BLAST/PSIBLAST alignment of GI: 254780595 and GI: 116250093 at iteration 1
>gi|116250093|ref|YP_765931.1| hypothetical protein RL0325 [Rhizobium leguminosarum bv. viciae 3841] Length = 289
>gi|115254741|emb|CAK05815.1| conserved hypothetical exported protein [Rhizobium leguminosarum bv. viciae 3841] Length = 289
 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 189/285 (66%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A    GV   GTTRS   +  L+ KGI  FLF  + +   LR+
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGDGVRVSGTTRSPDKMDMLRQKGIEAFLFDGESMEEGLRQ 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  + DP +  + KD  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 61  ALDSVTHLVQSIAPG-KADPLLRLLGKDGARLLPKLEWIGYLSTVGVYGDHQGAWVTEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  +T+R  AE+ WLA+ ++  +  AVLRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 PCLPVSGRSTERLEAEEGWLAMGRERGVPAAVLRLSGIYGPGRNAFSNLDKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 DQVFNRIRVEDIGAAARFLSERGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K+ GF   +PNY +SL QLW++
Sbjct: 240 TAELTPMARTFYGENKRVSNAKLKAAGFAFSFPNYPMSLAQLWRD 284