGYVGLVTGACLAELGHEVVCVDIDESKVELLNKGISPIYEPGLEELLKENLASGRLRFTTDYEEAVKDADVV   80 (414)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEECCHHHHHHCCCEE
T ss_conf             91589888556887899998709848999578899999867999976705899998462357279874788896259779


Q ss_pred             EEEECCCCC
Q ss_conf             876124443
Q gi|254780595|r   69 VQCIKPSSE   77 (289)
Q Consensus        69 ~~~~~~~~~   77 (289)
                      +.+++-+..
T Consensus        81 fIavgTP~~   89 (414)
T COG1004          81 FIAVGTPPD   89 (414)
T ss_pred             EEECCCCCC
T ss_conf             997489999


No 257
>PRK08862 short chain dehydrogenase; Provisional
Probab=97.79  E-value=0.00033  Score=43.50  Aligned_cols=143  Identities=14%  Similarity=0.053  Sum_probs=75.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCC--CEEEECCCCCCCHH---HH---HHHC-CCCE
Q ss_conf             3999888-888999999999889889999679446345----56449--82898067864023---46---5411-5632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKG--ISPFLFADQKINNL---LR---EKLY-FTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~--~~~~~~~~~~~~~~---~~---~~~~-~~~~   67 (289)
                      .+||||| +=||..++++|.++|.+|+...|+++++..    +...+  +..+..++.+....   +.   .... ..|.
T Consensus         7 v~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~~g~~iDv   86 (227)
T PRK08862          7 IILITSAGSVLGRTISCHFARLGATLILCDQDQSALNDTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQFNRAPDV   86 (227)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99997988799999999999879999999699999999999999758974899951661999999999999995899749


Q ss_pred             EEEEECCCCCC----CEEECCC----CCH----H------HHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             78761244433----1000122----101----3------4432-0--12334333320102576212345321123431
Q gi|254780595|r   68 IVQCIKPSSEG----DPCIISM----SKD----F------YKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~~~----~~~~~~~----~~~----~------~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
                      ++++++.....    +......    ..+    +      ...+ +  ....+|.+||...+              .+..
T Consensus        87 LVNNa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~~G~IINi~S~~~~--------------~~~~  152 (227)
T PRK08862         87 LVNNWTSSPLPSLFDEQPSESFIQQLTSLASTLFTYGQVAAERMRKRKKKGVIVNVISHDDH--------------QDLT  152 (227)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCC--------------CCCH
T ss_conf             98566457788633458899999999986569999999999999966998799999768766--------------8827


Q ss_pred             HHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCC
Q ss_conf             134554455554320012---34567642034777
Q gi|254780595|r  127 CVATQRFNAEKEWLAITK---KLNIKLAVLRLSGI  158 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~i  158 (289)
                      .|+.+|...+.+.+.++.   .+|+++-.+-|+.+
T Consensus       153 ~y~asKaav~~lTkslA~Ela~~gIRVNaVaPG~i  187 (227)
T PRK08862        153 GVESSTALVSGFTHSWAKELTPFNIRVGGVVPSIF  187 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCEE
T ss_conf             89999999999999999997674989999943808


No 258
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.77  E-value=0.001  Score=40.71  Aligned_cols=196  Identities=14%  Similarity=0.102  Sum_probs=94.8

Q ss_pred             EEEEEC--C-CHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHH---CCCEEEECCCCCCCH---HH---HHHHCCCCEE
Q ss_conf             399988--8-88899999999988988999967944634-5564---498289806786402---34---6541156327
Q gi|254780595|r    2 HLMIFG--A-GYTGKFIADAALKVGVYTCGTTRSVSNLL-TLKH---KGISPFLFADQKINN---LL---REKLYFTTHI   68 (289)
Q Consensus         2 kIlI~G--a-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~-~l~~---~~~~~~~~~~~~~~~---~~---~~~~~~~~~v   68 (289)
                      ++||||  + .=||..+++.|.++|.+|....|+..+.. .+..   .....+..|..+.+.   .+   .+....+|.+
T Consensus         9 ~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~i~~Dv~~~~~v~~~~~~~~~~~G~lD~l   88 (256)
T PRK07889          9 RILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRLTERIAKRLPEPAPVLELDVTNEEHLASLADRVREHIGGLDGV   88 (256)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79998998856899999999998799999983893589999998658887599942889999999999999986897879


Q ss_pred             EEEECCCCC--------CCEEECCCCCH----HH---HHH-------HCCCCCCCCCCEEECCCCCCCCCCCCCCCCC-C
Q ss_conf             876124443--------31000122101----34---432-------0123343333201025762123453211234-3
Q gi|254780595|r   69 VQCIKPSSE--------GDPCIISMSKD----FY---KFM-------PHVKWIGYLSSTSIYGNREGQWVDEHSFVHP-I  125 (289)
Q Consensus        69 ~~~~~~~~~--------~~~~~~~~~~~----~~---~~~-------~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P-~  125 (289)
                      +|+++....        .+.........    ..   ...       ..-..++.+|+.+.             ...| .
T Consensus        89 Vnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~Iv~~s~~~~-------------~~~p~~  155 (256)
T PRK07889         89 VHSIGFAPQTALGGNPFLDAPWEDVATALHISAYSLASLAKALLPLMNPGGSIVGLDFDAT-------------VAWPAY  155 (256)
T ss_pred             EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCC-------------CCCCCH
T ss_conf             7421347744346765200358888889989999999999997654216887467457555-------------456742


Q ss_pred             CHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCH---HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHH
Q ss_conf             11345544555543200123---45676420347777898503---4443113454322211000102477779999999
Q gi|254780595|r  126 SCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRNP---FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL  199 (289)
Q Consensus       126 ~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~~---~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l  199 (289)
                      ..|+.+|...+.+.+..+.+   +|+++-.+-|+.+--+-...   +..+........+-+   +....-+|+|+++++|
T Consensus       156 ~~y~asKaal~~ltr~lA~el~~~gIRVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~pl~---~r~~~pediA~~v~fL  232 (256)
T PRK07889        156 DWMGVAKAALESTNRYLARELGPRGVRSNLVAAGPIRTLAAKAIPGFELLEEGWDQRAPLG---WDMKDPTPVAKTVVAL  232 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCC---CCCCCHHHHHHHHHHH
T ss_conf             4677789999999999999973409799999747887734433798699999998669988---7898999999999999


Q ss_pred             HCCC----CCCCEECCCC
Q ss_conf             5135----5786162684
Q gi|254780595|r  200 MTHH----LGGIFNLSDD  213 (289)
Q Consensus       200 ~~~~----~~~iyni~~~  213 (289)
                      +...    -|+++++-.+
T Consensus       233 ~Sd~s~~iTG~~l~VDGG  250 (256)
T PRK07889        233 LSDWFPATTGEIIHVDGG  250 (256)
T ss_pred             HCCHHCCCCCCEEEECCC
T ss_conf             678223716885887959


No 259
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=97.77  E-value=0.00015  Score=45.49  Aligned_cols=45  Identities=27%  Similarity=0.344  Sum_probs=39.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEE
Q ss_conf             9399988888899999999988988999967944634556449828
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP   46 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~   46 (289)
                      |||+|+|+|=||+.+.-.|.+.||+|+.+.|+ ++...+...|...
T Consensus         1 MkI~I~GaGAiG~~~a~~L~~~g~~V~lv~r~-~~~~~i~~~Gl~i   45 (306)
T PRK12921          1 MKIAVVGAGAVGGTFGARLLEAGRDVTFLGRS-ARAEALREKGLVI   45 (306)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEEC-CHHHHHHHCCEEE
T ss_conf             98999992499999999998369988999700-0999999789699


No 260
>pfam02254 TrkA_N TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.
Probab=97.76  E-value=0.00015  Score=45.51  Aligned_cols=69  Identities=14%  Similarity=0.196  Sum_probs=54.1

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEE
Q ss_conf             9998888889999999998898899996794463455644982898067864023465411563278761
Q gi|254780595|r    3 LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         3 IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~   72 (289)
                      |+|.|+|-+|+.+++.|.++| +|+++.+++++...+...+...+.+|..+........+..++.++.+.
T Consensus         1 viI~G~g~~G~~la~~L~~~~-~v~vId~d~~~~~~~~~~~~~vi~GD~~~~~~L~~a~i~~a~~vi~~~   69 (115)
T pfam02254         1 IIIIGYGRVGRSLAEELREGG-PVVVIDKDPERVEELREEGVPVVVGDATDEEVLEEAGIEDADAVVAAT   69 (115)
T ss_pred             CEEECCCHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHCCCCCCEEEEEC
T ss_conf             999878889999999998089-999999987998778866986999956886678761920287999962


No 261
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=97.74  E-value=0.00015  Score=45.52  Aligned_cols=77  Identities=22%  Similarity=0.200  Sum_probs=56.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCE
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124443310
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDP   80 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   80 (289)
                      |||=++|-|-+|..++..|++.||+|++..|++++...+...+....     .....+...++....|+.+++.....+.
T Consensus         1 MkIGfIGLG~MG~~mA~nL~~~G~~V~v~dr~~~~~~~~~~~ga~~~-----~s~~e~~~~~d~prvI~l~lp~~~~Vd~   75 (301)
T PRK09599          1 MQLGMIGLGRMGGNMARRLLRGGHEVVGYDRNPEAVEALAAEGATGA-----ASLEELVAKLPAPRVVWLMVPAGEITDS   75 (301)
T ss_pred             CEEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEC-----CCHHHHHHHCCCCCEEEEECCCCHHHHH
T ss_conf             97999834587999999999689907997699999999998599432-----9999999707888779998179703899


Q ss_pred             EE
Q ss_conf             00
Q gi|254780595|r   81 CI   82 (289)
Q Consensus        81 ~~   82 (289)
                      ++
T Consensus        76 Vi   77 (301)
T PRK09599         76 TI   77 (301)
T ss_pred             HH
T ss_conf             99


No 262
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.74  E-value=0.0016  Score=39.57  Aligned_cols=192  Identities=13%  Similarity=0.085  Sum_probs=98.7

Q ss_pred             EEEEEC--C-CHHHHHHHHHHHHCCCEEEEEECCH---HHHHHHHH-CCCE-EEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             399988--8-8889999999998898899996794---46345564-4982-89806786402346-------5411563
Q gi|254780595|r    2 HLMIFG--A-GYTGKFIADAALKVGVYTCGTTRSV---SNLLTLKH-KGIS-PFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~G--a-G~iG~~l~~~L~~~g~~V~~~~r~~---~~~~~l~~-~~~~-~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
                      ++||||  + .=||..+++.|.++|.+|....++.   +....+.. .+.. .+..|.. +...+.       +....+|
T Consensus         8 ~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~-~~~~v~~~v~~~~~~~g~iD   86 (260)
T PRK06997          8 RILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSDLVFPCDVA-DDAQIDALFASLGTRWDGLD   86 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCC-CHHHHHHHHHHHHHHHCCCC
T ss_conf             89998998872899999999998599999980880669999999986298479983799-99999999999999849989


Q ss_pred             EEEEEECCCCC----C---CEEE-CCCCC----HH------H-H---HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             27876124443----3---1000-12210----13------4-4---320123343333201025762123453211234
Q gi|254780595|r   67 HIVQCIKPSSE----G---DPCI-ISMSK----DF------Y-K---FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        67 ~v~~~~~~~~~----~---~~~~-~~~~~----~~------~-~---~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      .+++.++....    .   +... .....    +.      . +   ....-..++.+||.+...           +.-.
T Consensus        87 ~LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~~~~~g~iv~iss~~~~~-----------~~p~  155 (260)
T PRK06997         87 GLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLGAER-----------VVPN  155 (260)
T ss_pred             EEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECEE-----------CCCC
T ss_conf             89644776773223533466558999999999888999999999987631677632301220100-----------3687


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC---H----HHHHHCCCCCCCCCCCCEECCHHHHHHHH
Q ss_conf             311345544555543200123---4567642034777789850---3----44431134543222110001024777799
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN---P----FIKIRQKNSLRLVKKNQVFNRIRVEDVAR  194 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~---~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~  194 (289)
                      ...|+.+|...+.+.+..+.+   +|+++-.+.|+.|.-+...   .    ...+.+..+.        --+.-.+|+++
T Consensus       156 ~~~y~asKaal~~ltr~lA~elg~~gIRVNaV~PG~i~t~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~peeiA~  227 (260)
T PRK06997        156 YNTMGLAKASLEASVRYLAVSLGPKGIRVNAISAGPIKTLAASGIKDFGKILDFVESNAPL--------RRNVTIEQVGN  227 (260)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCHHHHHHHHHHCCCC--------CCCCCHHHHHH
T ss_conf             4223778899999999999986117978988733753356652689759999999857998--------99959999999


Q ss_pred             HHHHHHCCC----CCCCEECCCC
Q ss_conf             999995135----5786162684
Q gi|254780595|r  195 CVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       195 ~i~~l~~~~----~~~iyni~~~  213 (289)
                      ++.+|+...    .|+++++-.+
T Consensus       228 ~v~FL~Sd~as~iTGq~i~VDGG  250 (260)
T PRK06997        228 VAAFLLSDLASGVTGEITHVDSG  250 (260)
T ss_pred             HHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999583533705872687978


No 263
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=97.72  E-value=0.0015  Score=39.71  Aligned_cols=195  Identities=19%  Similarity=0.153  Sum_probs=109.2

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECC--HHHHHH----HHHCCCEE-EECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             999888-888999999999889889999679--446345----56449828-9806786402346-------54115632
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRS--VSNLLT----LKHKGISP-FLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~--~~~~~~----l~~~~~~~-~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
                      +||||| +=||..+++.|.++|++|.....+  .+....    ....+... ++.-|.++...+.       ......|.
T Consensus         4 alVTGaaSGIG~~iA~~LA~aGa~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~~~~D~T~~~e~~~~~~~~~~~fG~~Di   83 (258)
T TIGR01963         4 ALVTGAASGIGLAIAKALAAAGANVVVNDLGEADEGAEAAAKVATDAGGSVIYLVADVTKEEEIADMIQAVAAEFGGLDI   83 (258)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99965871678999999987298899846788789999999999961883577514788889999999999998568874


Q ss_pred             EEEEEC-----CCCCC-----CEEEC-CCC---CHHHHHHHC-----CC-CCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             787612-----44433-----10001-221---013443201-----23-343333201025762123453211234311
Q gi|254780595|r   68 IVQCIK-----PSSEG-----DPCII-SMS---KDFYKFMPH-----VK-WIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        68 v~~~~~-----~~~~~-----~~~~~-~~~---~~~~~~~~~-----~~-~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
                      +++.++     |-.++     +..+. .+.   ....+.++.     -. |+|+++|+  -|=       +-+|.+  +.
T Consensus        84 LVNNAG~QhVaPiEeFP~~~w~~iiav~LtsaF~t~raAlP~Mk~~gwGGRIiNIAS~--HGL-------vASp~K--SA  152 (258)
T TIGR01963        84 LVNNAGIQHVAPIEEFPPEKWDRIIAVMLTSAFHTIRAALPHMKKQGWGGRIINIASV--HGL-------VASPFK--SA  152 (258)
T ss_pred             EEECCCEEECCCCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEEEEEEEE--CCC-------CCCCCH--HH
T ss_conf             8844640141765477866787373021688899997506432137855379971010--000-------035321--34


Q ss_pred             HH--------HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC--CCCHHHHHHC-CCC------CCCCCCCCEECCHHHH
Q ss_conf             34--------55445555432001234567642034777789--8503444311-345------4322211000102477
Q gi|254780595|r  128 VA--------TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP--KRNPFIKIRQ-KNS------LRLVKKNQVFNRIRVE  190 (289)
Q Consensus       128 y~--------~~k~~~E~~~~~~~~~~~~~~~ilR~~~iyGp--~r~~~~~~~~-g~~------~~~~~~~~~~~~ihv~  190 (289)
                      |-        .+|..+    ++ ..++|+.+-.+.|+.|-=|  .+..=++.+. |-+      -.++++-....||-++
T Consensus       153 YVAAKHG~~GLTKv~A----LE-~A~~giT~NaiCPGYV~TPLV~~Qi~DqAk~rGi~eE~V~~~VmL~~~P~k~F~~~~  227 (258)
T TIGR01963       153 YVAAKHGLIGLTKVLA----LE-VAAHGITANAICPGYVRTPLVEKQIADQAKTRGIPEEQVIREVMLKKQPTKRFVTVD  227 (258)
T ss_pred             HHHHHHHHHHHHHHHH----HH-CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             5677430212115555----42-047887586672875675546765899986518899888898607888984113799


Q ss_pred             HHHHHHHHHHCCC----CCCCEECCCC
Q ss_conf             7799999995135----5786162684
Q gi|254780595|r  191 DVARCVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       191 Dva~~i~~l~~~~----~~~iyni~~~  213 (289)
                      +++...++|....    -|..+.+-.|
T Consensus       228 e~A~~a~fLaS~~A~~~TG~~~~~DGG  254 (258)
T TIGR01963       228 EVAETALFLASDAAAGITGQAIVLDGG  254 (258)
T ss_pred             HHHHHHHHHCCHHHHCCCCEEEEECCC
T ss_conf             999999984173442366207886484


No 264
>KOG4039 consensus
Probab=97.66  E-value=0.00011  Score=46.28  Aligned_cols=143  Identities=14%  Similarity=0.044  Sum_probs=79.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             93999888-888999999999889--889999679446345564498289806786402346541156327876124443
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVG--VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
                      |..||+|| |-.|+.|.+++++++  -+|+++.|...-.+ -..+.+.-...|.... ........+.|..+-|.+.+..
T Consensus        19 ~s~fvlGAtG~~G~~llk~~~E~~~FSKV~~i~RR~~~d~-at~k~v~q~~vDf~Kl-~~~a~~~qg~dV~FcaLgTTRg   96 (238)
T KOG4039          19 MSGFVLGATGLCGGGLLKHAQEAPQFSKVYAILRRELPDP-ATDKVVAQVEVDFSKL-SQLATNEQGPDVLFCALGTTRG   96 (238)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCC-CCCCEEEEEEECHHHH-HHHHHHHCCCCEEEEEECCCCC
T ss_conf             2247885355313899999885656206999973157984-2136454678326888-8877650288568996113555


Q ss_pred             ---CCEEE---CCC--CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             ---31000---122--1013443201233433332010257621234532112343113455445555432001234567
Q gi|254780595|r   78 ---GDPCI---ISM--SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIK  149 (289)
Q Consensus        78 ---~~~~~---~~~--~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~  149 (289)
                         .|..+   .++  ...-.+..+.|++|+.+||.+.-         -++    ..-|-+.|-+.|+.+.+..-+   .
T Consensus        97 kaGadgfykvDhDyvl~~A~~AKe~Gck~fvLvSS~GAd---------~sS----rFlY~k~KGEvE~~v~eL~F~---~  160 (238)
T KOG4039          97 KAGADGFYKVDHDYVLQLAQAAKEKGCKTFVLVSSAGAD---------PSS----RFLYMKMKGEVERDVIELDFK---H  160 (238)
T ss_pred             CCCCCCEEEECHHHHHHHHHHHHHCCCEEEEEEECCCCC---------CCC----CEEEEECCCHHHHHHHHCCCC---E
T ss_conf             556675376153888889999885897089997426788---------643----420241034466666641550---7


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             642034777789
Q gi|254780595|r  150 LAVLRLSGIYGP  161 (289)
Q Consensus       150 ~~ilR~~~iyGp  161 (289)
                      ++|+||+.+.|.
T Consensus       161 ~~i~RPG~ll~~  172 (238)
T KOG4039         161 IIILRPGPLLGE  172 (238)
T ss_pred             EEEECCCCEECC
T ss_conf             999437533134


No 265
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]
Probab=97.66  E-value=0.00025  Score=44.21  Aligned_cols=71  Identities=24%  Similarity=0.236  Sum_probs=48.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCC----CCCCHHHHHHHCCCCEEEEEE
Q ss_conf             939998888889999999998898899996794463455644982898067----864023465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFAD----QKINNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~----~~~~~~~~~~~~~~~~v~~~~   72 (289)
                      |||.|+|||=+|+.+.-.|.+.|+.|+.+.|++. ...+...|........    ......-......+|.|+.+.
T Consensus         1 mkI~IlGaGAvG~l~g~~L~~~g~~V~~~~R~~~-~~~l~~~GL~i~~~~~~~~~~~~~~~~~~~~~~~Dlviv~v   75 (307)
T COG1893           1 MKILILGAGAIGSLLGARLAKAGHDVTLLVRSRR-LEALKKKGLRIEDEGGNFTTPVVAATDAEALGPADLVIVTV   75 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECHHH-HHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             9599987878999999999858995799810899-99998789799816885224432356733367888899980


No 266
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=97.66  E-value=0.00022  Score=44.48  Aligned_cols=77  Identities=18%  Similarity=0.132  Sum_probs=57.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCE
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124443310
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDP   80 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   80 (289)
                      |||=++|-|-+|..++..|++.||+|++..|++++...+...+.....     ....+...++..+.|+.+++.....+.
T Consensus         1 MkIGfIGLG~MG~~mA~nL~~~G~~V~v~d~~~~~~~~~~~~g~~~~~-----s~~e~~~~l~~~~vI~~~vp~g~~v~~   75 (298)
T PRK12490          1 MKLGLIGLGKMGGNMAERLREDGHEVVGYDVNQEAVDVAGKLGITARH-----SLEELVSKLEAPRAIWVMVPAGEVTES   75 (298)
T ss_pred             CEEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEECC-----CHHHHHHHCCCCCEEEEECCCCHHHHH
T ss_conf             979998346768999999997799489984998999999986995428-----999999737899889997689455999


Q ss_pred             EE
Q ss_conf             00
Q gi|254780595|r   81 CI   82 (289)
Q Consensus        81 ~~   82 (289)
                      ++
T Consensus        76 vi   77 (298)
T PRK12490         76 VL   77 (298)
T ss_pred             HH
T ss_conf             99


No 267
>PRK06940 short chain dehydrogenase; Provisional
Probab=97.64  E-value=0.00064  Score=41.88  Aligned_cols=202  Identities=15%  Similarity=0.090  Sum_probs=96.5

Q ss_pred             EEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHHHH------HHHCCCCEE
Q ss_conf             39998-88888999999999889889999679446345----564498--289806786402346------541156327
Q gi|254780595|r    2 HLMIF-GAGYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNLLR------EKLYFTTHI   68 (289)
Q Consensus         2 kIlI~-GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~~~------~~~~~~~~v   68 (289)
                      ||+|| |+|=||..+++.|. .|.+|+...|+.++...    +...+.  ..+..|..+. ..+.      +....+|.+
T Consensus         6 kV~v~tGa~GIG~aiA~~la-~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~-~~v~~l~~~~~~~G~idiL   83 (277)
T PRK06940          6 EVVVVIGAGGMGQAIARRVG-SGKTVLLADYNEENLQAVARTLREAGFDVITQQVDVSSR-ESVKALAQTAATLGAVTGL   83 (277)
T ss_pred             CEEEECCCCHHHHHHHHHHH-HCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHCCCCEE
T ss_conf             29999781699999999998-199899998988999999999872288299998257998-9999999999986998799


Q ss_pred             EEEECCCCCCCEEECCC----------CCHHHHHHHCCCCCCCCCCEEECC--------------CCCCCC-----CCCC
Q ss_conf             87612444331000122----------101344320123343333201025--------------762123-----4532
Q gi|254780595|r   69 VQCIKPSSEGDPCIISM----------SKDFYKFMPHVKWIGYLSSTSIYG--------------NREGQW-----VDEH  119 (289)
Q Consensus        69 ~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~i~~SS~~VYg--------------~~~g~~-----i~E~  119 (289)
                      +++++-.......-...          .+.+......-...+++++.+-|-              ...+..     +.-.
T Consensus        84 VnnAG~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  163 (277)
T PRK06940         84 VHTAGVSPSQASPEAILKVDLYGTALVLEEFGKVIAPGGAGVVIASMSGHRLPALTAEQEQALATTPTEELLSLPFLQPD  163 (277)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
T ss_conf             98886786657899999886688999999999999849828998604443111445666545402676526641000233


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCC-CCH--------HHHHHCCCCCCCCCCCCEECCH
Q ss_conf             1123431134554455554320012---345676420347777898-503--------4443113454322211000102
Q gi|254780595|r  120 SFVHPISCVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPK-RNP--------FIKIRQKNSLRLVKKNQVFNRI  187 (289)
Q Consensus       120 ~~~~P~~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~-r~~--------~~~~~~g~~~~~~~~~~~~~~i  187 (289)
                      ....+...|+.+|.....+.+..+.   .+|+++-.+-|+.|.-|. +..        +.++....+.    +    -+-
T Consensus       164 ~~~~~~~aY~~sK~a~~~ltk~lA~e~a~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~P~----g----R~g  235 (277)
T PRK06940        164 SIEDPLHAYQFAKRANVLRVRAAAVKWGARGARINSISPGIISTPMGQDELAGPRGDGYRAMIAKSGT----G----RIG  235 (277)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCEECCHHHHHHCCCCHHHHHHHHHCCCC----C----CCC
T ss_conf             35632399999999999999999999986496577875576727356877536658999999856998----9----987


Q ss_pred             HHHHHHHHHHHHHCCCC----CCCEECCCC
Q ss_conf             47777999999951355----786162684
Q gi|254780595|r  188 RVEDVARCVIFLMTHHL----GGIFNLSDD  213 (289)
Q Consensus       188 hv~Dva~~i~~l~~~~~----~~iyni~~~  213 (289)
                      .-+|+++++.+|+....    |+++.+-.+
T Consensus       236 ~peeia~~v~FL~Sd~as~iTG~~i~VDGG  265 (277)
T PRK06940        236 TPDDIAAAAEFLMGPEGSFITGADLLVDGG  265 (277)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             899999999999584436944843895857


No 268
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=97.63  E-value=0.0019  Score=39.17  Aligned_cols=195  Identities=13%  Similarity=0.049  Sum_probs=99.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH--HHH-HHHCCCEEEECCCCCCCH---HH---HHHHCCCCEEEEE
Q ss_conf             3999888-888999999999889889999679446--345-564498289806786402---34---6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN--LLT-LKHKGISPFLFADQKINN---LL---REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~--~~~-l~~~~~~~~~~~~~~~~~---~~---~~~~~~~~~v~~~   71 (289)
                      ..+|||+ .=||..+++.|.+.|-+|+++.+....  ... ....+...+..|..+.+.   .+   .+....+|+++|+
T Consensus       209 VALVTGAArGIG~AIA~~LAreGA~VVi~Di~~a~~~l~~~a~elgg~al~~DVt~~~a~~~lv~~~~~~~G~lDILVnN  288 (447)
T PRK08261        209 VALVTGAARGIGAAIAEVLARDGAHVVCLDVPQAGDDLAAVAARLGGTALALDITAPDAPAKIAEHLAERHGGLDIVVHN  288 (447)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89991725789999999999869999998271148999999987098089953689999999999999964999899989


Q ss_pred             ECCCCCCC------EEEC-CCCCHH----------HH--HHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             12444331------0001-221013----------44--32012334333320102576212345321123431134554
Q gi|254780595|r   72 IKPSSEGD------PCII-SMSKDF----------YK--FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQR  132 (289)
Q Consensus        72 ~~~~~~~~------~~~~-~~~~~~----------~~--~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k  132 (289)
                      ++-.....      ..+. .+..|+          ..  ....-.++|.+||.+-+...           .....|+.+|
T Consensus       289 AGi~~~~~l~~~~~e~Wd~v~~vNl~g~~~l~qall~~m~~~~gG~IVnIsSiag~~g~-----------~g~~~YaaSK  357 (447)
T PRK08261        289 AGITRDKTLANMDEARWDSVIAVNLLAPLRITEALLDNGALGDGGRIVCVSSISGIAGN-----------RGQTNYAASK  357 (447)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEECCCCC-----------CCCHHHHHHH
T ss_conf             97899977111999999999999869999999999997765479579985020004678-----------8742879999


Q ss_pred             HHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC--CCHHHHHHCCCC-CCCCCCCCEECCHHHHHHHHHHHHHHCCC---
Q ss_conf             4555543200123---45676420347777898--503444311345-43222110001024777799999995135---
Q gi|254780595|r  133 FNAEKEWLAITKK---LNIKLAVLRLSGIYGPK--RNPFIKIRQKNS-LRLVKKNQVFNRIRVEDVARCVIFLMTHH---  203 (289)
Q Consensus       133 ~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~--r~~~~~~~~g~~-~~~~~~~~~~~~ihv~Dva~~i~~l~~~~---  203 (289)
                      .....+.+..+.+   +|+.+-.+-|+.|--+-  ..++..-..+.. ..+...+      .-+|+|+++.++....   
T Consensus       358 aAv~~ltrslA~ela~~GIRVNaVaPG~I~T~mta~~p~~~re~~rr~~sL~r~G------~PeDVA~aVaFLASd~A~~  431 (447)
T PRK08261        358 AGVIGLVQALAPLLAARGITINAVAPGFIETQMTAAIPFAIREAGRRMNSLSQGG------LPVDVAETIAWFASPASGA  431 (447)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHCCCHHHHHHHHHCCCCCCCC------CHHHHHHHHHHHHCHHHCC
T ss_conf             9999999999999604095999997688886301037735699988508667897------9999999999970943279


Q ss_pred             -CCCCEECCCC
Q ss_conf             -5786162684
Q gi|254780595|r  204 -LGGIFNLSDD  213 (289)
Q Consensus       204 -~~~iyni~~~  213 (289)
                       .|++..++.+
T Consensus       432 ITGqvL~VDG~  442 (447)
T PRK08261        432 VTGNVVRVCGQ  442 (447)
T ss_pred             CCCCEEEECCC
T ss_conf             87977898987


No 269
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=97.60  E-value=0.0003  Score=43.79  Aligned_cols=68  Identities=18%  Similarity=0.303  Sum_probs=51.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             39998888889999999998898--899996794463455644982898067864023465411563278761244
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGV--YTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~--~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      ||+|+|.|.||..++..|.++|.  +|+++.|+++........++....      .....+.+..+|.|+.|.++.
T Consensus         8 ~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id~~------~~~~~e~~~~~DlIilatPv~   77 (307)
T PRK07502          8 RVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARARELGLGDRV------TTSAAEAVKGADLVILCVPVG   77 (307)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCHH------CCCHHHHHCCCCEEEEECCHH
T ss_conf             6899927879999999998549985799984999999999986997511------277766404589799917899


No 270
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=97.58  E-value=0.00024  Score=44.32  Aligned_cols=102  Identities=15%  Similarity=-0.001  Sum_probs=59.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------CCCEEE-ECCCCCCCHHHHHHHCCCCEE
Q ss_conf             93999888888999999999889889999679446345564-----------498289-806786402346541156327
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-----------KGISPF-LFADQKINNLLREKLYFTTHI   68 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-----------~~~~~~-~~~~~~~~~~~~~~~~~~~~v   68 (289)
                      |||-|+|||.||+-.+..++..||+|+....+++....+..           ...... ..........+.+.+.++|.|
T Consensus         3 kkVAVIGAGvMGsGwAa~FA~aG~~V~L~Dp~peA~~ki~~~l~~a~~al~~L~~~~l~~~grL~~~~sL~eAV~dADlV   82 (489)
T PRK07531          3 MKAACIGGGVIGGGWAARFLLNGWDVAVFDPHPEAERIIGEVLANARRALPGLTDAPLPPEGRLSFCASLAEAVAGADWI   82 (489)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCHHHHHCCCCEE
T ss_conf             67999871886899999999579969999488789999999999999987753203556467768638899997479999


Q ss_pred             EEEECCCCCCCEEECCCCCHHHHHHHC-C-CCCCCCCCEEECC
Q ss_conf             876124443310001221013443201-2-3343333201025
Q gi|254780595|r   69 VQCIKPSSEGDPCIISMSKDFYKFMPH-V-KWIGYLSSTSIYG  109 (289)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~-~~~i~~SS~~VYg  109 (289)
                      +-+++-.       ......+.+.... + +..|..||||-+.
T Consensus        83 qEaVPE~-------LdIKq~vf~eLd~~~~~~aIiASsTSgl~  118 (489)
T PRK07531         83 QESVPER-------LDLKHKVLAEIEAAARPDALIGSSTSGFK  118 (489)
T ss_pred             EECCCCC-------HHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             9878566-------99999999999976799838985366588


No 271
>KOG1209 consensus
Probab=97.57  E-value=0.00022  Score=44.58  Aligned_cols=72  Identities=17%  Similarity=0.233  Sum_probs=52.7

Q ss_pred             EEEEECC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HCCCEEEECCCCCCCHHHH------HHH-CCCCEEEEE
Q ss_conf             3999888--88899999999988988999967944634556-4498289806786402346------541-156327876
Q gi|254780595|r    2 HLMIFGA--GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK-HKGISPFLFADQKINNLLR------EKL-YFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga--G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~-~~~~~~~~~~~~~~~~~~~------~~~-~~~~~v~~~   71 (289)
                      +||||||  |=||.+|++++.+.|+.|.+++|..+....|. +.+..++..|..+++....      ... ...|.+++.
T Consensus         9 ~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~Gkld~L~NN   88 (289)
T KOG1209           9 KVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPDGKLDLLYNN   88 (289)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             59996057765349999999867819999702246076678860970587056872778998888861899826888717


Q ss_pred             EC
Q ss_conf             12
Q gi|254780595|r   72 IK   73 (289)
Q Consensus        72 ~~   73 (289)
                      ++
T Consensus        89 AG   90 (289)
T KOG1209          89 AG   90 (289)
T ss_pred             CC
T ss_conf             99


No 272
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=97.51  E-value=0.0018  Score=39.33  Aligned_cols=193  Identities=12%  Similarity=0.071  Sum_probs=97.8

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHH-H----HHHHHHCCCEE--EECCCCCCCHHHH------HHHCCCCE
Q ss_conf             3999888-88899999999988988999967944-6----34556449828--9806786402346------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVS-N----LLTLKHKGISP--FLFADQKINNLLR------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~-~----~~~l~~~~~~~--~~~~~~~~~~~~~------~~~~~~~~   67 (289)
                      .++|||+ +=||..++..|.+.|.+|....++.. .    ...+...+...  +..|. .+.....      .....+|.
T Consensus        11 valVTGas~GIGraiA~~lA~~GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~~~~~~Dv-sd~~~v~~lv~~~~~~G~iDi   89 (303)
T PRK07792         11 VAVVTGAAAGLGRAEALGLARLGATVVVNDIASALDASDVLDEIRAAGAKAVAVAGDI-SQRATADELVATADGLGGLDI   89 (303)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCC-CCHHHHHHHHHHHHHHCCCCE
T ss_conf             8999288668999999999986999999718972479999999984499389996676-899999999999998399969


Q ss_pred             EEEEECCCCCC----------CEEECCCCC-------HHHHH-HHCC--------CCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             78761244433----------100012210-------13443-2012--------3343333201025762123453211
Q gi|254780595|r   68 IVQCIKPSSEG----------DPCIISMSK-------DFYKF-MPHV--------KWIGYLSSTSIYGNREGQWVDEHSF  121 (289)
Q Consensus        68 v~~~~~~~~~~----------~~~~~~~~~-------~~~~~-~~~~--------~~~i~~SS~~VYg~~~g~~i~E~~~  121 (289)
                      ++++++-....          +..+.....       ..... +...        .++|.+||.+-..   +        
T Consensus        90 LVNNAGi~~~~~~~~~t~e~wd~v~~vNL~g~f~~~r~a~~~m~~~~~~~~g~~~G~IInisS~ag~~---g--------  158 (303)
T PRK07792         90 VVNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRAKAKEAGGPVYGRIVNTSSEAGLV---G--------  158 (303)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHCC---C--------
T ss_conf             99888556787610099999999998873899999999999999974516998634999974476566---8--------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHH-HHCCCCCCCCCCCCEECCHHHHHHHHHHH
Q ss_conf             23431134554455554320012---345676420347777898503444-31134543222110001024777799999
Q gi|254780595|r  122 VHPISCVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIK-IRQKNSLRLVKKNQVFNRIRVEDVARCVI  197 (289)
Q Consensus       122 ~~P~~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~-~~~g~~~~~~~~~~~~~~ihv~Dva~~i~  197 (289)
                      ......|+.+|.....+.+..+.   .+|+.+-.+-|+.     +..+.. +....+. .  ....+....-+|+|.++.
T Consensus       159 ~~g~~~Y~AsKagv~~lTrslA~Ela~~gIRVNaIaP~a-----~t~~~~~~~~~~~~-~--~~~~~~p~~PeeVA~~v~  230 (303)
T PRK07792        159 PVGQANYGAAKAGITALTLSAARALGRYGVRANAICPRA-----RTAMTADVFGDAPD-V--AAGGIDPLSPEHVVTLVQ  230 (303)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC-----CCHHHHHHHHHCHH-H--HHHCCCCCCHHHHHHHHH
T ss_conf             998588999999999999999999855196999989999-----87022444201777-7--975779999999999999


Q ss_pred             HHHCCC----CCCCEECCCCC
Q ss_conf             995135----57861626843
Q gi|254780595|r  198 FLMTHH----LGGIFNLSDDE  214 (289)
Q Consensus       198 ~l~~~~----~~~iyni~~~~  214 (289)
                      +|....    .|+++.+-.+.
T Consensus       231 fLaSd~as~ITGq~l~VdGG~  251 (303)
T PRK07792        231 FLASPAAAGVNGQLFIVYGPQ  251 (303)
T ss_pred             HHCCCCCCCCCCCEEEECCCE
T ss_conf             973910069879879986999


No 273
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=97.51  E-value=0.00026  Score=44.16  Aligned_cols=76  Identities=17%  Similarity=0.224  Sum_probs=62.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9399988888899999999988988999967944634556449828980678640234654115632787612444
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
                      ++|+|.|.|-+|+.+++.|.++|..++++..|++.....+..|...+.+|....+-......+.+..++.++++..
T Consensus       400 ~~VII~G~GRvGq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v~yGDat~~~vL~~AGi~~Ar~vViaidd~~  475 (615)
T PRK03562        400 PRVIIAGFGRFGQIVGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQ  475 (615)
T ss_pred             CCEEEEECCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHCCCCCCCEEEEEECCHH
T ss_conf             9989990280469999999978998799979999999999679908976899999998679140688999949899


No 274
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=97.51  E-value=0.00025  Score=44.23  Aligned_cols=109  Identities=15%  Similarity=0.140  Sum_probs=68.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCC-CCHHH----------HHHHCCCCEEE
Q ss_conf             93999888888999999999889889999679446345564498289806786-40234----------65411563278
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQK-INNLL----------REKLYFTTHIV   69 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~-~~~~~----------~~~~~~~~~v~   69 (289)
                      |+|-|+|-||||-.++-.+.++|++|+|+.-++.+...++.-......-++.. .....          ...+..+|..+
T Consensus        10 ~~I~ViGLGYVGLPlA~~fA~~G~~ViG~DIn~~~Vd~ln~G~~~i~e~~~~~~v~~~v~~g~lraTtd~~~l~~~dv~i   89 (436)
T COG0677          10 ATIGVIGLGYVGLPLAAAFASAGFKVIGVDINQKKVDKLNRGESYIEEPDLDEVVKEAVESGKLRATTDPEELKECDVFI   89 (436)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCEEECCCHHHHHHHHHHCCCCEEECCHHHCCCCCEEE
T ss_conf             28999824644578899998769955757578899888757864254686889999998639715756855625488899


Q ss_pred             EEECCCCCC--CEE---ECCCCCHHHHHHHCCCCCCCCCCEEECCCC
Q ss_conf             761244433--100---012210134432012334333320102576
Q gi|254780595|r   70 QCIKPSSEG--DPC---IISMSKDFYKFMPHVKWIGYLSSTSIYGNR  111 (289)
Q Consensus        70 ~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~~~i~~SS~~VYg~~  111 (289)
                      .|++-+...  ++.   +.+..+.++..+++-.-+|+-||+  |+.+
T Consensus        90 I~VPTPl~~~~~pDls~v~~aa~sIa~~L~kG~LVIlEST~--~PGT  134 (436)
T COG0677          90 ICVPTPLKKYREPDLSYVESAARSIAPVLKKGDLVILESTT--PPGT  134 (436)
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC--CCCC
T ss_conf             99357767899988489999999999756778889996478--9985


No 275
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.49  E-value=0.0026  Score=38.46  Aligned_cols=193  Identities=14%  Similarity=0.083  Sum_probs=96.8

Q ss_pred             EEEEEC--C-CHHHHHHHHHHHHCCCEEEEEEC---CHHHHHHHHHC-CCE-EEECCCCCCCHH---HH---HHHCCCCE
Q ss_conf             399988--8-88899999999988988999967---94463455644-982-898067864023---46---54115632
Q gi|254780595|r    2 HLMIFG--A-GYTGKFIADAALKVGVYTCGTTR---SVSNLLTLKHK-GIS-PFLFADQKINNL---LR---EKLYFTTH   67 (289)
Q Consensus         2 kIlI~G--a-G~iG~~l~~~L~~~g~~V~~~~r---~~~~~~~l~~~-~~~-~~~~~~~~~~~~---~~---~~~~~~~~   67 (289)
                      ++||||  + +=||..+++.|.++|.+|....+   ..+....+... +.. .+..|..+.++.   +.   +....+|.
T Consensus         8 ~~lVTGa~~~~GIG~aia~~la~~Ga~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iD~   87 (261)
T PRK08690          8 KILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELVFRCDVASDDEINQVFADLGKHWDGLDG   87 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998987863899999999998599999973761559999999987398089988999999999999999999689878


Q ss_pred             EEEEECCC--CC-C-C---EEEC-CCCC----H---HHHHHH--------CCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             78761244--43-3-1---0001-2210----1---344320--------123343333201025762123453211234
Q gi|254780595|r   68 IVQCIKPS--SE-G-D---PCII-SMSK----D---FYKFMP--------HVKWIGYLSSTSIYGNREGQWVDEHSFVHP  124 (289)
Q Consensus        68 v~~~~~~~--~~-~-~---~~~~-~~~~----~---~~~~~~--------~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P  124 (289)
                      ++++++-.  .. . +   .... .+..    +   +....+        +...+|.+||.+.+..           .-.
T Consensus        88 LVnnaG~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~Ii~iss~~~~~~-----------~~~  156 (261)
T PRK08690         88 LVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRA-----------IPN  156 (261)
T ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEECC-----------CCC
T ss_conf             975255476333454247561599999999987677899999876876057841465433320015-----------663


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCC---CHHHH----HHCCCCCCCCCCCCEECCHHHHHHHH
Q ss_conf             311345544555543200123---456764203477778985---03444----31134543222110001024777799
Q gi|254780595|r  125 ISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKR---NPFIK----IRQKNSLRLVKKNQVFNRIRVEDVAR  194 (289)
Q Consensus       125 ~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r---~~~~~----~~~g~~~~~~~~~~~~~~ihv~Dva~  194 (289)
                      ...|+.+|...+.+.+..+.+   +|+++-.+.|+.|.-+..   .....    +....+.        --+...+|+++
T Consensus       157 ~~~y~~sKaal~~ltr~lA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl--------~R~g~peeia~  228 (261)
T PRK08690        157 YNVMGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPL--------RRNVTIEEVGN  228 (261)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCC--------CCCCCHHHHHH
T ss_conf             1045788999999999999972589689989877788554442478769999999867998--------99949999999


Q ss_pred             HHHHHHCCC----CCCCEECCCC
Q ss_conf             999995135----5786162684
Q gi|254780595|r  195 CVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       195 ~i~~l~~~~----~~~iyni~~~  213 (289)
                      ++.+|+...    -|+++.+-.+
T Consensus       229 ~v~FL~Sd~ss~iTG~~i~VDGG  251 (261)
T PRK08690        229 TAAFLLSDLSSGITGEITYVDGG  251 (261)
T ss_pred             HHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999385524705863997969


No 276
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=97.47  E-value=0.00083  Score=41.25  Aligned_cols=66  Identities=20%  Similarity=0.310  Sum_probs=52.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             39998888889999999998898-899996794463455644-9828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGV-YTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~-~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      ||||+|+|-+|+.+++.|.++|. +|+.++|+.++...+... +.....+      ..+...+..+|.|+.|.+
T Consensus       184 ~vlviGaGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~~~~~~~------~~l~~~l~~~DvvisaT~  251 (429)
T PRK00045        184 KVLVIGAGEMGELVAKHLAEKGVRKITVANRTLERAEELAEEFGAEAIPL------EELPEALAEADIVISSTA  251 (429)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCEEECH------HHHHHHHHHCCEEEEECC
T ss_conf             59997674899999999985599849997586778999999759889749------999999965899999448


No 277
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]
Probab=97.45  E-value=0.00045  Score=42.73  Aligned_cols=69  Identities=16%  Similarity=0.163  Sum_probs=46.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             9399988888899999999988988999967-94463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTR-SVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r-~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |++.|.|+|-||+.|+.+|.+.||+|+.-+| .++....... ...+.     -............|.|+-+++..
T Consensus         2 ~~~~i~GtGniG~alA~~~a~ag~eV~igs~r~~~~~~a~a~-~l~~~-----i~~~~~~dA~~~aDVVvLAVP~~   71 (211)
T COG2085           2 MIIAIIGTGNIGSALALRLAKAGHEVIIGSSRGPKALAAAAA-ALGPL-----ITGGSNEDAAALADVVVLAVPFE   71 (211)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHH-HHCCC-----CCCCCHHHHHHCCCEEEEECCHH
T ss_conf             179996257187899999996797399964788067889998-64565-----33477688884399899954578


No 278
>PRK00711 D-amino acid dehydrogenase small subunit; Validated
Probab=97.44  E-value=0.00022  Score=44.55  Aligned_cols=32  Identities=22%  Similarity=0.265  Sum_probs=30.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             93999888888999999999889889999679
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRS   32 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~   32 (289)
                      |||+|+|+|.+|...+-+|.++|++|+.+.|.
T Consensus         1 m~VvIIGaGi~G~stA~~La~~G~~V~vler~   32 (416)
T PRK00711          1 MRVVVLGSGVVGVTSAWYLARAGHEVTVIDRQ   32 (416)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             97999994499999999999689968999699


No 279
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=97.44  E-value=0.00045  Score=42.76  Aligned_cols=71  Identities=14%  Similarity=0.126  Sum_probs=50.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH-HH--HCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888-888999999999889889999679446345-56--449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT-LK--HKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~-l~--~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      .|-|||| |-+|++|+++|..+|.+|+++++++++... ..  ...++.+.| ....+..+...++.+|.++...+
T Consensus       182 TV~VTGASG~LG~aL~k~l~~~GAKVIalTs~~~~i~~~~~~~~~~~~~i~W-~~G~E~~L~~~L~kiDILILNHG  256 (410)
T PRK07424        182 TVAVTGASGTLGQALLKELHQQGAKVIALTSNSDKIPLEINGEDLPVKTIHW-QVGQEAALAELLEKVDILVINHG  256 (410)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCEEEEE-ECCCHHHHHHHHHHCCEEEECCC
T ss_conf             7999547737789999999977998999935898655344665467127864-32888898888864689988488


No 280
>PRK08303 short chain dehydrogenase; Provisional
Probab=97.44  E-value=0.0051  Score=36.74  Aligned_cols=183  Identities=13%  Similarity=0.028  Sum_probs=90.0

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHH----------H----HHHHHCCCE--EEECCCCCCCHHHH-----
Q ss_conf             3999888-888999999999889889999679446----------3----455644982--89806786402346-----
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSN----------L----LTLKHKGIS--PFLFADQKINNLLR-----   59 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~----------~----~~l~~~~~~--~~~~~~~~~~~~~~-----   59 (289)
                      ..||||+ .=||..++.+|.+.|.+|+.+.|+...          +    ..+...+-.  .+..|..+ ...+.     
T Consensus        10 vAlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd-~~~v~~~v~~   88 (305)
T PRK08303         10 VALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLV-PEQVRALVER   88 (305)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCC-HHHHHHHHHH
T ss_conf             899908875899999999998799899982761100000120679999999999759908999756899-9999999999


Q ss_pred             --HHHCCCCEEEEEECCC---CCC-CE----EECC----CCCHHH-------HH---H--HCCCCCCCCCCE-EECCCCC
Q ss_conf             --5411563278761244---433-10----0012----210134-------43---2--012334333320-1025762
Q gi|254780595|r   60 --EKLYFTTHIVQCIKPS---SEG-DP----CIIS----MSKDFY-------KF---M--PHVKWIGYLSST-SIYGNRE  112 (289)
Q Consensus        60 --~~~~~~~~v~~~~~~~---~~~-~~----~~~~----~~~~~~-------~~---~--~~~~~~i~~SS~-~VYg~~~  112 (289)
                        .....+|.+++.+...   ... .+    ....    +..++.       ..   +  ..-.++|.+||. +.++.. 
T Consensus        89 ~~~~~G~lDILVNNa~~~~~~~~~~~~~~~~~~e~~~~~~~vn~~~~~~~~~~a~p~m~~~~~G~IVnisS~~~~~~~~-  167 (305)
T PRK08303         89 IDREQGRLDILVNDIWGGEKLFEWGKPVWEHSLDKGLRMLRLAVDTHLITSHHALPLLIRRPGGLVVEVTDGTAEYNAT-  167 (305)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-
T ss_conf             9995296208985586665434468027661799999999999899999999999999877995899988555522778-


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC--------CCHHHHHHCCCCCCCCCCC
Q ss_conf             123453211234311345544555543200123---45676420347777898--------5034443113454322211
Q gi|254780595|r  113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK--------RNPFIKIRQKNSLRLVKKN  181 (289)
Q Consensus       113 g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~--------r~~~~~~~~g~~~~~~~~~  181 (289)
                              .......|+.+|...+.+.+..+.+   +|+.+..+-|+.|-=|-        ...........++      
T Consensus       168 --------~~~~~~~Y~asKaAv~~ltr~lA~Ela~~GIrVNaV~PG~i~T~~~~~~~~~~ee~~~~~~~~~~~------  233 (305)
T PRK08303        168 --------HYRLSVFYDLAKTAVLRLAFSLAHELAPHGATAVALTPGWLRSEMMLDHFGVTEENWRDATAKEPH------  233 (305)
T ss_pred             --------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCC------
T ss_conf             --------877519899999999999999999973419199999638877554353325887899998703886------


Q ss_pred             CEECCHH-HHHHHHHHHHHHCC
Q ss_conf             0001024-77779999999513
Q gi|254780595|r  182 QVFNRIR-VEDVARCVIFLMTH  202 (289)
Q Consensus       182 ~~~~~ih-v~Dva~~i~~l~~~  202 (289)
                        ..+.- =+|+++++.+|...
T Consensus       234 --~~r~~tPeeva~aVafLaSD  253 (305)
T PRK08303        234 --FAISETPRYVGRAVAALAAD  253 (305)
T ss_pred             --CCCCCCHHHHHHHHHHHHCC
T ss_conf             --55666989999999999579


No 281
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=97.43  E-value=0.00043  Score=42.84  Aligned_cols=75  Identities=15%  Similarity=0.155  Sum_probs=60.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             399988888899999999988988999967944634556449828980678640234654115632787612444
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
                      +|+|.|.|-+|+.+++.|.++|..++++..|++....++..|...+.+|..+.+-......+.+..++.++++..
T Consensus       402 ~VII~G~GR~Gq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v~yGDat~~~vL~~AGi~~A~~vViai~d~~  476 (602)
T PRK03659        402 QVIIVGFGRFGQVIGRLLMANKMRITVLERDISAVNLMRKYGYKVYYGDATQLELLRAAGAEKAEAIVITCNEPE  476 (602)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHCCCCCCCEEEEEECCHH
T ss_conf             989978875689999999978999899978679999999789908975899999998679040588999829899


No 282
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=97.43  E-value=0.00093  Score=40.96  Aligned_cols=67  Identities=16%  Similarity=0.234  Sum_probs=49.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHCC----CEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             939998888889999999998898-8999967944634556449----828980678640234654115632787612
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGV-YTCGTTRSVSNLLTLKHKG----ISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~-~V~~~~r~~~~~~~l~~~~----~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      .|+||+|+|-+|+.+++.|.+.|. +|+.++|+.++...+...-    +....+      ..+...+..+|.|+.+.+
T Consensus        13 ~~vlVIGaG~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~~~~~~~~------~~l~~~l~~~DivI~aT~   84 (134)
T pfam01488        13 KKVLLIGAGEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGEEVEALPL------DELEELLAEADIVISATS   84 (134)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEC------HHHHHHHHHCCEEEEECC
T ss_conf             989999960999999999997599889995475789999999849972589851------354413631999999259


No 283
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=97.41  E-value=0.001  Score=40.66  Aligned_cols=37  Identities=24%  Similarity=0.299  Sum_probs=17.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
Q ss_conf             39998888889999999998898899996794463455
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTL   39 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l   39 (289)
                      ||+|.|+|-+|..+++.| ++|++|+.+-+++++...+
T Consensus       234 ~v~I~Ggg~ig~~la~~L-~~~~~v~iIe~d~~~~~~l  270 (455)
T PRK09496        234 RIMIAGGGNIGLYLAKLL-EKGYSVKLIERDPERAEEL  270 (455)
T ss_pred             EEEEECCCHHHHHHHHHH-HCCCEEEEECCCHHHHHHH
T ss_conf             189987869999999987-4088389970898999999


No 284
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=97.36  E-value=0.0013  Score=40.09  Aligned_cols=32  Identities=19%  Similarity=0.283  Sum_probs=27.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHH-CCCEEEEE-ECC
Q ss_conf             93999888-8889999999998-89889999-679
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALK-VGVYTCGT-TRS   32 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~-~g~~V~~~-~r~   32 (289)
                      |||.|.|| |-+|+.+++.+.+ .++++.+. .|.
T Consensus         3 ikI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~i~~~   37 (265)
T PRK00048          3 IKVGVAGASGRMGRELIEAVEAAEDLELVAALDRP   37 (265)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             59999888887799999999868997999999468


No 285
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=97.36  E-value=0.00053  Score=42.34  Aligned_cols=48  Identities=13%  Similarity=0.102  Sum_probs=26.6

Q ss_pred             CCCCCC--CCCCCCCCCC--CHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHC
Q ss_conf             676420--3477778985--03444311345432221100010247777999999951
Q gi|254780595|r  148 IKLAVL--RLSGIYGPKR--NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT  201 (289)
Q Consensus       148 ~~~~il--R~~~iyGp~r--~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~  201 (289)
                      .|.||.  | ..|.|-||  +.+.|..++....+.-+..     ...|+||......+
T Consensus       146 td~TIHgS~-v~VlGfGRtG~tiAr~f~aLGA~V~V~AR-----~~~dlARI~E~g~~  197 (288)
T TIGR02853       146 TDFTIHGSN-VMVLGFGRTGMTIARTFSALGARVSVGAR-----SSADLARITEMGLE  197 (288)
T ss_pred             CCCCEECCE-EEEECCCCHHHHHHHHHHHCCCEEEEECC-----CHHHHHHHHHHCCC
T ss_conf             896250134-57884470568999999726980575317-----83678999996068


No 286
>PRK10669 putative cation:proton antiport protein; Provisional
Probab=97.35  E-value=0.0013  Score=40.09  Aligned_cols=27  Identities=19%  Similarity=0.130  Sum_probs=11.1

Q ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             999973984489999999999999751
Q gi|254780595|r  261 AKIKSLGFQLLYPNYRISLKQLWKEIE  287 (289)
Q Consensus       261 ~kl~~lG~~p~~p~~~~gl~~~~~~~~  287 (289)
                      .++++.|=.--.+.-.|.=++|.+-++
T Consensus       522 ~~L~~aGA~~VV~~~~e~a~~m~e~l~  548 (558)
T PRK10669        522 AYITERGANQVVMGEREIARTMLELLE  548 (558)
T ss_pred             HHHHHCCCCEEECCHHHHHHHHHHHHC
T ss_conf             999977999898937899999999857


No 287
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=97.34  E-value=0.0014  Score=40.00  Aligned_cols=67  Identities=18%  Similarity=0.172  Sum_probs=50.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC---CEEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             93999888888999999999889---8899996794463455644-982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG---VYTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g---~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||.++|||-+|+.+++-|++.+   ++++++.|++++...+... ++...        ....+....+|.|+.++.|.
T Consensus         3 ~kI~~IG~G~Mg~Aii~gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~v~~~--------~~~~~~~~~~diIiLaVKP~   73 (267)
T PRK11880          3 KKIGFIGGGNMASAIIGGLLASGVPAKDIIVSDPSPEKRAALAEEYGVRAA--------TDNQEAAQEADVVVLAVKPQ   73 (267)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCEEE--------CCHHHHHHCCCEEEEEECHH
T ss_conf             879998668999999999997798945289977999999999997396785--------78698872199999972878


No 288
>PRK07680 late competence protein ComER; Validated
Probab=97.31  E-value=0.0018  Score=39.26  Aligned_cols=67  Identities=24%  Similarity=0.355  Sum_probs=50.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC----CEEEEEECCHHHHHHHHHC--CCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             93999888888999999999889----8899996794463455644--98289806786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG----VYTCGTTRSVSNLLTLKHK--GISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g----~~V~~~~r~~~~~~~l~~~--~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||.++|||-+|+.+++-|++.|    .+++...|++++...+...  ++...        ....+....+|.|+.++-|
T Consensus         1 MkI~fIG~GnMg~Aii~gl~~~~~~~~~~i~i~~r~~~~~~~l~~~~~~i~~~--------~~~~~~~~~~dvIiLaVKP   72 (273)
T PRK07680          1 MNIGFIGTGNMGTILIEAFLESRAVKPSCLTITNRTPAKAYHIKEKYPSIHVA--------KTIEEVIEQSELIFICVKP   72 (273)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEE--------CCHHHHHHCCCEEEEECCH
T ss_conf             98999876999999999999779989456999889989999999876990886--------8889998409989996488


Q ss_pred             C
Q ss_conf             4
Q gi|254780595|r   75 S   75 (289)
Q Consensus        75 ~   75 (289)
                      .
T Consensus        73 q   73 (273)
T PRK07680         73 L   73 (273)
T ss_pred             H
T ss_conf             8


No 289
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=97.30  E-value=0.0017  Score=39.40  Aligned_cols=70  Identities=16%  Similarity=0.164  Sum_probs=45.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECC-CCCCCH----HHHHHHCCCCEEEEEE
Q ss_conf             93999888888999999999889889999679446345564498289806-786402----3465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA-DQKINN----LLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~-~~~~~~----~~~~~~~~~~~v~~~~   72 (289)
                      |||.|+|||=||+.+.-.|.+.|++|+.+.|+.  ...+...|....-.+ +.....    .-......+|.|+.|.
T Consensus         6 ~kI~IiGaGAiG~~~a~~L~~aG~~V~li~r~~--~~ai~~~Gl~i~~~~g~~~~~~~~~~~~~~~~~~~D~viv~v   80 (313)
T PRK06249          6 PRIAIIGTGAIGGFYGAMLARAGFDVHFLLRSD--YEAVRENGLQVDSVHGDFHLPQVQAYRSAEDMPPCDWVLVGL   80 (313)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCH--HHHHHHCCEEEEECCCCEEECCCEEECCHHHCCCCCEEEEEC
T ss_conf             889999914999999999996699569996755--999986885999669828976840236977839965899953


No 290
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=97.26  E-value=0.002  Score=39.01  Aligned_cols=78  Identities=13%  Similarity=0.000  Sum_probs=60.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             939998888889999999998898899996794463455644982898067864023465411563278761244433
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG   78 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~   78 (289)
                      -+++|+|+|..|..-++.+...|.+|+++.+++.+...+..................+.+.+..+|.|+-++-.....
T Consensus        21 a~vvViG~Gv~G~~A~~~A~~lGa~V~v~D~~~~~l~~~~~~~~~~v~~~~~~~~~~l~~~i~~aDvvIgavl~pg~~   98 (150)
T pfam01262        21 AKVVVIGGGVVGLGAAATAKGLGAPVTILDVRPERLEQLDSLFAEFVETDIFSNCEYLAEAIAEADLVIGTVLIPGAR   98 (150)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHCCEEEEEEECCCCC
T ss_conf             779998987899999999986799899972999999999986476200166537999999974387999720317886


No 291
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=97.26  E-value=0.0013  Score=40.04  Aligned_cols=71  Identities=17%  Similarity=0.192  Sum_probs=52.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHCCC--EEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888888999999999889-889999679446345564498--28980678640234654115632787612
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVG-VYTCGTTRSVSNLLTLKHKGI--SPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~l~~~~~--~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      |+||+|||-.|.-++++|.++| .+|+.++|+-.+...|-..=-  ..+.++.... ..+...+..+|.|+.+-+
T Consensus       187 ~~LliGAGeMg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P~~~~f~~La~-~~L~~~L~~~DivissTg  260 (436)
T TIGR01035       187 KVLLIGAGEMGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGPEAVKFEALAL-EKLEEALAEADIVISSTG  260 (436)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCHHHH-HHHHHHHHHCCEEEEECC
T ss_conf             18998274579999999964895289885567789999998707866454445548-999999742889998557


No 292
>KOG1210 consensus
Probab=97.25  E-value=0.0063  Score=36.21  Aligned_cols=187  Identities=17%  Similarity=0.153  Sum_probs=93.4

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-----CCEEEEC--CCCCCCHHHH---HHH----CCCC
Q ss_conf             399988-88889999999998898899996794463455644-----9828980--6786402346---541----1563
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-----GISPFLF--ADQKINNLLR---EKL----YFTT   66 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-----~~~~~~~--~~~~~~~~~~---~~~----~~~~   66 (289)
                      +|+||| +-=||..++.++..+|+.|+.+.|+.++.......     .+..+.+  .|..+.....   +.+    ...|
T Consensus        35 hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~~~d  114 (331)
T KOG1210          35 HILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEGPID  114 (331)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             69981684156689999999703742999464878999874311444353036753553028999988763233048950


Q ss_pred             EEEEEECC---CCCCCEEE--------CCC------CCHHHHHHHCCC---CCCCCCCE-EECCCCCCCCCCCCCCCCCC
Q ss_conf             27876124---44331000--------122------101344320123---34333320-10257621234532112343
Q gi|254780595|r   67 HIVQCIKP---SSEGDPCI--------ISM------SKDFYKFMPHVK---WIGYLSST-SIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        67 ~v~~~~~~---~~~~~~~~--------~~~------~~~~~~~~~~~~---~~i~~SS~-~VYg~~~g~~i~E~~~~~P~  125 (289)
                      ++++|++-   ....+...        .++      .+..+...+...   +++.+||. +.||-            ...
T Consensus       115 ~l~~cAG~~v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~mk~~~~~g~I~~vsS~~a~~~i------------~Gy  182 (331)
T KOG1210         115 NLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARAMKKREHLGRIILVSSQLAMLGI------------YGY  182 (331)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHCCC------------CCC
T ss_conf             27870676554200139999999988755344679999999986322568479984332541675------------664


Q ss_pred             CHHHHHHHHHHH---HHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             113455445555---43200123456764203477778985034443113454322211000102477779999999513
Q gi|254780595|r  126 SCVATQRFNAEK---EWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       126 ~~y~~~k~~~E~---~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
                      +.|+-+|.+.-.   .++.....+++.++..-|+.+--||...-.+.+-.....+.+++   +-+--+++|.+++.-+.+
T Consensus       183 saYs~sK~alrgLa~~l~qE~i~~~v~Vt~~~P~~~~tpGfE~En~tkP~~t~ii~g~s---s~~~~e~~a~~~~~~~~r  259 (331)
T KOG1210         183 SAYSPSKFALRGLAEALRQELIKYGVHVTLYYPPDTLTPGFERENKTKPEETKIIEGGS---SVIKCEEMAKAIVKGMKR  259 (331)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCHHEEEECCCC---CCCCHHHHHHHHHHHHHH
T ss_conf             13560789999999999998765266999972898789764310236742103100788---876889999999867760


Q ss_pred             C
Q ss_conf             5
Q gi|254780595|r  203 H  203 (289)
Q Consensus       203 ~  203 (289)
                      .
T Consensus       260 g  260 (331)
T KOG1210         260 G  260 (331)
T ss_pred             C
T ss_conf             6


No 293
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=97.23  E-value=0.0012  Score=40.32  Aligned_cols=99  Identities=17%  Similarity=0.133  Sum_probs=59.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCE
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124443310
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDP   80 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   80 (289)
                      ++|.|+|.|-||+.+++.+..-|.+|.+.+|++....  ...++.         ...+.+.+..+|+|+.+++-+.++..
T Consensus        37 k~vgIiG~G~IG~~va~~l~~fg~~V~~~d~~~~~~~--~~~~~~---------~~~l~~ll~~sDii~~~~plt~~T~~  105 (176)
T pfam02826        37 KTVGIIGLGRIGRAVARRLKAFGMKVIAYDRYPKAEA--EALGAR---------YVSLDELLAESDVVSLHLPLTPETRH  105 (176)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCCCHH--HHCCEE---------ECCHHHHHHHCCEEEECCCCCCCCCC
T ss_conf             9999989699999999999983981254379876102--315716---------66899998629988754767420246


Q ss_pred             EECCCCCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             00122101344320123343333201025762123453211
Q gi|254780595|r   81 CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF  121 (289)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~  121 (289)
                         -..+...+.+++-.-+|-+|        .|..+||++-
T Consensus       106 ---li~~~~l~~mk~~a~lIN~s--------RG~ivde~aL  135 (176)
T pfam02826       106 ---LINAERLALMKPGAILINTA--------RGGLVDEDAL  135 (176)
T ss_pred             ---CCCHHHHHHHCCCCEEEEEC--------CCCCCCHHHH
T ss_conf             ---34699998518998899806--------7551289999


No 294
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=97.20  E-value=0.00083  Score=41.25  Aligned_cols=73  Identities=21%  Similarity=0.108  Sum_probs=42.9

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCC--EEEEEECCHHHHH----HHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             939998888-889999999998898--8999967944634----556449828980678640234654115632787612
Q gi|254780595|r    1 MHLMIFGAG-YTGKFIADAALKVGV--YTCGTTRSVSNLL----TLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~GaG-~iG~~l~~~L~~~g~--~V~~~~r~~~~~~----~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      |||.|+||| .+|++++-.|..++.  ++.-+.+++++..    .+.+.  ..+..............+.++|.|+.+++
T Consensus         1 mKV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~~~a~g~alDl~~~--~~~~~~~~~~~~~~~~~~~daDiVVitaG   78 (142)
T pfam00056         1 VKVAVVGAGGGVGSSLAFALALQGLADELVLVDINKDKAEGVAMDLSHG--STFLSVPGIVGGDDYEALKDADVVVITAG   78 (142)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCC--CCCCCCCEEECCCCHHHHCCCCEEEEECC
T ss_conf             9899989877899999999974796634788505776411799998614--43478876974883888378999998157


Q ss_pred             CC
Q ss_conf             44
Q gi|254780595|r   74 PS   75 (289)
Q Consensus        74 ~~   75 (289)
                      ..
T Consensus        79 ~~   80 (142)
T pfam00056        79 VP   80 (142)
T ss_pred             CC
T ss_conf             77


No 295
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=97.19  E-value=0.00045  Score=42.74  Aligned_cols=36  Identities=28%  Similarity=0.280  Sum_probs=32.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
Q ss_conf             399988888899999999988988999967944634
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLL   37 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~   37 (289)
                      ||-|+|||.+|+-++..+...|++|+...++++...
T Consensus         4 kV~ViGaG~MG~~IA~~~a~~G~~V~l~D~~~e~l~   39 (289)
T PRK09260          4 KIVVVGAGVMGRGIAYVFASSGFQTTLVDISQEQLA   39 (289)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             699979688789999999968998899979989999


No 296
>KOG0725 consensus
Probab=97.19  E-value=0.0046  Score=36.99  Aligned_cols=191  Identities=15%  Similarity=0.050  Sum_probs=99.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC---------CCEEEECCCCCCCH---H----HHHHHC
Q ss_conf             93999888-8889999999998898899996794463455644---------98289806786402---3----465411
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK---------GISPFLFADQKINN---L----LREKLY   63 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~---------~~~~~~~~~~~~~~---~----~~~~~~   63 (289)
                      +..+|||+ -=||..++.+|.+.|.+|+...|+.+........         .+..+..|..+...   .    ..+...
T Consensus         9 kvalVTG~s~GIG~aia~~la~~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~~~~~~~G   88 (270)
T KOG0725           9 KVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEFAVEKFFG   88 (270)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             78999799981589999999987998999845456667789998743677761489975557678899999999998478


Q ss_pred             CCCEEEEEECCCCCCC-----------EEECCCCC-HHH----HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             5632787612444331-----------00012210-134----4320-----1233433332010257621234532112
Q gi|254780595|r   64 FTTHIVQCIKPSSEGD-----------PCIISMSK-DFY----KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFV  122 (289)
Q Consensus        64 ~~~~v~~~~~~~~~~~-----------~~~~~~~~-~~~----~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~  122 (289)
                      ..|.+++.++......           .......+ ...    ++..     +...++++||.+-+..         .+.
T Consensus        89 kidiLvnnag~~~~~~~~~~~s~e~~d~~~~~Nl~G~~~~~~~~a~~~~~~~~gg~I~~~ss~~~~~~---------~~~  159 (270)
T KOG0725          89 KIDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGSAFCLKQAARPMLKKSKGGSIVNISSVAGVGP---------GPG  159 (270)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC---------CCC
T ss_conf             88779872664678874421999999888864031278999999999998538946999666445566---------777


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCC-H-----HHHHHCC--CCCCCCCCCCEECCHHHHH
Q ss_conf             3431134554455554320012---34567642034777789850-3-----4443113--4543222110001024777
Q gi|254780595|r  123 HPISCVATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRN-P-----FIKIRQK--NSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       123 ~P~~~y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~-~-----~~~~~~g--~~~~~~~~~~~~~~ihv~D  191 (289)
                      .| ..|+.+|.+.+.+.+..+.   .+++++-.+=|+.|..+-+. .     ...+.+.  ....++.+    ...-.+|
T Consensus       160 ~~-~~Y~~sK~al~~ltr~lA~El~~~gIRvN~v~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~p~g----r~g~~~e  234 (270)
T KOG0725         160 SG-VAYGVSKAALLQLTRSLAKELAKHGIRVNSVSPGLVKTSLRAAGLDDGEMEEFKEATDSKGAVPLG----RVGTPEE  234 (270)
T ss_pred             CC-CCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHCCCCCCCHHHHHHHHHCCCCCCCC----CEECCHH
T ss_conf             65-200114999999899999999863936888346867044021256642026777643023666456----5206278


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             79999999513557
Q gi|254780595|r  192 VARCVIFLMTHHLG  205 (289)
Q Consensus       192 va~~i~~l~~~~~~  205 (289)
                      ++.++.++.....+
T Consensus       235 va~~~~fla~~~as  248 (270)
T KOG0725         235 VAEAAAFLASDDAS  248 (270)
T ss_pred             HHHHHHHHCCCCCC
T ss_conf             88757863075543


No 297
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=97.17  E-value=0.0011  Score=40.44  Aligned_cols=100  Identities=15%  Similarity=0.081  Sum_probs=56.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-----------HCCCEEE-ECCCCCCCHHHHHHHCCCCEEE
Q ss_conf             399988888899999999988988999967944634556-----------4498289-8067864023465411563278
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLK-----------HKGISPF-LFADQKINNLLREKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~-----------~~~~~~~-~~~~~~~~~~~~~~~~~~~~v~   69 (289)
                      +|-|+|||.+|+-.+..++..|++|+....+++......           ..+..+- ..+.......+...+.++|.|+
T Consensus         9 ~VaVIGaG~MG~giAa~~a~~G~~V~l~D~~~~a~~~~~~~i~~~~~~l~~~~~~~~~~~~~l~~~~~l~~av~~aD~Vi   88 (321)
T PRK07066          9 TFAAIGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRANVANAWPALERQGLAPGASPARLRFVATIEACVADADFIQ   88 (321)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHCCCCEEE
T ss_conf             79998887888999999994798599996988899999999999999998668996316965014688899863599899


Q ss_pred             EEECCCCCCCEEECCCCCHHHHHHHC-C-CCCCCCCCEEEC
Q ss_conf             76124443310001221013443201-2-334333320102
Q gi|254780595|r   70 QCIKPSSEGDPCIISMSKDFYKFMPH-V-KWIGYLSSTSIY  108 (289)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~-~~~i~~SS~~VY  108 (289)
                      -+++-.       ......+.+.... + ...|..||||-.
T Consensus        89 EavpE~-------l~lK~~lf~~ld~~~~~~aIiASnTS~l  122 (321)
T PRK07066         89 ESAPER-------EALKLELHERISRAAKPDAIIASSTSGL  122 (321)
T ss_pred             ECCEEC-------HHHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             877665-------9999999999997679886785257657


No 298
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent.
Probab=97.16  E-value=0.0017  Score=39.46  Aligned_cols=69  Identities=17%  Similarity=0.124  Sum_probs=49.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             399988888899999999988988999-967944634556449828980678640234654115632787612444
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCG-TTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~-~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
                      ||-++|+|-+|+.++..|++.||++.. .+|++++...+....-...      ......+.....|.|+.+++|..
T Consensus         1 KIg~IG~G~mg~ai~~~l~~~g~~~~~~~~r~~~~~~~~~~~~~~~~------~~~~~~~~~~~~DvIilavkp~~   70 (93)
T pfam03807         1 KIGIIGAGNMGEALARGLAAAGHEVIIANSRNPEKAAALAEELGVGA------TAVSNEEAAEEADVVILAVKPED   70 (93)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHCCCC------CCCCHHHHHHCCCEEEEEECHHH
T ss_conf             98999700999999999997799612786487899999999819976------45899999744998999979999


No 299
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]
Probab=97.09  E-value=0.004  Score=37.37  Aligned_cols=74  Identities=22%  Similarity=0.210  Sum_probs=54.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEE-EECC-----CCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             9399988888899999999988988999967944634556449828-9806-----786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP-FLFA-----DQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~-~~~~-----~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||.|+|+|--|+.|+..|.+.||+|+.-.|+++-...+....... ++-+     .......+...+.++|.|+..+|.
T Consensus         2 ~kI~ViGaGswGTALA~~la~ng~~V~lw~r~~~~~~~i~~~~~N~~yLp~i~lp~~l~at~Dl~~a~~~ad~iv~avPs   81 (329)
T COG0240           2 MKIAVIGAGSWGTALAKVLARNGHEVRLWGRDEEIVAEINETRENPKYLPGILLPPNLKATTDLAEALDGADIIVIAVPS   81 (329)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCEEEEECCH
T ss_conf             61899817837999999999669846999628999999973476701059962886322246899997229999997875


No 300
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=97.08  E-value=0.0062  Score=36.26  Aligned_cols=197  Identities=14%  Similarity=0.137  Sum_probs=104.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-------------------C-CEEEECCCCCCCHHHHH-
Q ss_conf             999888-8889999999998898899996794463455644-------------------9-82898067864023465-
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-------------------G-ISPFLFADQKINNLLRE-   60 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-------------------~-~~~~~~~~~~~~~~~~~-   60 (289)
                      +||||+ |=||+.++.+|.++|-.|+...-|.++.....+.                   | ...+.. |.++.+.+.. 
T Consensus       427 a~VtGGasGIG~~~A~rL~~eGAhvV~aD~d~~~a~~va~~~~~~fG~d~a~AGsdisaCGPaiGl~~-DvT~e~~v~~~  505 (709)
T TIGR02632       427 AFVTGGASGIGRETARRLVDEGAHVVLADLDAEAAEAVAAEIVDKFGADKAVAGSDISACGPAIGLKL-DVTDEEAVKAA  505 (709)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEECCCCHHCCCCCEEEEE-EECCHHHHHHH
T ss_conf             88973886526899999973697799962365789999999863138881211432000467100276-31758999999


Q ss_pred             ------HHCCCCEEEEEEC----CCCCCCE---EECCCCCH------HH-----HHHHC---CCCCCCCCC-EEECCCCC
Q ss_conf             ------4115632787612----4443310---00122101------34-----43201---233433332-01025762
Q gi|254780595|r   61 ------KLYFTTHIVQCIK----PSSEGDP---CIISMSKD------FY-----KFMPH---VKWIGYLSS-TSIYGNRE  112 (289)
Q Consensus        61 ------~~~~~~~v~~~~~----~~~~~~~---~~~~~~~~------~~-----~~~~~---~~~~i~~SS-~~VYg~~~  112 (289)
                            ...++|.|+++++    ++.+...   .+......      ++     +....   ..-+||+.| .+||... 
T Consensus       506 f~~v~~~yGGvD~vv~nAGi~~S~p~~~t~r~~~W~l~~di~atG~FLVareA~r~~~~Q~lGG~~VfiaSkNav~A~k-  584 (709)
T TIGR02632       506 FAEVALAYGGVDIVVNNAGIAVSSPLEETERLEEWDLNLDILATGYFLVAREAARLMRKQGLGGNIVFIASKNAVVAGK-  584 (709)
T ss_pred             HHHHHHHHCCEEEEEECCCHHCCCCCHHHHHHHHHHHCCEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCEEEEEECC-
T ss_conf             9999997498478765253010577023221554320120101200358889999997317985567761100011178-


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC---CCCCC------CCCCCCCCCCCCCCHHHHHHC-------CCCCC
Q ss_conf             123453211234311345544555543200123---45676------420347777898503444311-------34543
Q gi|254780595|r  113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKK---LNIKL------AVLRLSGIYGPKRNPFIKIRQ-------KNSLR  176 (289)
Q Consensus       113 g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~------~ilR~~~iyGp~r~~~~~~~~-------g~~~~  176 (289)
                                 -...|..+|.+.-++++..+-+   +|++|      +|||=+.||--++. ..|...       .++.-
T Consensus       585 -----------n~~AY~aaKA~~~Hl~R~LA~Ela~~GiRVNtV~PdaVl~GS~if~~~W~-~~raA~ygi~ftadePtd  652 (709)
T TIGR02632       585 -----------NASAYSAAKAAEAHLARCLAAELAELGIRVNTVNPDAVLRGSGIFDGEWR-EERAAAYGIPFTADEPTD  652 (709)
T ss_pred             -----------CCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHCCCCCCCCHHHH-HHHHHHHCCCCCCCCCHH
T ss_conf             -----------84055589999998999999814788646401065001105521533678-888877077434687235


Q ss_pred             CCC---CCCEE--C----CHHHHHHHHHHHHHHCCC----CCCCEECCCC
Q ss_conf             222---11000--1----024777799999995135----5786162684
Q gi|254780595|r  177 LVK---KNQVF--N----RIRVEDVARCVIFLMTHH----LGGIFNLSDD  213 (289)
Q Consensus       177 ~~~---~~~~~--~----~ihv~Dva~~i~~l~~~~----~~~iyni~~~  213 (289)
                      +..   ..+|.  +    .|+-+|+|+|+.++....    .|.+.++=.|
T Consensus       653 vl~d~L~~fY~~RslLk~~v~p~d~AeAvf~L~S~~~~~tTG~~i~VDaG  702 (709)
T TIGR02632       653 VLADKLEEFYAKRSLLKREVLPADIAEAVFFLASDKLEKTTGLIITVDAG  702 (709)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCEECCCCC
T ss_conf             78888988987543237766808899999997345101027866403777


No 301
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=97.05  E-value=0.0031  Score=37.98  Aligned_cols=68  Identities=21%  Similarity=0.190  Sum_probs=45.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHH--CCCEEEEE-ECCHHHHHHHHH-CCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             939998888889999999998--89889999-679446345564-4982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALK--VGVYTCGT-TRSVSNLLTLKH-KGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~--~g~~V~~~-~r~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||-|+|||.||+.+++.|.+  .++++.++ +|++.+...+.. .+.....       ..+.......|.|+-|+++.
T Consensus         7 mrVgliG~GaIG~~va~~l~~g~~~~~l~~V~~r~~~~~~~~~~~~~~~~~~-------~~~~~l~~~~DlVVE~A~~~   78 (271)
T PRK13302          7 LRVAIAGLGAIGKAIAQALDRGLPGLTLSAVAVRDPQRHADFIWGLRRPPPV-------VPLDQLATHADIVVEAAPAS   78 (271)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCC-------CCHHHHHHCCCEEEECCCHH
T ss_conf             7799988678999999999758998189999928878889998735898740-------78899601899999898989


No 302
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=97.04  E-value=0.0041  Score=37.28  Aligned_cols=72  Identities=15%  Similarity=0.194  Sum_probs=54.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEE-CCCCCCCHHHHHHH--CCCCEEEEEEC
Q ss_conf             3999888-8889999999998898899996794463455644982898-06786402346541--15632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-FADQKINNLLREKL--YFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~-~~~~~~~~~~~~~~--~~~~~v~~~~~   73 (289)
                      +|||+|+ |-+|+..++.+...|.+|+++++++++.....+.|...++ ..+.+..+.+.+..  .++|.++.+++
T Consensus       143 ~vLi~gaaGgVG~~avQlAk~~Ga~Vi~t~~s~~k~e~~~~lGA~~vi~~~~~~~~~~i~~~t~g~gvdvv~D~vG  218 (327)
T PRK10754        143 QFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQKAQRALKAGAWQVINYREENIVERVKEITGGKKVRVVYDSVG  218 (327)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCEEEEECCC
T ss_conf             9999817761126899999986999999989899999999669999998999999999999868998369998988


No 303
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=97.03  E-value=0.003  Score=38.05  Aligned_cols=71  Identities=17%  Similarity=0.061  Sum_probs=45.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             93999888888999999999889889999679446345564498289806786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |+|.|.|.|.||+.+++.|.++||.|.++.++.+.........  .-..+.. ............|.|+.++|.
T Consensus         4 ~~v~IvG~GliG~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~--lgv~d~~-~~~~~~~~~~~aDlVivavPi   74 (279)
T COG0287           4 MKVGIVGLGLMGGSLARALKEAGLVVRIIGRDRSAATLKAALE--LGVIDEL-TVAGLAEAAAEADLVIVAVPI   74 (279)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHH--CCCCHHH-CCCHHHHHCCCCCEEEEECCH
T ss_conf             4899987746779999999976984799724774677877663--5853010-011555413569989995778


No 304
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=97.02  E-value=0.0058  Score=36.41  Aligned_cols=70  Identities=20%  Similarity=0.224  Sum_probs=49.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             399988888899999999988988999967944634556449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      +|.|+|+|=+|..-++.+.+.|.+|++++|++++.......+...++-..  +...........|.++.+++
T Consensus       169 ~V~I~G~GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~--~~~~~~~~~~~~d~ii~tv~  238 (339)
T COG1064         169 WVAVVGAGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSS--DSDALEAVKEIADAIIDTVG  238 (339)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEECC--CCHHHHHHHHHCCEEEECCC
T ss_conf             99998774899999999998699699995787799999984882899767--81166776734739999877


No 305
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=97.00  E-value=0.00067  Score=41.78  Aligned_cols=101  Identities=14%  Similarity=0.079  Sum_probs=56.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------CCCE-EE----ECCCCCCCHHHHHHHCCC
Q ss_conf             3999888888999999999889889999679446345564-----------4982-89----806786402346541156
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-----------KGIS-PF----LFADQKINNLLREKLYFT   65 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~-----------~~~~-~~----~~~~~~~~~~~~~~~~~~   65 (289)
                      ||-|+|||.+|+.++..+...|++|+...++++.......           .+.. .-    ..........+.+.+.++
T Consensus         4 ~VaViGaG~mG~giA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~l~~~~~~g~~~~~~~~~~~~ri~~~~~l~~al~~a   83 (308)
T PRK06129          4 SIAIVGAGLIGRAWAIVFARAGHRVRLWDADPAALAAAPAYIAGRLEDLAAFDLLDGESPDAVLARIRATDSLADAVADA   83 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCEEECCCHHHHHCCC
T ss_conf             79997778999999999985899389998988999999999999999999769998765999983507228889984749


Q ss_pred             CEEEEEECCCCCCCEEECCCCCHHHHHHHC--CCCCCCCCCEEECC
Q ss_conf             327876124443310001221013443201--23343333201025
Q gi|254780595|r   66 THIVQCIKPSSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYG  109 (289)
Q Consensus        66 ~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~i~~SS~~VYg  109 (289)
                      |.|+-+++-.       ....+.+.+....  ....|+.|+||-..
T Consensus        84 dlViEav~E~-------l~iK~~lf~~le~~~~~~~IlaSnTSsl~  122 (308)
T PRK06129         84 DYVQESAPEN-------LELKRALFAELDALAPPHAILASSTSALL  122 (308)
T ss_pred             CEEEECCCCC-------HHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             9999998077-------99999999999965698558984555388


No 306
>pfam08338 DUF1731 Domain of unknown function (DUF1731). This domain of unknown function appears towards the C-terminus of proteins of the NAD dependent epimerase/dehydratase family (pfam01370) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition.
Probab=96.99  E-value=0.00053  Score=42.37  Aligned_cols=38  Identities=24%  Similarity=0.453  Sum_probs=31.5

Q ss_pred             CHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             824465530694516899997398448999999999999
Q gi|254780595|r  245 SPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW  283 (289)
Q Consensus       245 ~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~~~~  283 (289)
                      ++|. ....++++|+++|+.+.||+++||+++++|++++
T Consensus        11 GEma-~lll~sqrv~p~kl~~~Gf~F~~~~l~~AL~~il   48 (48)
T pfam08338        11 GEMA-ELLLEGQRVLPKKLLEAGFQFRYPTLEDALRDLL   48 (48)
T ss_pred             HHHH-HHHHCCCCCCCHHHHHCCCCCCCCCHHHHHHHHC
T ss_conf             8489-9986898527489998789868999999999879


No 307
>PRK06223 malate dehydrogenase; Reviewed
Probab=96.98  E-value=0.002  Score=39.09  Aligned_cols=71  Identities=17%  Similarity=0.036  Sum_probs=43.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCHHHHH----HHHHCCCEEEECCCCCC--CHHHHHHHCCCCEEEEEE
Q ss_conf             93999888888999999999889--88999967944634----55644982898067864--023465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG--VYTCGTTRSVSNLL----TLKHKGISPFLFADQKI--NNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g--~~V~~~~r~~~~~~----~l~~~~~~~~~~~~~~~--~~~~~~~~~~~~~v~~~~   72 (289)
                      |||-|+|||.+|+.++-.|..++  -++.-+.+++++..    .+.+.  ..+...+...  .... +.+.++|.|+.++
T Consensus         1 mKI~IiGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~--~~~~~~~~~i~~~~d~-~~~~daDiVVita   77 (312)
T PRK06223          1 MKISIIGAGNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAES--SAVDGFDAKITGTNDY-ADIAGSDVVIITA   77 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCC--CCCCCCCCEEEECCCH-HHHCCCCEEEEEC
T ss_conf             979999969899999999985799874899769997336798887651--4336888479837888-9957999999906


Q ss_pred             CC
Q ss_conf             24
Q gi|254780595|r   73 KP   74 (289)
Q Consensus        73 ~~   74 (289)
                      +.
T Consensus        78 g~   79 (312)
T PRK06223         78 GV   79 (312)
T ss_pred             CC
T ss_conf             77


No 308
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed
Probab=96.97  E-value=0.0053  Score=36.67  Aligned_cols=69  Identities=10%  Similarity=0.063  Sum_probs=49.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC---EEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             939998888889999999998898---899996794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGV---YTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~---~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||-++|+|-+|+.+++-|++.|+   +++...|+.++...+..........      ..-.+....+|.|+.++-|.
T Consensus         1 MkIgfIG~GnMg~Aii~Gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~~v~~~------~~n~~~~~~~dvi~LaVKP~   72 (255)
T PRK06476          1 MRIGFIGTGAITEAMVTGLLSSPADVSEIIVSPRNAQIAARLAARFAKVRIA------KDNQAVVDRSDVVFLAVRPQ   72 (255)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEEE------CCHHHHHHHCCEEEEEECHH
T ss_conf             9899986469999999999978899250889898989999999876955985------78899985188788861788


No 309
>pfam02558 ApbA Ketopantoate reductase PanE/ApbA. This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) <= 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway.
Probab=96.97  E-value=0.005  Score=36.78  Aligned_cols=43  Identities=21%  Similarity=0.356  Sum_probs=36.1

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEE
Q ss_conf             99988888899999999988988999967944634556449828
Q gi|254780595|r    3 LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP   46 (289)
Q Consensus         3 IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~   46 (289)
                      |.|+|||=||+.++..|.+.|++|+.+.|.+ +...+...+...
T Consensus         1 I~IiGaGaiG~~~a~~L~~ag~~V~lv~R~~-~~~~i~~~G~~~   43 (150)
T pfam02558         1 IAILGAGAVGSLYGARLARAGHDVTLIARGR-HLEAIRENGLRI   43 (150)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHCCEEE
T ss_conf             9999668999999999997799289997563-678877497699


No 310
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=96.96  E-value=0.0053  Score=36.63  Aligned_cols=73  Identities=18%  Similarity=0.200  Sum_probs=51.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEE-EECC--CCCCCHHHHHHHC--CCCEEEEEEC
Q ss_conf             93999888-88899999999988988999967944634556449828-9806--7864023465411--5632787612
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP-FLFA--DQKINNLLREKLY--FTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~-~~~~--~~~~~~~~~~~~~--~~~~v~~~~~   73 (289)
                      .+|||+|+ |=+|...++.+...|.+|+++++++++...++..|+.. .+.+  +.+..+.+.+...  ++|.|+.+++
T Consensus       106 ~~VlI~gg~G~vG~~aiqlak~~Ga~Vi~t~~s~~k~~~~~~lG~~~~~v~~~~~~~~~~~v~~~t~g~gvDvv~d~vg  184 (288)
T smart00829      106 ESVLIHAAAGGVGQAAIQLAQHLGAEVFATAGSPEKRDFLRELGIPDDHIFSSRDLSFADEILRATGGRGVDVVLNSLA  184 (288)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCCEEEEECCC
T ss_conf             9999978986777999999997398300340888999999976999607621799509999998708988279998986


No 311
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849   This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues. Among complete genomes, it is found is found in Bacillus subtilis and Mycobacterium tuberculosis, both of which also contain Gnd, and in Aquifex aeolicus. .
Probab=96.96  E-value=0.002  Score=39.10  Aligned_cols=40  Identities=30%  Similarity=0.347  Sum_probs=37.8

Q ss_pred             CE-EEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
Q ss_conf             93-99988888899999999988988999967944634556
Q gi|254780595|r    1 MH-LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLK   40 (289)
Q Consensus         1 Mk-IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~   40 (289)
                      || |.++|-|-.|..|+++|.++||+|++-++++.....+.
T Consensus         1 MktlglIGLGrMG~ni~~rl~~rgh~~vgYd~~q~av~~~k   41 (341)
T TIGR00872         1 MKTLGLIGLGRMGANIAKRLADRGHEVVGYDRDQAAVEELK   41 (341)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
T ss_conf             95244313346789999998527946998538879999972


No 312
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=96.95  E-value=0.0047  Score=36.97  Aligned_cols=66  Identities=20%  Similarity=0.264  Sum_probs=50.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888888999999999889-8899996794463455644-9828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVG-VYTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      |+||+|||-+|.-+++.|.++| .+|+..+|+.++...+... +....      .-..+...+..+|.|+.+.+
T Consensus       180 ~vlvIGAGem~~lva~~L~~~g~~~i~IaNRT~erA~~La~~~~~~~~------~l~el~~~l~~~DvVissTs  247 (414)
T COG0373         180 KVLVIGAGEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLGAEAV------ALEELLEALAEADVVISSTS  247 (414)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCEEE------CHHHHHHHHHHCCEEEEECC
T ss_conf             699986518999999999858987799975878999999998387022------18778876520799999069


No 313
>PRK06732 phosphopantothenate--cysteine ligase; Validated
Probab=96.94  E-value=0.0024  Score=38.58  Aligned_cols=74  Identities=20%  Similarity=0.259  Sum_probs=46.8

Q ss_pred             CEEEEE-C---------------C-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECC-CCCCCHHHHHHH
Q ss_conf             939998-8---------------8-888999999999889889999679446345564498289806-786402346541
Q gi|254780595|r    1 MHLMIF-G---------------A-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA-DQKINNLLREKL   62 (289)
Q Consensus         1 MkIlI~-G---------------a-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~   62 (289)
                      |||||| |               + |-.|..+++++..+|++|+.+++.. ........++..+... ..+....+...+
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~~Ga~Vtli~g~~-~~~p~~~~~~~~i~v~ta~em~~~~~~~~   79 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQAGHEVTLVTTKT-AVKPEPHPNLSIIEIENVDDLLATLKPLV   79 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCCEEEEEECCC-CCCCCCCCCEEEEEECCHHHHHHHHHHHC
T ss_conf             98999578876676884476767814999999999997899899995677-56889889858999458999999999747


Q ss_pred             CCCCEEEEEECCC
Q ss_conf             1563278761244
Q gi|254780595|r   63 YFTTHIVQCIKPS   75 (289)
Q Consensus        63 ~~~~~v~~~~~~~   75 (289)
                      ...|.++++++..
T Consensus        80 ~~~D~~I~aAAVs   92 (228)
T PRK06732         80 PHHDVLIHSMAVS   92 (228)
T ss_pred             CCCCEEEEEEEEC
T ss_conf             8999999931810


No 314
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=96.91  E-value=0.0031  Score=37.96  Aligned_cols=222  Identities=15%  Similarity=0.147  Sum_probs=96.9

Q ss_pred             EEEEECCC-----------HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHH-HHCCCCEEE
Q ss_conf             39998888-----------889999999998898899996794463455644982898067864023465-411563278
Q gi|254780595|r    2 HLMIFGAG-----------YTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE-KLYFTTHIV   69 (289)
Q Consensus         2 kIlI~GaG-----------~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~~~v~   69 (289)
                      ||||+|||           |.+=|.+..|.+.|++++-++-||+-.+.--+. ..-+-|+..+....+.- ..+..+.|+
T Consensus       575 ~~lvlGSGp~RIGqgvEFDYc~Vh~~~aLr~~Gye~ImiN~NPETVSTDyD~-sDrLYFEplt~E~Vm~I~e~E~~~GVI  653 (1089)
T TIGR01369       575 KVLVLGSGPNRIGQGVEFDYCCVHAVLALREAGYETIMINYNPETVSTDYDT-SDRLYFEPLTFEDVMNIIELEKPEGVI  653 (1089)
T ss_pred             EEEEECCCCEECCCCEEEHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHH-HHHCCCCCCCCCCCEEHEEECCCCEEE
T ss_conf             6899878451406631205678999999987299599997789974366665-101158763503100110005866799


Q ss_pred             EEECCCCCCCEEECCCCCHHHHHHHC-C-CCCCCCCCEEEC--CCCC--CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             76124443310001221013443201-2-334333320102--5762--1234532112343113455445555432001
Q gi|254780595|r   70 QCIKPSSEGDPCIISMSKDFYKFMPH-V-KWIGYLSSTSIY--GNRE--GQWVDEHSFVHPISCVATQRFNAEKEWLAIT  143 (289)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~-~~~i~~SS~~VY--g~~~--g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~  143 (289)
                      ...+         -.+-.+++..+.. . -+++=+|..++=  =|+.  ...+++=.-.+|.+.-+.+.-    .+.+++
T Consensus       654 Vq~G---------GQtp~nlA~~L~~~GG~~iLGTS~~~ID~AEDR~kFs~~l~~Lgi~QP~~~~a~s~e----ea~~~A  720 (1089)
T TIGR01369       654 VQFG---------GQTPLNLAKELEEAGGVPILGTSPESIDRAEDREKFSELLDELGIPQPEWKIATSVE----EAKEFA  720 (1089)
T ss_pred             EECC---------CHHHHHHHHHHHHCCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCEECCHH----HHHHHH
T ss_conf             9748---------732678999999708931736885787513186799999971587989885272879----999998


Q ss_pred             CCCCCCCCCCCCCCCCCCC-------CCHHHHHH-------CCCCCCCCCCCCEEC-C--HHHHHHH--------HHHHH
Q ss_conf             2345676420347777898-------50344431-------134543222110001-0--2477779--------99999
Q gi|254780595|r  144 KKLNIKLAVLRLSGIYGPK-------RNPFIKIR-------QKNSLRLVKKNQVFN-R--IRVEDVA--------RCVIF  198 (289)
Q Consensus       144 ~~~~~~~~ilR~~~iyGp~-------r~~~~~~~-------~g~~~~~~~~~~~~~-~--ihv~Dva--------~~i~~  198 (289)
                      ++-|.|+ ++||+.|.|=.       ..-+.+..       ...|.++   +++.. -  +.||=|+        ..+-|
T Consensus       721 ~~iGYPv-lvRPSYVLgG~aM~iv~~~eeL~~yl~~a~~~S~~~PVli---dky~e~A~E~dVD~v~Dg~~v~i~gI~EH  796 (1089)
T TIGR01369       721 SEIGYPV-LVRPSYVLGGRAMEIVYNEEELARYLEEAVEVSPEHPVLI---DKYLEDAVEIDVDAVSDGEEVLIPGIMEH  796 (1089)
T ss_pred             HHCCCCE-EECCCCCCCCCCHHEECCHHHHHHHHHHHHHHCCCCCEEE---EEECCCCEEEEEEEEEECCEEEEEEHHHH
T ss_conf             5469928-9816830033621002678899999999997208997698---88528888999989972884899623123


Q ss_pred             HHCCC--CC------CCEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             95135--57------861626843333899999999995579986343101
Q gi|254780595|r  199 LMTHH--LG------GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT  241 (289)
Q Consensus       199 l~~~~--~~------~iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~  241 (289)
                      +.+.+  .|      ...++..+.--.+++.++.+|+.+++.=|..+-|-.
T Consensus       797 iE~AGVHSGDs~~~~Pp~~L~~~~~~~i~~~~~~iA~~L~v~Gl~NiQf~~  847 (1089)
T TIGR01369       797 IEEAGVHSGDSTCVLPPQTLSEDIVKRIKDIVRKIAKELNVKGLFNIQFVV  847 (1089)
T ss_pred             HHHCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             421367613053117697778899999999999999870660722245556


No 315
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional
Probab=96.89  E-value=0.026  Score=32.73  Aligned_cols=192  Identities=13%  Similarity=0.091  Sum_probs=88.5

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCEEEEEECCHH-----------H---HHHHHH------CCCEEEECCCC---C--
Q ss_conf             39998888---8899999999988988999967944-----------6---345564------49828980678---6--
Q gi|254780595|r    2 HLMIFGAG---YTGKFIADAALKVGVYTCGTTRSVS-----------N---LLTLKH------KGISPFLFADQ---K--   53 (289)
Q Consensus         2 kIlI~GaG---~iG~~l~~~L~~~g~~V~~~~r~~~-----------~---~~~l~~------~~~~~~~~~~~---~--   53 (289)
                      ..||||+|   =||..+++.|.+.|-+|....|.+.           +   ...+..      ..+.+...+..   +  
T Consensus        10 vAlVTGaGgs~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~   89 (298)
T PRK06300         10 VAFIAGIGDDQGYGWGIAKMLAEAGATIIVGTWVPIYKIFSQSWELGKFNESRKLSNGELLTIAKIYPMDASFDKPEDVP   89 (298)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECCCCCCHHHHH
T ss_conf             79990879986299999999998299999923753024555688765568888750563000034653003457432305


Q ss_pred             -------------------CCHHHHHHHCCCCEEEEEECCCCC-CCEEECC----CCC----HH---HHH-------HHC
Q ss_conf             -------------------402346541156327876124443-3100012----210----13---443-------201
Q gi|254780595|r   54 -------------------INNLLREKLYFTTHIVQCIKPSSE-GDPCIIS----MSK----DF---YKF-------MPH   95 (289)
Q Consensus        54 -------------------~~~~~~~~~~~~~~v~~~~~~~~~-~~~~~~~----~~~----~~---~~~-------~~~   95 (289)
                                         .-+...+....+|.++++++-... ..+....    +..    ++   ..+       .+.
T Consensus        90 ~di~~~~~~~~l~~~~v~~~v~~~~~~fG~iDiLVnna~~~~~~~~~~~e~~~~~~~~~~~~n~~~~~~~~~~~~p~m~~  169 (298)
T PRK06300         90 EDIAENKRYKGISGYTISEVVEQVKKDFGHIDILVHSLANSPEISKPLLETSRKGYLAALSTSSYSFVSLLSHFGPIMNA  169 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             77765665410015799999999998779977899899888756778455899999999989849999999999999763


Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC----CCCCCCCCCCCCCCCCCCCC-CC--HHHH
Q ss_conf             23343333201025762123453211234311345544555543200----12345676420347777898-50--3444
Q gi|254780595|r   96 VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAI----TKKLNIKLAVLRLSGIYGPK-RN--PFIK  168 (289)
Q Consensus        96 ~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~----~~~~~~~~~ilR~~~iyGp~-r~--~~~~  168 (289)
                      -.++|-+||.+--.          ..+.....|+.+|...+.+-+..    .+++|+.+-.+.|+.+..+. +.  ....
T Consensus       170 ~G~ii~i~s~~~~~----------~~p~~~~~ysasKaal~~lTr~lA~E~g~~ygIRVNaI~PG~i~T~~~~~~~~~e~  239 (298)
T PRK06300        170 GGSTISLTYLASMR----------AVPGYGGGMSAAKAALESDTKTLAWEAGRRWGIRVNTISAGPLASRAGKAIGFIER  239 (298)
T ss_pred             CCCEEEEEEEECCC----------CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCHH
T ss_conf             89447754300134----------46774036799999998659999998570118089998548644712321466299


Q ss_pred             ----HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC----CCCEECC
Q ss_conf             ----311345432221100010247777999999951355----7861626
Q gi|254780595|r  169 ----IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL----GGIFNLS  211 (289)
Q Consensus       169 ----~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~----~~iyni~  211 (289)
                          .....+.        --+...+|+|+++.+|.....    |+++.+-
T Consensus       240 ~~~~~~~~~Pl--------~R~g~peeiA~~v~FLaSd~as~ITG~~i~VD  282 (298)
T PRK06300        240 MVDYYQDWAPL--------PEPMEAEQVGAVAAFLVSPLASAITGETLYVD  282 (298)
T ss_pred             HHHHHHHCCCC--------CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEEC
T ss_conf             99999857998--------99989999999999980840069578878789


No 316
>PRK07588 hypothetical protein; Provisional
Probab=96.89  E-value=0.0016  Score=39.63  Aligned_cols=34  Identities=26%  Similarity=0.297  Sum_probs=31.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9399988888899999999988988999967944
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVS   34 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~   34 (289)
                      |||+|.|||--|-.++-.|.++||+|+.+-|.+.
T Consensus         1 mkVlIvGaGiaGLalA~~L~r~G~~v~V~Er~~~   34 (391)
T PRK07588          1 MKIAISGAGIAGATLAHWLQRTGHEPTLIERAPK   34 (391)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9799999328999999999868999899903898


No 317
>pfam10727 Rossmann-like Rossmann-like domain. This family of proteins contain a Rossmann-like domain.
Probab=96.88  E-value=0.0021  Score=38.91  Aligned_cols=88  Identities=13%  Similarity=0.088  Sum_probs=54.3

Q ss_pred             EECCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCEEEC
Q ss_conf             9888888999999999889889999-679446345564498289806786402346541156327876124443310001
Q gi|254780595|r    5 IFGAGYTGKFIADAALKVGVYTCGT-TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCII   83 (289)
Q Consensus         5 I~GaG~iG~~l~~~L~~~g~~V~~~-~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~   83 (289)
                      |+|+|-+|..|...|.+.||.|.++ +|+..........--..+        ....+....+|.|+.+++++.-     .
T Consensus         2 iIGaGrvG~~L~~al~~aGh~v~gv~srs~~s~~~a~~~~~~~~--------~~~~ev~~~adlv~itvPDd~I-----~   68 (111)
T pfam10727         2 IISAGRVGVALGEALERAGHVVHAISAISDASRERAERRLDSPV--------LPIPDVIRRAELVVLAVPDAEL-----P   68 (111)
T ss_pred             CCCCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHCCCCC--------CCHHHHHHHCCEEEEECCHHHH-----H
T ss_conf             43765779999999997898289998389889999998669976--------7958989767999998978889-----9


Q ss_pred             CCCCHHHHHHHCCCCCCCCCCE
Q ss_conf             2210134432012334333320
Q gi|254780595|r   84 SMSKDFYKFMPHVKWIGYLSST  105 (289)
Q Consensus        84 ~~~~~~~~~~~~~~~~i~~SS~  105 (289)
                      ...+.+......-|-++|+|..
T Consensus        69 ~vv~~la~~~~~GqiV~HtSGa   90 (111)
T pfam10727        69 GLVEGLAATVRRGQIVAHTSGA   90 (111)
T ss_pred             HHHHHHHHHCCCCCEEEECCCC
T ss_conf             9999998326799799986687


No 318
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such..
Probab=96.87  E-value=0.0066  Score=36.12  Aligned_cols=70  Identities=16%  Similarity=0.183  Sum_probs=56.9

Q ss_pred             EEEEECC-CHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHH-HHHHCCCCEEEEE
Q ss_conf             3999888-8889999999998-8988999967944634556449828980678640234-6541156327876
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALK-VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL-REKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~-~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~~v~~~   71 (289)
                      +|||+|+ |=+||-+++.+.+ -+-+|+++.-.|+...+....|.+.++-+-......+ ...+..+++|+.+
T Consensus       153 ~lLIiGgAGGVGSI~iQLAR~LT~ltVIaTASRpEs~~Wv~~LGAH~VIDHskPL~~ql~~L~l~~v~~V~Sl  225 (338)
T TIGR02817       153 ALLIIGGAGGVGSILIQLARQLTGLTVIATASRPESQEWVLELGAHHVIDHSKPLKAQLEKLGLEAVSYVFSL  225 (338)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHCCCCCCEEECC
T ss_conf             4789738851789999999985496499972857899999973991886588436899998288998557516


No 319
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.86  E-value=0.0031  Score=37.94  Aligned_cols=73  Identities=12%  Similarity=-0.034  Sum_probs=42.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCHHHHH--HHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             93999888-8889999999998898--8999967944634--5564498289806786402346541156327876124
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGV--YTCGTTRSVSNLL--TLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~--~V~~~~r~~~~~~--~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||-|+|| |.+|++++-.|..++.  ++.-+..+..+..  .+.+.....-.. -..........+.++|.|+.+++.
T Consensus         1 mKV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~-~~~~~~~~~~~l~daDiVVitAG~   78 (310)
T cd01337           1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVT-GYLGPEELKKALKGADVVVIPAGV   78 (310)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEE-EEECCCCHHHHHCCCCEEEECCCC
T ss_conf             989999999818999999997299977699982774266755321656568512-570887466774799999987898


No 320
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.83  E-value=0.003  Score=38.06  Aligned_cols=72  Identities=21%  Similarity=0.191  Sum_probs=43.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCHHHH----HHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             93999888888999999999889--8899996794463----45564498289806786402346541156327876124
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG--VYTCGTTRSVSNL----LTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g--~~V~~~~r~~~~~----~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      |||-|+|||.+|+.++-.|..++  -++.-+.++..+.    ..+.+.  ..+.....-.... ...+.++|.|+.+++.
T Consensus         1 mKI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a--~~~~~~~~i~~~~-~~~l~daDvVVitaG~   77 (308)
T cd05292           1 MKVAIVGAGFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHG--TPFVKPVRIYAGD-YADCKGADVVVITAGA   77 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHH--CCCCCCCEEEECC-HHHHCCCCEEEECCCC
T ss_conf             979999948889999999986799887999918898451256876624--1036881684099-9997799999989999


Q ss_pred             C
Q ss_conf             4
Q gi|254780595|r   75 S   75 (289)
Q Consensus        75 ~   75 (289)
                      .
T Consensus        78 ~   78 (308)
T cd05292          78 N   78 (308)
T ss_pred             C
T ss_conf             9


No 321
>PRK06753 hypothetical protein; Provisional
Probab=96.83  E-value=0.0018  Score=39.28  Aligned_cols=34  Identities=26%  Similarity=0.230  Sum_probs=31.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9399988888899999999988988999967944
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVS   34 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~   34 (289)
                      |||+|+|+|-.|-.++..|.++|++|+.+-|++.
T Consensus         1 mkV~IVGaGiaGL~~A~~L~~~G~~v~V~Er~~~   34 (373)
T PRK06753          1 MKIAIIGAGIGGLTAAALLQEQGHTVKVFEKNES   34 (373)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9899999458999999999977999999888999


No 322
>KOG0409 consensus
Probab=96.83  E-value=0.0033  Score=37.85  Aligned_cols=76  Identities=12%  Similarity=0.150  Sum_probs=59.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCEE
Q ss_conf             39998888889999999998898899996794463455644982898067864023465411563278761244433100
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPC   81 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~   81 (289)
                      +|=-+|-|-.|+..+..|++.||+|++..|+..+...+...|...        .....+..+.+|.|+-+++........
T Consensus        37 ~iGFIGLG~MG~~M~~nLik~G~kVtV~dr~~~k~~~f~~~Ga~v--------~~sPaeVae~sDvvitmv~~~~~v~~v  108 (327)
T KOG0409          37 RIGFIGLGNMGSAMVSNLIKAGYKVTVYDRTKDKCKEFQEAGARV--------ANSPAEVAEDSDVVITMVPNPKDVKDV  108 (327)
T ss_pred             EEEEEEECCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCHHH--------HCCHHHHHHHCCEEEEECCCHHHHHHH
T ss_conf             135774341118999999975987999958678878999705014--------079799986368899976880766888


Q ss_pred             ECCC
Q ss_conf             0122
Q gi|254780595|r   82 IISM   85 (289)
Q Consensus        82 ~~~~   85 (289)
                      +...
T Consensus       109 ~~g~  112 (327)
T KOG0409         109 LLGK  112 (327)
T ss_pred             HCCC
T ss_conf             4077


No 323
>PRK13940 glutamyl-tRNA reductase; Provisional
Probab=96.82  E-value=0.0055  Score=36.55  Aligned_cols=68  Identities=15%  Similarity=0.176  Sum_probs=49.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888888999999999889-88999967944634556449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVG-VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      |+||+|+|-+|+.+++.|.+.| .+++..+|+.++...+...--    ......-..+...+..+|.|+.+.+
T Consensus       183 ~vlvvGaGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~----~~~~~~~~~l~~~l~~aDivisaT~  251 (414)
T PRK13940        183 NVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFR----NASAHYLSELPQLIKKADIIIAAVN  251 (414)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHC----CCCCCCHHHHHHHHHHCCEEEEECC
T ss_conf             38996686478999999997699879994575677999999708----8850169999999863887998169


No 324
>PRK06545 prephenate dehydrogenase; Validated
Probab=96.82  E-value=0.0056  Score=36.53  Aligned_cols=69  Identities=20%  Similarity=0.130  Sum_probs=47.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEE--EEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             93999888888999999999889889--9996794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYT--CGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V--~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      .+|+|+|.|.||..++..|.++|..+  ++.+++......-...++...      ....+......+|.|+.|.|+.
T Consensus         1 k~V~IiGlGLIGgSlalalk~~g~~~~i~~~d~~~~~l~~A~~~g~id~------~~~~~~~~~~~~DlVvlatPv~   71 (357)
T PRK06545          1 KTVLIVGLGLIGGSLALAIKAAGPDVFIIGYDPSGAQLARALGFGVIDE------LAEDLARAAAEADLIVLAVPVD   71 (357)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCE------ECCCHHHHCCCCCEEEECCCHH
T ss_conf             9799997787899999999854997699996699999999986899773------0488767156799999949999


No 325
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed
Probab=96.81  E-value=0.0067  Score=36.06  Aligned_cols=66  Identities=21%  Similarity=0.147  Sum_probs=46.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEE
Q ss_conf             939998888889999999998898899996794463455644982898067864023465411563278
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIV   69 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~   69 (289)
                      ++|-|+|+|++|+.++....+.|++|.++..++....  .+.. ..+...+.++...+......+|.|-
T Consensus         8 ~tIGIlGgGQLgrMla~aA~~lG~~v~vldp~~~~PA--~~va-~~~~~~~~~D~~al~~fa~~~DviT   73 (377)
T PRK06019          8 KTIGIIGGGQLGRMLALAAAPLGYKVIVLDPDADCPA--AQVA-DRVIVADYDDVAALRELAEQCDVIT   73 (377)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCH--HHHC-CEEEECCCCCHHHHHHHHHCCCEEE
T ss_conf             9999987868999999999978998999848984984--7837-8489868898999999984599999


No 326
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional
Probab=96.79  E-value=0.0024  Score=38.63  Aligned_cols=33  Identities=30%  Similarity=0.296  Sum_probs=30.2

Q ss_pred             CE-EEEECCCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             93-9998888889999999998898899996794
Q gi|254780595|r    1 MH-LMIFGAGYTGKFIADAALKVGVYTCGTTRSV   33 (289)
Q Consensus         1 Mk-IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~   33 (289)
                      |+ |.|+|+|.+|...+-+|.++|++|+.+.|+.
T Consensus         1 m~~V~VIGaGivGlstA~~La~~G~~VtviDr~~   34 (410)
T PRK12409          1 MSHIAVIGAGITGVTTAYALAQRGYQVTVFDRHR   34 (410)
T ss_pred             CCCEEEECCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9959998983999999999997899189996989


No 327
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848    In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis. These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This entry describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of IPR005252 from INTERPRO, corresponding to phosphopantothenate--cysteine ligase activity ..
Probab=96.76  E-value=0.0033  Score=37.82  Aligned_cols=85  Identities=19%  Similarity=0.202  Sum_probs=49.9

Q ss_pred             CEEEEE-C---------------C-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEC-CCCCCCHHHHHHH
Q ss_conf             939998-8---------------8-88899999999988988999967944634556449828980-6786402346541
Q gi|254780595|r    1 MHLMIF-G---------------A-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-ADQKINNLLREKL   62 (289)
Q Consensus         1 MkIlI~-G---------------a-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~-~~~~~~~~~~~~~   62 (289)
                      |||||| |               + |.+|..+++.+++.||+|+-++.- .-..+..+.+-..... +-.+.-..+.+..
T Consensus         1 Mk~LvTsGGTsE~ID~VRSITNHStG~LGK~IaE~fL~~Gh~VtlvTTK-~A~kP~~~~~Lsi~Eie~~~~L~~~L~~~v   79 (253)
T TIGR02114         1 MKILVTSGGTSEPIDNVRSITNHSTGGLGKIIAEKFLAAGHEVTLVTTK-RALKPEPQLNLSIKEIETVKDLLTTLKELV   79 (253)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECC-CCCCCCCCCCCCEEEECCHHHHHHHHHHHC
T ss_conf             9368815886366666355123376872179999998658789787536-121888888862486427789999988750


Q ss_pred             CC--CCEEEEEECCCCCCCEEECCCCC
Q ss_conf             15--63278761244433100012210
Q gi|254780595|r   63 YF--TTHIVQCIKPSSEGDPCIISMSK   87 (289)
Q Consensus        63 ~~--~~~v~~~~~~~~~~~~~~~~~~~   87 (289)
                      ..  .|.++|+-|-+ ++-+.+....+
T Consensus        80 ~~kq~d~liHsMAVS-DYTpvym~~~E  105 (253)
T TIGR02114        80 AEKQHDILIHSMAVS-DYTPVYMTDLE  105 (253)
T ss_pred             CCCCCCEEEEEECCC-CCCHHHHCCHH
T ss_conf             125543888851126-88510001167


No 328
>PRK13304 L-aspartate dehydrogenase; Reviewed
Probab=96.71  E-value=0.0062  Score=36.26  Aligned_cols=68  Identities=18%  Similarity=0.180  Sum_probs=44.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHC--CCEEEEE-ECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             9399988888899999999988--9889999-6794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKV--GVYTCGT-TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~--g~~V~~~-~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      |||-|+|+|.||+.+++.|.+.  +.++.++ .|++++...+....-....       ..+.+.....|.|+-|+++.
T Consensus         2 ~rVgiIG~GaIG~~Va~~l~~g~~~~~L~~V~~r~~~~a~~~a~~~~~~~~-------~~ld~l~~~~DlVVE~A~~~   72 (265)
T PRK13304          2 LKIGIVGCGAIANLITKAIDSGRINAELLAFYDRNLEKAENLAEKTGAPAC-------LSIDELVKDVDLVVECASQK   72 (265)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCCCCCCC-------CCHHHHHHCCCEEEECCCHH
T ss_conf             499998657899999999867998649999978987898877641599712-------79899833899999898989


No 329
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=96.69  E-value=0.011  Score=34.86  Aligned_cols=73  Identities=10%  Similarity=0.016  Sum_probs=50.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEE----ECCCCCCCHHHHHHHCCCCEEEEEECC
Q ss_conf             3999888-888999999999889889999679446345564498289----806786402346541156327876124
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF----LFADQKINNLLREKLYFTTHIVQCIKP   74 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~----~~~~~~~~~~~~~~~~~~~~v~~~~~~   74 (289)
                      +++|+|+ |-||+..+..|.++|.+|+.+.|+.++.......-...+    ..-+...+......+..+|.|+.+.+.
T Consensus        30 ~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~~ek~~~~a~~i~~r~g~~~~~~~~~~~~~~~~~l~~adiV~~a~aA  107 (194)
T cd01078          30 TAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQKAADSLRARFGEGVGAVETSDDAARAAAIKGADVVFAAGAA  107 (194)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCEEEECCHH
T ss_conf             899985885789999999998399799995878889999999999709873113578877899774669899964277


No 330
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed
Probab=96.60  E-value=0.016  Score=33.91  Aligned_cols=67  Identities=21%  Similarity=0.240  Sum_probs=48.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC----EEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             939998888889999999998898----899996794463455644-982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGV----YTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~----~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      +||-++|||-+|+.++.-|++.+.    +++...|+.++...+... ++...        ....+....+|.|+.|+-|.
T Consensus         3 kkI~fIG~GnMg~Aii~Gl~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~--------~~~~e~~~~~Dii~LaVKP~   74 (272)
T PRK12491          3 KQIGFIGCGNMGIAMIGGMINKNIVSPDQIICSDLNVSNLKNASDKYGITIT--------TNNNEVANSADILILSIKPD   74 (272)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEE--------CCHHHHHHHCCEEEEEECHH
T ss_conf             8699985679999999999978898967699969799999999997197886--------68799973199999995778


No 331
>PRK08309 short chain dehydrogenase; Provisional
Probab=96.60  E-value=0.0074  Score=35.82  Aligned_cols=41  Identities=22%  Similarity=0.271  Sum_probs=35.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC
Q ss_conf             93999888-8889999999998898899996794463455644
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK   42 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~   42 (289)
                      |+.||+|. |.+ ..++..|.++|++|+.+.|+..+.....+.
T Consensus         1 mhaLVIGGTGML-~~vs~~L~~qg~~VsiiaR~~~kl~~~~~~   42 (182)
T PRK08309          1 MHALVIGGTGML-KRVSLWLCEEGFHVSIIARDEVKLENVKRE   42 (182)
T ss_pred             CCEEEECCCHHH-HHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             916997241755-999999973799999994487886536862


No 332
>KOG0023 consensus
Probab=96.60  E-value=0.009  Score=35.32  Aligned_cols=71  Identities=15%  Similarity=0.186  Sum_probs=40.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             93999888-8889999999998898899996794-4634556449828980678640234654115632787612
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSV-SNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~-~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
                      ++|-|+|+ | +|+.-++...+.|++|++++++. ++.+.++..|.+.|+- ...+..........-|.++|+++
T Consensus       183 ~~vgI~GlGG-LGh~aVq~AKAMG~rV~vis~~~~kkeea~~~LGAd~fv~-~~~d~d~~~~~~~~~dg~~~~v~  255 (360)
T KOG0023         183 KWVGIVGLGG-LGHMAVQYAKAMGMRVTVISTSSKKKEEAIKSLGADVFVD-STEDPDIMKAIMKTTDGGIDTVS  255 (360)
T ss_pred             CEEEEECCCC-CCHHHHHHHHHHCCEEEEEECCCHHHHHHHHHCCCCEEEE-ECCCHHHHHHHHHHHCCCCEEEE
T ss_conf             6898855764-0168999998708679999278534899998549621588-42787899999875267502321


No 333
>PRK13243 glyoxylate reductase; Reviewed
Probab=96.57  E-value=0.015  Score=34.03  Aligned_cols=21  Identities=5%  Similarity=0.202  Sum_probs=13.5

Q ss_pred             CEECCCCCHHHHHHHHHHHHH
Q ss_conf             616268433338999999999
Q gi|254780595|r  207 IFNLSDDEPAPPQNVIMEAAS  227 (289)
Q Consensus       207 iyni~~~~~~s~~e~~~~i~~  227 (289)
                      +.|++=+.-+...++++.+.+
T Consensus       236 lIN~aRG~iVde~aL~~aL~~  256 (333)
T PRK13243        236 LVNIARGKVVDTKALVKALKE  256 (333)
T ss_pred             EEECCCCHHCCHHHHHHHHHH
T ss_conf             998588400399999999980


No 334
>COG3268 Uncharacterized conserved protein [Function unknown]
Probab=96.56  E-value=0.0052  Score=36.69  Aligned_cols=72  Identities=25%  Similarity=0.447  Sum_probs=53.7

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             999888-8889999999998898899996794463455644-982898067864023465411563278761244
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
                      ++|-|| ||.|..++++|...|++-.--.||..++..+... +-+.-.|... ....+...+....+|++|+.|=
T Consensus         9 ~iiYGAtGy~G~lvae~l~~~g~~~aLAgRs~~kl~~l~~~LG~~~~~~p~~-~p~~~~~~~~~~~VVlncvGPy   82 (382)
T COG3268           9 IIIYGATGYAGGLVAEYLAREGLTAALAGRSSAKLDALRASLGPEAAVFPLG-VPAALEAMASRTQVVLNCVGPY   82 (382)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCCC-CHHHHHHHHHCCEEEEECCCCC
T ss_conf             8997465521589999999748864321688899988998509664446778-8899999974266899614661


No 335
>KOG1201 consensus
Probab=96.55  E-value=0.025  Score=32.77  Aligned_cols=186  Identities=14%  Similarity=0.098  Sum_probs=94.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHH----HHHHHCC-CEEEECCCCCCCHH------HHHHHCCCCEEE
Q ss_conf             3999888-8889999999998898899996794463----4556449-82898067864023------465411563278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNL----LTLKHKG-ISPFLFADQKINNL------LREKLYFTTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~----~~l~~~~-~~~~~~~~~~~~~~------~~~~~~~~~~v~   69 (289)
                      .+||||+ +=+|+.++.++.++|.++.....+.+..    ...+..| +..+..|..+.++.      +.+....++.++
T Consensus        40 ~vLITGgg~GlGr~ialefa~