HHsearch alignment for GI: 254780595 and conserved domain: pfam01370

>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=100.00  E-value=3.6e-39  Score=242.98  Aligned_cols=207  Identities=21%  Similarity=0.290  Sum_probs=154.4

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH-HHHCCCEEEECCCCCCCHHHHHHHC--CCCEEEEEECCCCCC
Q ss_conf             999888-888999999999889889999679446345-5644982898067864023465411--563278761244433
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT-LKHKGISPFLFADQKINNLLREKLY--FTTHIVQCIKPSSEG   78 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~v~~~~~~~~~~   78 (289)
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~dl~-~~~~~~~~~~~~~~D~VihlAa~~~~~   79 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLNTGRIRFRFHEGDLT-DPDALERLLAEVQPDAVIHLAAQSGVG   79 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCEEEEEECC-CHHHHHHHHHHCCCCEEEECCCCCCCH
T ss_conf             7997289799999999999787989999899730122211467659996588-999999998538998999897747832


Q ss_pred             ----CE-----EECCCCCHHHHH--HHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             ----10-----001221013443--2012334333320102576212345321123431134554455554320012345
Q gi|254780595|r   79 ----DP-----CIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN  147 (289)
Q Consensus        79 ----~~-----~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~  147 (289)
T Consensus        80 ~~~~~~~~~~~~N~~~t~~ll~~~~~~~~~~~I~~SS~~vYg~~~~~~~~E~~~~~p~~~Y~~sK~~~E~~~~~~~~~~~  159 (235)
T pfam01370        80 ASFEDPAEFIRANVLGTLNLLEAARRAGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYAAAKLAGERLVLAYARAYG  159 (235)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             65519999999999999999999998399989992563574799999977777889850799999999999999999848


Q ss_pred             CCCCCCCCCCCCCCCCC----------HHHHHHCCCC--CCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEEC
Q ss_conf             67642034777789850----------3444311345--43222110001024777799999995135-5786162
Q gi|254780595|r  148 IKLAVLRLSGIYGPKRN----------PFIKIRQKNS--LRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNL  210 (289)
Q Consensus       148 ~~~~ilR~~~iyGp~r~----------~~~~~~~g~~--~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni  210 (289)
T Consensus       160 ~~~~ilR~~~vyGp~~~~~~~~~~i~~~i~~~~~~~~~~~~~g~g~~~r~~i~v~D~~~ai~~~~~~~~~g~iyNI  235 (235)
T pfam01370       160 LRAVILRLFNVYGPGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVARAILLALEHPDGGEVYNI  235 (235)
T ss_pred             CCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCCEEECCCCHHHHHHHHHHHHCCCCCCCCEEC
T ss_conf             8986500125988998877621489999999982899727708999789179499999999999818999992429