BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780595|ref|YP_003065008.1| nucleoside-diphosphate-sugar
epimerase protein [Candidatus Liberibacter asiaticus str. psy62]
         (289 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780595|ref|YP_003065008.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040272|gb|ACT57068.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 289

 Score =  603 bits (1555), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE
Sbjct: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS
Sbjct: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
           FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK
Sbjct: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD
Sbjct: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
           TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL
Sbjct: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289


>gi|315121795|ref|YP_004062284.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495197|gb|ADR51796.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 289

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/289 (75%), Positives = 259/289 (89%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHLMIFGAGY G+FIADAALK+G++T GTTRS SNL TLK+KGIS FLFA+QKIN+ L++
Sbjct: 1   MHLMIFGAGYAGQFIADAALKIGIHTSGTTRSESNLQTLKNKGISAFLFANQKINSTLQK 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KLY  TH+VQCIKP  E DPCI+SM ++ YKF+P++KWIGYLSSTS+YGNR GQWVDE +
Sbjct: 61  KLYSITHVVQCIKPEFESDPCILSMGEELYKFIPNIKWIGYLSSTSVYGNRAGQWVDEQT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +HPIS  ATQRF  EK+W++I KKL+IK+A+LRLSGIYGPKRNPFI I+QK S+RL+KK
Sbjct: 121 PIHPISYTATQRFEVEKKWISIAKKLDIKIAILRLSGIYGPKRNPFITIKQKKSVRLIKK 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+A+CVIFLM ++LGGIFN+SDDEP+PPQNVIMEAASLMK+ PPLEQ FD
Sbjct: 181 DQVFNRIRVEDIAQCVIFLMKNNLGGIFNVSDDEPSPPQNVIMEAASLMKVNPPLEQYFD 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
           TA +SP TR FYADNKRISNAKIKSLGF+LLYPNYRISLKQLW++ +N+
Sbjct: 241 TAKVSPITRLFYADNKRISNAKIKSLGFRLLYPNYRISLKQLWEDDKNI 289


>gi|222084590|ref|YP_002543119.1| nucleoside-diphosphate-sugar epimerase protein [Agrobacterium
           radiobacter K84]
 gi|221722038|gb|ACM25194.1| nucleoside-diphosphate-sugar epimerase protein [Agrobacterium
           radiobacter K84]
          Length = 298

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 185/283 (65%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A    GV   GTTRS      L  +G+  F+F  + ++  L E
Sbjct: 9   MHVMIFGCGYSGTVIAKAFAGSGVRITGTTRSADKADLLARQGVEAFVFDGETLDPALAE 68

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   TH++Q I P + GDP +     D    MP ++WIGYLS+  +YG+ +G W++E +
Sbjct: 69  AMKSATHLIQSIAPGTAGDPLLRLAHLDVATLMPKLEWIGYLSTVGVYGDHKGAWINEET 128

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +HP+S  + +R  AE  WL +  +L I +AVLRL+GIYGP RN F  + +  + RL+K 
Sbjct: 129 SLHPVSSRSVERVEAEDGWLRVGVRLGIPVAVLRLAGIYGPGRNAFSNLEKGTARRLIKA 188

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVED+  C  FL    LGGI+N++DDEP  PQ++I+EAA LM + PP EQ F+
Sbjct: 189 NQVFNRIRVEDIGACAKFLSDRRLGGIYNVTDDEPTAPQDIIVEAARLMGVEPPPEQPFE 248

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           TA ++P  R FY +NKR+SNAK++SLGF   YP YR+SL +LW
Sbjct: 249 TAELTPMARSFYGENKRVSNAKLRSLGFLFRYPEYRMSLAELW 291


>gi|116250093|ref|YP_765931.1| hypothetical protein RL0325 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254741|emb|CAK05815.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 289

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 189/285 (66%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A    GV   GTTRS   +  L+ KGI  FLF  + +   LR+
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGDGVRVSGTTRSPDKMDMLRQKGIEAFLFDGESMEEGLRQ 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  + DP +  + KD  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 61  ALDSVTHLVQSIAPG-KADPLLRLLGKDGARLLPKLEWIGYLSTVGVYGDHQGAWVTEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  +T+R  AE+ WLA+ ++  +  AVLRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 PCLPVSGRSTERLEAEEGWLAMGRERGVPAAVLRLSGIYGPGRNAFSNLDKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 DQVFNRIRVEDIGAAARFLSERGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K+ GF   +PNY +SL QLW++
Sbjct: 240 TAELTPMARTFYGENKRVSNAKLKAAGFAFSFPNYPMSLAQLWRD 284


>gi|86355964|ref|YP_467856.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli CFN 42]
 gi|86280066|gb|ABC89129.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli CFN 42]
          Length = 289

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 186/285 (65%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A    GV   GTTRS   L  L+  GI  FLF  + + + L  
Sbjct: 1   MHVMIFGCGYSGTAIAKAFASQGVRVSGTTRSAEKLEALRANGIEAFLFDGETMGDGLSR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  + DP +  + +D  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 61  ALESVTHLVQSIAPG-KADPLLQLLGEDSGRLLPRLEWIGYLSTVGVYGDHKGAWVTEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              PIS  + +R  AE+ WLA+ ++  +  AVLRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 RCLPISGRSKERLEAEQGWLALGQERGVPAAVLRLSGIYGPGRNAFCNLEKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 NQVFNRIRVEDIGAATRFLSARGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K  GF+L +P Y +SL QLW++
Sbjct: 240 TAELTPMARTFYGENKRVSNAKLKKAGFELSFPTYPMSLAQLWQD 284


>gi|209551885|ref|YP_002283802.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537641|gb|ACI57576.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 289

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 186/284 (65%), Gaps = 1/284 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG G++G  IA A    GV   GTTRS   +  L+  GI  FLF  + +++ LR 
Sbjct: 1   MHVMIFGCGFSGTAIARAFANDGVRISGTTRSADKMAALRQNGIEAFLFDGETVDDDLRR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  +GDP +  + +D       ++WIGYLS+  +YG+ +G W+DE +
Sbjct: 61  ALRSVTHLVQSIAPG-KGDPLLRLLDEDSASLPSSLEWIGYLSTVGVYGDHKGAWIDEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE  WLA+ +   +  AVLRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 PCVPVSGRSKERLEAEAGWLAMGEACGVPAAVLRLSGIYGPGRNAFCNLDKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL  H LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 DQVFNRIRVEDIGAAARFLSEHGLGGIYNITDDRPGPPQDVIVEAARLMGVAPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWK 284
           TA ++P  R FY +NKR+SNAK+K+ GF+  +P+Y +SL QLW+
Sbjct: 240 TAELTPMARSFYGENKRVSNAKLKAAGFEFSFPDYPMSLAQLWQ 283


>gi|241207262|ref|YP_002978358.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861152|gb|ACS58819.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 290

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/285 (47%), Positives = 185/285 (64%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A     V   GTTRS   +  L+  GI  FLF  + +   LR 
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGDDVRVSGTTRSPDKMEALRRNGIEAFLFDGESMEAGLRR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P    DP +  + KD  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 61  ALTGVTHLVQSIAPG-RADPLLRLLDKDGARLLPKLEWIGYLSTVGVYGDHQGAWVSEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  +T+R  AE+ WLA+ ++  +  AVLRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 PCLPVSGRSTERLEAEEGWLAMGRERGVPAAVLRLSGIYGPGRNAFCNLDKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 DQVFNRIRVEDIGASTRFLSERGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K+ GF   +PNY +SL QLW++
Sbjct: 240 TAELTPMARTFYGENKRVSNAKLKAAGFAFSFPNYPMSLAQLWRD 284


>gi|222147272|ref|YP_002548229.1| hypothetical protein Avi_0339 [Agrobacterium vitis S4]
 gi|221734262|gb|ACM35225.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 298

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 183/283 (64%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M LMIFGAGY+GK I    ++ G+   GTTRS +    L   GI P +F  Q++++ + +
Sbjct: 9   MRLMIFGAGYSGKAIGQHFIQQGIPVSGTTRSPAKAKALSDLGIEPLVFDGQRLSDEIIQ 68

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   TH+VQ I P S+GDP +         +MP V+W+ YLS+  +YG+ +G WVDE +
Sbjct: 69  AMACATHVVQSIAPGSDGDPLLRLTQGALKTWMPKVQWLAYLSTVGVYGDHQGAWVDEDT 128

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W        + L+ LRLSGIYGP RN  + + +  + RLVKK
Sbjct: 129 VCKPVSVRSKERVEAEQAWGRAALAAGVPLSTLRLSGIYGPGRNGLVNMAEGTARRLVKK 188

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+A    FL   +  GIFN++D EPAPPQ+V+ EAA LM++ PP EQ F+
Sbjct: 189 DQVFNRIRVEDIAAATWFLAGRNEQGIFNITDHEPAPPQDVVAEAARLMEVEPPPEQAFE 248

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           TA +SP  R FY +NKR+ NAK+++LGF   YP+YR+SL QLW
Sbjct: 249 TAELSPMARSFYGENKRVMNAKVRALGFAFAYPDYRVSLSQLW 291


>gi|190889975|ref|YP_001976517.1| nucleoside-diphosphate-sugar epimerase [Rhizobium etli CIAT 652]
 gi|190695254|gb|ACE89339.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli CIAT 652]
          Length = 289

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 133/285 (46%), Positives = 186/285 (65%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A     V   GTTRS   +  L+  GI  FLF  + + + L  
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGQDVQVSGTTRSAEKVEALRANGIEAFLFDGETMGDRLSR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  + DP +  + +D  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 61  ALVDVTHLVQSIAPG-KADPLLRLLGEDSARLLPRLEWIGYLSTVGVYGDHKGAWVSEET 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ WLAI ++ ++  A+LRLSGIYGP RN F  + +  + RL+KK
Sbjct: 120 PCLPVSGRSKERLEAEEGWLAIGRERDVPAAILRLSGIYGPGRNAFCNLDKGTARRLIKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL  H LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 180 DQVFNRIRVEDIGAATRFLSEHGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 239

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K  GF+  +P Y +SL QLW++
Sbjct: 240 TAELTPMARTFYGENKRVSNAKLKKAGFEFSFPTYPMSLAQLWQD 284


>gi|327192011|gb|EGE58992.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli CNPAF512]
          Length = 286

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/282 (46%), Positives = 183/282 (64%), Gaps = 1/282 (0%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           MIFG GY+G  IA A    GV   GTTRS   +  L+  GI  FLF  + + + LR  L 
Sbjct: 1   MIFGCGYSGTAIAKAFAGDGVRISGTTRSADKIEALRRNGIEAFLFDGETMEDGLRRALA 60

Query: 64  FTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVH 123
             TH+VQ I P  + DP +  +  D     P ++WIGYLS+  +YG+ +G W++E +   
Sbjct: 61  DVTHLVQSIAPG-KADPLLRLLGGDGASLPPWLEWIGYLSTVGVYGDHKGAWINEETPCM 119

Query: 124 PISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQV 183
           P+S  + +R  AE+ WLA+ ++  +  AVLRLSGIYGP RN F  + +  + RL+KK+QV
Sbjct: 120 PVSGRSKERLEAEEGWLAMGRERGVPAAVLRLSGIYGPGRNAFCNLEKGTARRLIKKDQV 179

Query: 184 FNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTAN 243
           FNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+TA 
Sbjct: 180 FNRIRVEDIGAATRFLSDQRLGGIYNITDDRPGPPQDVILEAARLMGVEPPPEQAFETAE 239

Query: 244 ISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           ++P  R FY +NKR+SNAK+K+ GF+  +PNY +SL QLW++
Sbjct: 240 LTPMARSFYGENKRVSNAKLKAAGFEFSFPNYPMSLAQLWQD 281


>gi|15964078|ref|NP_384431.1| hypothetical protein SMc00405 [Sinorhizobium meliloti 1021]
 gi|307301222|ref|ZP_07580984.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti BL225C]
 gi|307317893|ref|ZP_07597330.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti AK83]
 gi|15073254|emb|CAC41762.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896295|gb|EFN27044.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti AK83]
 gi|306903678|gb|EFN34265.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti BL225C]
          Length = 291

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 126/283 (44%), Positives = 184/283 (65%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+++I GAGY+G  IA A   + +   GTTR+   L  L+  GI P LF   +I++ L++
Sbjct: 1   MNVLILGAGYSGTAIASALAPLAMSVSGTTRAAEKLGRLQAAGIRPILFDGAEISDELKD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  TTH+VQ I P  +GDP   + +    + +P ++W+GYLS+  +YG+  G WV E +
Sbjct: 61  VMRETTHLVQSIAPGRDGDPMFRAGTPPLAELLPRLEWVGYLSTVGVYGDHGGAWVTEDT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            ++P+S  + +R  AE  WL    +  I +AVLRL+GIYGP RN F  + +  + R++K 
Sbjct: 121 PLNPVSQRSLERVEAENAWLEHGAQRGIPVAVLRLAGIYGPGRNAFRNLSEGTARRVIKP 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVED+      L    +GG+FN++DDEPAPPQ+V+ EAA LM + PP E  F+
Sbjct: 181 NQVFNRIRVEDIGAATALLAKRGVGGVFNVTDDEPAPPQDVVQEAARLMGVEPPPEIPFE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           TA++SP  R FY +NKR+SNA+++  GF   +PNYR+SL QLW
Sbjct: 241 TADMSPMARSFYGENKRVSNARLRQAGFDPDFPNYRVSLAQLW 283


>gi|227824164|ref|YP_002828137.1| putative NAD-dependent epimerase/dehydratase [Sinorhizobium fredii
           NGR234]
 gi|227343166|gb|ACP27384.1| putative NAD-dependent epimerase/dehydratase [Sinorhizobium fredii
           NGR234]
          Length = 299

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 178/283 (62%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH++I GAGY+G  IA A         GTTRS   L TLK  GI P LF    I+  L E
Sbjct: 9   MHVLILGAGYSGTAIAKAFAPAAQSVTGTTRSPEKLATLKAAGIEPLLFDGNAISADLAE 68

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  TTH+VQ I P  EGDP   + +    + +P+++W+GYLS+  +YG+  G WV E +
Sbjct: 69  AMRKTTHLVQSIAPGREGDPMFRAGTPPLERLLPNLRWVGYLSTVGVYGDHGGGWVSEET 128

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            + P+S  + +R  AE  WL     L I +AVLRL+GIYGP RN F  + +  + R+VK 
Sbjct: 129 PLKPVSQRSVERVEAENAWLDHGASLGIPVAVLRLAGIYGPGRNAFRNLTEGTARRVVKP 188

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVED+     FL    +GGIFN++DDEP PPQ+V+ EAA LM + PP E  F+
Sbjct: 189 NQVFNRIRVEDIGAAAAFLAGRGMGGIFNVTDDEPGPPQDVVAEAARLMGVEPPPEIPFE 248

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           +A +S   R FY +NKR+SN +++  GF+  +PNYR+SL QLW
Sbjct: 249 SAEMSSMARSFYGENKRVSNTRLRRAGFEFAFPNYRVSLAQLW 291


>gi|325291725|ref|YP_004277589.1| nucleoside-diphosphate-sugar epimerase protein [Agrobacterium sp.
           H13-3]
 gi|325059578|gb|ADY63269.1| putative nucleoside-diphosphate-sugar epimerase protein
           [Agrobacterium sp. H13-3]
          Length = 290

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 133/284 (46%), Positives = 186/284 (65%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFGAGY+GK IA+A         GTTRS     +L   G++PFLF    +N+ L  
Sbjct: 1   MHVMIFGAGYSGKAIANALKTEAATISGTTRSTDKFASLAATGMTPFLFDGAHLNDDLIA 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   T++VQ I P  +GDP +  +  D  + +P ++WI YLS+  +YG+ +G WVDE +
Sbjct: 61  TMANVTNLVQSIAPGKDGDPLLALLGDDLKRLLPKLEWIAYLSTVGVYGDHDGAWVDEET 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE  W A  +K  + LA+LRLSGIYGP RN F+   +  + RLVKK
Sbjct: 121 PCRPVSARSVERVAAETAWAAAAEKAGVPLAILRLSGIYGPGRNSFMNFEKGTARRLVKK 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL   +  G+FN++DDEPAPPQ+V+  AA+LM + PP EQ F+
Sbjct: 181 DQVFNRIRVEDIGAAHAFLARRNERGVFNVTDDEPAPPQDVVSFAATLMGVEPPPEQAFE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWK 284
           TA+++P  R FY +NKR+SNA+I+ LGF   +P Y+ISL QLW+
Sbjct: 241 TADLTPMARSFYGENKRVSNARIRGLGFDFSFPEYKISLTQLWE 284


>gi|150398717|ref|YP_001329184.1| NAD-dependent epimerase/dehydratase [Sinorhizobium medicae WSM419]
 gi|150030232|gb|ABR62349.1| NAD-dependent epimerase/dehydratase [Sinorhizobium medicae WSM419]
          Length = 291

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 181/283 (63%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+++I GAGY+G  IA A   +     GTTRS   L  L+  GI P LF   +I++ L++
Sbjct: 1   MNVLILGAGYSGTAIASALAPLAKSVTGTTRSAEKLGRLQDAGIRPILFDGAEISDELKD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  TTH+VQ I P  EGDP   + +    + MP ++W+ YLS+  +YG+  G WV E +
Sbjct: 61  AMRDTTHLVQSIAPGREGDPMFRAGTAPLTELMPRLEWVCYLSTVGVYGDHGGAWVTEDT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            ++P+S  + +R  AE  WL    +  + +AVLRL+GIYGP RN F  + +  + R++K 
Sbjct: 121 PLNPVSQRSLERVEAEGAWLEHGARRGVPVAVLRLAGIYGPGRNAFRNLSEGTARRIIKP 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRIRVED+     FL    +GG+FN++D+EPAPPQ+V+ EAA LM I PP E  F+
Sbjct: 181 NQVFNRIRVEDIGAASAFLAARGMGGVFNVTDNEPAPPQDVVEEAARLMGIEPPPEIPFE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           TA +S   R FY +NKR+SNA+++  GF   +PNYR+SL QLW
Sbjct: 241 TAEMSAMARTFYGENKRVSNARLRQAGFDPAFPNYRVSLAQLW 283


>gi|15887640|ref|NP_353321.1| hypothetical protein Atu0291 [Agrobacterium tumefaciens str. C58]
 gi|15155189|gb|AAK86106.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 290

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 181/284 (63%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFGAGY+GK IA+A        CGTTRS      L   G++P LF    +++ L  
Sbjct: 1   MHVMIFGAGYSGKAIANALKTKAASVCGTTRSADKFANLAAAGMTPLLFDGVHLDDDLIA 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   TH+VQ I P  +GDP    +  D  K +P++KW+ YLS+  +YG+  G WV+E +
Sbjct: 61  AMRNVTHLVQSIAPGKDGDPLFALLGGDLKKLLPNLKWLAYLSTVGVYGDHHGAWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE  W    +  ++ L++LRLSGIYGP RN F+   +  + RLVKK
Sbjct: 121 PCRPVSARSVERVAAEAAWTEAAQSADVPLSILRLSGIYGPGRNTFMNFEKGTARRLVKK 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+   + FL   +  GIFN++DDEP PPQ+V+  AA LM + PP EQ F 
Sbjct: 181 DQVFNRIRVEDIGAAIAFLALKNERGIFNVTDDEPCPPQDVVSFAADLMGVVPPAEQDFG 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWK 284
           TA+++P  R FY +NKR+SNAKI+ LGF   +P YR SLKQLW+
Sbjct: 241 TADLTPMARSFYGENKRVSNAKIRELGFDFRFPEYRQSLKQLWE 284


>gi|218516652|ref|ZP_03513492.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli 8C-3]
          Length = 297

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 179/285 (62%), Gaps = 1/285 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A     V   GTTRS   +  L+  GI  FLF  + + + L  
Sbjct: 9   MHVMIFGCGYSGTAIAKAFAGQDVQVSGTTRSAEKVEALRANGIEAFLFDGETMGDRLSR 68

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH+VQ I P  + DP +  + +D  + +P ++WIGYLS+  +YG+ +G WV E +
Sbjct: 69  ALVDVTHLVQSIAPG-KADPLLRLLGEDSARLLPRLEWIGYLSTVGVYGDHKGAWVSEET 127

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ WLAI ++ ++  A+LRLS          ++ RQ +   L+KK
Sbjct: 128 PCLPVSGRSKERLEAEEGWLAIGRERDVPAAILRLSRHLRAGAQRVLQSRQGHGAALIKK 187

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           +QVFNRIRVED+     FL  H LGGI+N++DD P PPQ+VI+EAA LM + PP EQ F+
Sbjct: 188 DQVFNRIRVEDIGAATRFLSEHGLGGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFE 247

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA ++P  R FY +NKR+SNAK+K  GF+  +P Y +SL QLW++
Sbjct: 248 TAELTPMARTFYGENKRVSNAKLKKAGFEFSFPTYPMSLAQLWQD 292


>gi|218681791|ref|ZP_03529542.1| NAD-dependent epimerase/dehydratase [Rhizobium etli CIAT 894]
          Length = 262

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 117/257 (45%), Positives = 169/257 (65%), Gaps = 1/257 (0%)

Query: 28  GTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSK 87
           GTTRS   +  L   GI  +LF  + ++  L + L   TH+VQ I P  + DP +  + +
Sbjct: 1   GTTRSAEKMDALGQAGIEAYLFDGETLDEGLIQALADVTHLVQSIAPG-KADPLLRLLGE 59

Query: 88  DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN 147
           D    +P ++WIGYLS+  +YG+ +G W+DE +   P+S  + +R  AE  WLA  ++  
Sbjct: 60  DSASLLPSLEWIGYLSTVGVYGDHKGAWIDEETPCVPVSARSKERLEAEAGWLATGRQRG 119

Query: 148 IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI 207
           +  AVLRLSGIYGP RN F  + +  + RL+KK+QVFNRIRVED+     FL  H LGG+
Sbjct: 120 VPAAVLRLSGIYGPGRNAFCNLEKGTARRLIKKDQVFNRIRVEDIGAATRFLSDHSLGGL 179

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           +N++D+ P PPQ+VI+EAA LM + PP EQ F+TA ++P  R FY +NKR+SNAK+K+ G
Sbjct: 180 YNITDNRPGPPQDVIVEAARLMGVEPPPEQAFETAELTPMARSFYGENKRVSNAKLKAAG 239

Query: 268 FQLLYPNYRISLKQLWK 284
           F+  +P+Y +SL QLW+
Sbjct: 240 FEFSFPDYPMSLAQLWQ 256


>gi|13473892|ref|NP_105460.1| hypothetical protein mlr4637 [Mesorhizobium loti MAFF303099]
 gi|14024643|dbj|BAB51246.1| mlr4637 [Mesorhizobium loti MAFF303099]
          Length = 299

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/282 (43%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++IFGAGY+GK  A A  +      GTTRS      L+  GI+P LF D  +   + E 
Sbjct: 5   QILIFGAGYSGKAFARAN-RDAATILGTTRSREKFAALRQAGITPLLF-DGALTGEIGEA 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  TTH+V  + P   GDP +++ +++    MP ++WIGYLS+  +YG+  G WVDE + 
Sbjct: 63  LQKTTHLVISVAPEEAGDP-VLNAAREAIAGMPALEWIGYLSTVGVYGDHGGAWVDETAA 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P+S  +  R  AE+ WL + K++   +A+LRLSGIYGP RN  + +    + RLVK +
Sbjct: 122 CRPVSKRSVMRVEAEQAWLKLGKEIGKPVAILRLSGIYGPGRNALVNLENGTARRLVKPD 181

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           QVFNRI  +D+A  +  L+  + GGIFN++DDEPAPPQ+V+  AASLM + PP E  FDT
Sbjct: 182 QVFNRIHCDDIAGALWQLIDGNTGGIFNVTDDEPAPPQDVVAYAASLMGVEPPPEIPFDT 241

Query: 242 ANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           A +SP  R FY +NKR++NA IK+ G+ L +P+YR +   +W
Sbjct: 242 AQLSPMARSFYGENKRVANAAIKAAGYSLRFPDYRAAFDHMW 283


>gi|163757557|ref|ZP_02164646.1| hypothetical protein HPDFL43_19142 [Hoeflea phototrophica DFL-43]
 gi|162285059|gb|EDQ35341.1| hypothetical protein HPDFL43_19142 [Hoeflea phototrophica DFL-43]
          Length = 290

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 172/285 (60%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M LMIFGAG++G  IA A      +  GTTRS+     L+  G++P ++     +  LR 
Sbjct: 1   MRLMIFGAGFSGLAIARALAGDCDFAGGTTRSMERFAKLEAAGLTPLIYQGGAPDGDLRT 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   TH+V  I P +EGDP + + +      +P ++W GYLS+  +YG+  G WVDE +
Sbjct: 61  HMAGITHLVMSIAPDAEGDPLLAAFADGLKNHLPALEWAGYLSTVGVYGDHGGDWVDEET 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  +  R  AE+ W  +    ++ LAVLRLSGIYGP RN    +    + RL+K 
Sbjct: 121 ICKPVSKRSIARVEAEQGWQELALAADVPLAVLRLSGIYGPGRNALKTLDAGKARRLIKP 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI V D+      L  ++LGG+FN++DD PAPPQ+V+  AA LM + PP E  F+
Sbjct: 181 GQVFNRIHVADIGGATTLLARNNLGGVFNVTDDMPAPPQDVVAHAADLMGVAPPPETDFE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           TA+++P  R FY +NKR++N++IK+ G++  YP+Y   L  LW++
Sbjct: 241 TADLTPMARSFYGENKRVANSRIKAAGYRFTYPDYMEGLGALWRD 285


>gi|260463456|ref|ZP_05811656.1| NAD-dependent epimerase/dehydratase [Mesorhizobium opportunistum
           WSM2075]
 gi|259030781|gb|EEW32057.1| NAD-dependent epimerase/dehydratase [Mesorhizobium opportunistum
           WSM2075]
          Length = 299

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 123/284 (43%), Positives = 178/284 (62%), Gaps = 3/284 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++IFGAGY+GK  A A  K      GTTRS      L+  GI P LF D  +   + E 
Sbjct: 5   QVLIFGAGYSGKAFARAN-KDATAIVGTTRSEEKFEALRQAGIEPLLF-DGALTAEVGEA 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  TTH+V  + P   GDP +++ ++     MP ++WIGYLS+  +YG+  G WVDE + 
Sbjct: 63  LKKTTHLVVSVAPDDAGDP-VLNAARATIARMPALEWIGYLSTVGVYGDYGGAWVDETAE 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P+S  +  R  AE++WL + + ++  +A+LRLSGIYGP RN  + +    + RLVK +
Sbjct: 122 CRPVSKRSVMRVAAEQDWLKLGRDIDRPVAILRLSGIYGPGRNALVNLENGTARRLVKPD 181

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           QVFNRI  +D+A  +  L+  + GGIFN++DDEPAPPQ+V+  AASLM + PP E  FDT
Sbjct: 182 QVFNRIHCDDIAGALWQLIGSNKGGIFNVTDDEPAPPQDVVAYAASLMGVEPPPEIPFDT 241

Query: 242 ANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           A +SP  R FY +NKR++NA IK+ G++  +P+YR +   +W +
Sbjct: 242 AQLSPLARSFYGENKRVANAAIKATGYRFRFPDYRTAFDHMWAD 285


>gi|153008667|ref|YP_001369882.1| NAD-dependent epimerase/dehydratase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560555|gb|ABS14053.1| NAD-dependent epimerase/dehydratase [Ochrobactrum anthropi ATCC
           49188]
          Length = 289

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 114/285 (40%), Positives = 175/285 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + +FGAGY+ +  A           GTTR       L+  GI P LF  +  +  L +
Sbjct: 1   MRVFLFGAGYSAQAFAQRMTGEAERIDGTTRHEQKFPLLEKAGIKPMLFDGETPSPDLLD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           +L  +TH+V  I P   GDP +  + +   +    ++WIGYLS+  +YG+ +GQWVDE +
Sbjct: 61  RLAQSTHVVVSISPGESGDPAVAVVEEALRRPDNTIRWIGYLSTVGVYGDHQGQWVDETA 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P S  + +R  AE+ W  ++++    LA+LRLSGIYGP RN FI + +  + R++K 
Sbjct: 121 PCKPASRRSLERVEAEEAWGQLSERHGTPLAILRLSGIYGPGRNAFINLERGTARRIIKD 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQVFNRI V+D+A  + FL   + GGIFN++D+EP+PPQ+V+  AA LM +TPP E  F 
Sbjct: 181 NQVFNRIHVDDIAGSLRFLAGTNTGGIFNITDNEPSPPQDVVTYAAELMGMTPPPEVPFA 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
            A+++P  R FY +NKR+SN +I+ LG++  YP+Y+ +   +W++
Sbjct: 241 EADMTPMARSFYGENKRVSNQRIRGLGYEFAYPDYKTAFSAMWRD 285


>gi|319780499|ref|YP_004139975.1| NAD-dependent epimerase/dehydratase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166387|gb|ADV09925.1| NAD-dependent epimerase/dehydratase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 299

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + IFGAGY+G+  A A  K      GTTRS     TL+  GI+P LF D  + + + + 
Sbjct: 5   QIFIFGAGYSGRAFARAN-KGAATIFGTTRSPEKFETLRQAGIAPLLF-DGALTDEIGDA 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  TTH++  + P   GDP ++  +++    MP ++WIGYLS+  +YGN +G WVDE + 
Sbjct: 63  LRKTTHLLISVAPEEAGDP-VLGAAREAIAQMPLLEWIGYLSTVGVYGNYDGAWVDETAE 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P+S  +  R  AE++WL + +++   +A+LRLSGIYGP RN  + +   ++ RLVK +
Sbjct: 122 CRPVSKRSMMRVAAEQDWLELGREIRRPVAILRLSGIYGPGRNALVNLENGSARRLVKPD 181

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           QVFNRI  +D+A  +  L+  + GGIFN++DD PA PQ+V+  AASLM I PP E  FD 
Sbjct: 182 QVFNRIHCDDIAGSLWQLIQGNKGGIFNVTDDLPAAPQDVVAYAASLMGIEPPPEIPFDA 241

Query: 242 ANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           A +SP  R FY +NKR+ NA IK+ G+ L +P+YR +   +W
Sbjct: 242 AQLSPMARSFYGENKRVGNAAIKAAGYSLRFPDYRAAFDHMW 283


>gi|239832670|ref|ZP_04680999.1| NAD-dependent epimerase/dehydratase [Ochrobactrum intermedium LMG
           3301]
 gi|239824937|gb|EEQ96505.1| NAD-dependent epimerase/dehydratase [Ochrobactrum intermedium LMG
           3301]
          Length = 296

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 174/285 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + +FGAG++ +  A           GTTR       L+  GI P LF  Q  +  L +
Sbjct: 8   MRIFLFGAGFSAQAFARRMTGEAERIDGTTRHEQKFPLLEQAGIKPLLFDGQTPSPELLD 67

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           +L  +TH++  I P   GDP +  + +   +    ++WIGYLS+  +YG+ +G WVDE +
Sbjct: 68  RLAQSTHVLISISPGESGDPAVAIVEEALRRSDNTIRWIGYLSTVGVYGDHQGAWVDETT 127

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P S    +R  AEK W  ++++    LA+LRLSGIYGP RN F+ +++  + R++K+
Sbjct: 128 ACKPSSRRNLERVEAEKAWGQLSERHGTPLAILRLSGIYGPGRNAFVNLKRGTARRVIKE 187

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           NQ+FNRI V D+A  + FL     GGIFN++D+EP+PPQ+V+  AA LM +TPP E  F+
Sbjct: 188 NQIFNRIHVGDIAGSLRFLAGTDTGGIFNITDNEPSPPQDVVTYAAELMGVTPPPEVAFE 247

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
            A+++P  R FY +NKR+SN +I+ LG++  YP+YR +   +W++
Sbjct: 248 DADLTPMARSFYGENKRVSNRRIRDLGYEFAYPDYRTAFSAMWRD 292


>gi|304393853|ref|ZP_07375778.1| NAD-dependent epimerase/dehydratase [Ahrensia sp. R2A130]
 gi|303294052|gb|EFL88427.1| NAD-dependent epimerase/dehydratase [Ahrensia sp. R2A130]
          Length = 305

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 178/296 (60%), Gaps = 11/296 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + IFGAG++GK I       G    GTTR      TL+  GI+P +F    + + LRE
Sbjct: 1   MSIGIFGAGFSGKAIGKRLADAGHDVWGTTRKADGFETLRAHGIAPTIFDGMDLTDDLRE 60

Query: 61  KLYFTTHIVQCIKPSSEG---------DPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGN 110
           +L  TT++V  I P  E          DP +I++  +    + P ++W+GYLS+  +YGN
Sbjct: 61  RLADTTNLVISIAPPREENLTDPDAPVDPVLIALEDETLAILAPKLQWVGYLSTVGVYGN 120

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
            +G W+DE + + P S  + QR  AE EWL +    ++ +AV+RLSGIYGP RN      
Sbjct: 121 HDGAWIDEDAPLAPTSARSRQRVRAEGEWLTVGAAHDLPVAVMRLSGIYGPGRNGLKTAA 180

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
           +  S RLVKK+QVFNRI   D+A  V   +T + GGIFN++DDEPAPPQ+V+  A  L+ 
Sbjct: 181 EGRSRRLVKKDQVFNRIHNHDIAAAVEAAITENTGGIFNITDDEPAPPQDVVSFAHKLLG 240

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
             PP E  F+TA++SP  R FY +NKR+SNA+ K+ LG    YP+YR +L ++ K+
Sbjct: 241 TPPPPELDFETADLSPMARSFYGENKRVSNARSKAVLGMAYAYPDYRTALSKMHKQ 296


>gi|256015805|ref|YP_003105814.1| hypothetical protein BMI_II1040 [Brucella microti CCM 4915]
 gi|255998465|gb|ACU50152.1| hypothetical protein BMI_II1040 [Brucella microti CCM 4915]
          Length = 289

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 176/283 (62%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL+ ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLFRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|306846247|ref|ZP_07478809.1| NAD-dependent epimerase/dehydratase [Brucella sp. BO1]
 gi|306273498|gb|EFM55359.1| NAD-dependent epimerase/dehydratase [Brucella sp. BO1]
          Length = 289

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 175/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  +THIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLARSTHIVISISPNESGDPAVAVVEEALCRPDNTIRWIGYLSTVGVYGDHQGEWVNETA 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKALGYEFTYPDYKTAFSAMW 283


>gi|256058795|ref|ZP_05449011.1| NAD-dependent epimerase/dehydratase [Brucella neotomae 5K33]
 gi|261322733|ref|ZP_05961930.1| NAD-dependent epimerase/dehydratase [Brucella neotomae 5K33]
 gi|261298713|gb|EEY02210.1| NAD-dependent epimerase/dehydratase [Brucella neotomae 5K33]
          Length = 289

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 176/283 (62%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+  + LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSPERVKAEEAWTQLSKRHGMPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|294853997|ref|ZP_06794669.1| nucleoside-diphosphate-sugar epimerase [Brucella sp. NVSL 07-0026]
 gi|294819652|gb|EFG36652.1| nucleoside-diphosphate-sugar epimerase [Brucella sp. NVSL 07-0026]
          Length = 289

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 178/284 (62%), Gaps = 2/284 (0%)

Query: 1   MHLMIFGAGY-TGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M++ +FGAGY T  F+   A + G    GTTR       L+  GI+P LF  +  +  L 
Sbjct: 1   MNIFLFGAGYSTQAFVRRMAGEAGRID-GTTRHEQKFPLLEAAGIAPILFDGETPSPELL 59

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           EKL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E 
Sbjct: 60  EKLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNET 119

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +   P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK
Sbjct: 120 TACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVK 179

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
             QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM ITPP    +
Sbjct: 180 AGQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGITPPPALPY 239

Query: 240 DTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
           + A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 240 EEADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|23500768|ref|NP_700208.1| hypothetical protein BRA1046 [Brucella suis 1330]
 gi|62317873|ref|YP_223726.1| hypothetical protein BruAb2_0986 [Brucella abortus bv. 1 str.
           9-941]
 gi|83269851|ref|YP_419142.1| kinesin, motor region [Brucella melitensis biovar Abortus 2308]
 gi|163845159|ref|YP_001622814.1| hypothetical protein BSUIS_B1041 [Brucella suis ATCC 23445]
 gi|189023123|ref|YP_001932864.1| Kinesin, motor region [Brucella abortus S19]
 gi|225686800|ref|YP_002734772.1| NAD-dependent epimerase/dehydratase [Brucella melitensis ATCC
           23457]
 gi|254690641|ref|ZP_05153895.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 6 str.
           870]
 gi|254696055|ref|ZP_05157883.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254699163|ref|ZP_05160991.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700239|ref|ZP_05162067.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 5 str. 513]
 gi|254705498|ref|ZP_05167326.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M163/99/10]
 gi|254710730|ref|ZP_05172541.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis B2/94]
 gi|254712800|ref|ZP_05174611.1| NAD-dependent epimerase/dehydratase [Brucella ceti M644/93/1]
 gi|254715869|ref|ZP_05177680.1| NAD-dependent epimerase/dehydratase [Brucella ceti M13/05/1]
 gi|254732607|ref|ZP_05191185.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 4 str.
           292]
 gi|256029112|ref|ZP_05442726.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M292/94/1]
 gi|256043912|ref|ZP_05446830.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256111022|ref|ZP_05452084.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256255822|ref|ZP_05461358.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 9 str.
           C68]
 gi|256262066|ref|ZP_05464598.1| kinesin [Brucella melitensis bv. 2 str. 63/9]
 gi|260167796|ref|ZP_05754607.1| NAD-dependent epimerase/dehydratase [Brucella sp. F5/99]
 gi|260545107|ref|ZP_05820928.1| kinesin [Brucella abortus NCTC 8038]
 gi|260565088|ref|ZP_05835573.1| kinesin [Brucella melitensis bv. 1 str. 16M]
 gi|260756212|ref|ZP_05868560.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 6 str.
           870]
 gi|260760419|ref|ZP_05872767.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 4 str.
           292]
 gi|260763659|ref|ZP_05875991.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882036|ref|ZP_05893650.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 9 str.
           C68]
 gi|261216486|ref|ZP_05930767.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261217630|ref|ZP_05931911.1| NAD-dependent epimerase/dehydratase [Brucella ceti M13/05/1]
 gi|261312903|ref|ZP_05952100.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M163/99/10]
 gi|261318298|ref|ZP_05957495.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis B2/94]
 gi|261320507|ref|ZP_05959704.1| NAD-dependent epimerase/dehydratase [Brucella ceti M644/93/1]
 gi|261750734|ref|ZP_05994443.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 5 str. 513]
 gi|261757232|ref|ZP_06000941.1| kinesin [Brucella sp. F5/99]
 gi|265986096|ref|ZP_06098653.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M292/94/1]
 gi|265990333|ref|ZP_06102890.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992558|ref|ZP_06105115.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297249193|ref|ZP_06932894.1| hypothetical protein BAYG_01930 [Brucella abortus bv. 5 str. B3196]
 gi|23464424|gb|AAN34213.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62198066|gb|AAX76365.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82940125|emb|CAJ13173.1| Kinesin, motor region [Brucella melitensis biovar Abortus 2308]
 gi|163675882|gb|ABY39992.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021697|gb|ACD74418.1| Kinesin, motor region [Brucella abortus S19]
 gi|225642905|gb|ACO02818.1| NAD-dependent epimerase/dehydratase [Brucella melitensis ATCC
           23457]
 gi|260098378|gb|EEW82252.1| kinesin [Brucella abortus NCTC 8038]
 gi|260152731|gb|EEW87824.1| kinesin [Brucella melitensis bv. 1 str. 16M]
 gi|260670737|gb|EEX57677.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 4 str.
           292]
 gi|260674080|gb|EEX60901.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676320|gb|EEX63141.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 6 str.
           870]
 gi|260871564|gb|EEX78633.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 9 str.
           C68]
 gi|260918093|gb|EEX84954.1| NAD-dependent epimerase/dehydratase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260922719|gb|EEX89287.1| NAD-dependent epimerase/dehydratase [Brucella ceti M13/05/1]
 gi|261293197|gb|EEX96693.1| NAD-dependent epimerase/dehydratase [Brucella ceti M644/93/1]
 gi|261297521|gb|EEY01018.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis B2/94]
 gi|261301929|gb|EEY05426.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M163/99/10]
 gi|261737216|gb|EEY25212.1| kinesin [Brucella sp. F5/99]
 gi|261740487|gb|EEY28413.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 5 str. 513]
 gi|262763428|gb|EEZ09460.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001002|gb|EEZ13692.1| NAD-dependent epimerase/dehydratase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091756|gb|EEZ16087.1| kinesin [Brucella melitensis bv. 2 str. 63/9]
 gi|264658293|gb|EEZ28554.1| NAD-dependent epimerase/dehydratase [Brucella pinnipedialis
           M292/94/1]
 gi|297173062|gb|EFH32426.1| hypothetical protein BAYG_01930 [Brucella abortus bv. 5 str. B3196]
 gi|326411207|gb|ADZ68271.1| Kinesin, motor region [Brucella melitensis M28]
 gi|326554498|gb|ADZ89137.1| Kinesin, motor region [Brucella melitensis M5-90]
          Length = 289

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 175/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|161621094|ref|YP_001594980.1| NAD-dependent epimerase/dehydratase [Brucella canis ATCC 23365]
 gi|254703361|ref|ZP_05165189.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 3 str. 686]
 gi|260567710|ref|ZP_05838179.1| kinesin [Brucella suis bv. 4 str. 40]
 gi|261753989|ref|ZP_05997698.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 3 str. 686]
 gi|161337905|gb|ABX64209.1| NAD-dependent epimerase/dehydratase [Brucella canis ATCC 23365]
 gi|260154375|gb|EEW89456.1| kinesin [Brucella suis bv. 4 str. 40]
 gi|261743742|gb|EEY31668.1| NAD-dependent epimerase/dehydratase [Brucella suis bv. 3 str. 686]
          Length = 289

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 175/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEETWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|256157304|ref|ZP_05455222.1| NAD-dependent epimerase/dehydratase [Brucella ceti M490/95/1]
 gi|256253719|ref|ZP_05459255.1| NAD-dependent epimerase/dehydratase [Brucella ceti B1/94]
 gi|261220854|ref|ZP_05935135.1| NAD-dependent epimerase/dehydratase [Brucella ceti B1/94]
 gi|265995790|ref|ZP_06108347.1| NAD-dependent epimerase/dehydratase [Brucella ceti M490/95/1]
 gi|260919438|gb|EEX86091.1| NAD-dependent epimerase/dehydratase [Brucella ceti B1/94]
 gi|262550087|gb|EEZ06248.1| NAD-dependent epimerase/dehydratase [Brucella ceti M490/95/1]
          Length = 289

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 175/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPIARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|17988598|ref|NP_541231.1| nucleoside-diphosphate-sugar epimerase [Brucella melitensis bv. 1
           str. 16M]
 gi|225629495|ref|ZP_03787528.1| nucleoside-diphosphate-sugar epimerase [Brucella ceti str. Cudo]
 gi|17984399|gb|AAL53495.1| nucleoside-diphosphate-sugar epimerase [Brucella melitensis bv. 1
           str. 16M]
 gi|225615991|gb|EEH13040.1| nucleoside-diphosphate-sugar epimerase [Brucella ceti str. Cudo]
          Length = 303

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 175/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 15  MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 74

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 75  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 134

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 135 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 194

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 195 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 254

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 255 EADMTPMARSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 297


>gi|254719854|ref|ZP_05181665.1| NAD-dependent epimerase/dehydratase [Brucella sp. 83/13]
 gi|265984870|ref|ZP_06097605.1| NAD-dependent epimerase/dehydratase [Brucella sp. 83/13]
 gi|306837556|ref|ZP_07470428.1| NAD-dependent epimerase/dehydratase [Brucella sp. NF 2653]
 gi|264663462|gb|EEZ33723.1| NAD-dependent epimerase/dehydratase [Brucella sp. 83/13]
 gi|306407340|gb|EFM63547.1| NAD-dependent epimerase/dehydratase [Brucella sp. NF 2653]
          Length = 289

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 173/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY  +  A           GTTR       L+  GI+P LF  +     L E
Sbjct: 1   MNIFLFGAGYCTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPTPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKALGYEFTYPDYKTAFSAMW 283


>gi|306840215|ref|ZP_07472990.1| NAD-dependent epimerase/dehydratase [Brucella sp. BO2]
 gi|306289820|gb|EFM60999.1| NAD-dependent epimerase/dehydratase [Brucella sp. BO2]
          Length = 289

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 174/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY  +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYCTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRPDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAPPQ+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPPQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P  R FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMARSFYGENKRVSNERIKALGYEFTYPDYKTAFSAMW 283


>gi|218510111|ref|ZP_03507989.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli Brasil 5]
          Length = 238

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 109/234 (46%), Positives = 156/234 (66%), Gaps = 1/234 (0%)

Query: 52  QKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNR 111
           + + + LR  L   TH+VQ I P  + DP +  + +D  + +P ++WIGYLS+  +YG+ 
Sbjct: 1   ETMGDGLRRALVDVTHLVQSIAPG-KADPLLRLLGEDSARLLPRLEWIGYLSTVGVYGDH 59

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
           +G WV E +   P+S  + +R  AE+ WLAI ++  +  A+LRLSGIYGP RN F  + +
Sbjct: 60  KGAWVSEETPCLPVSGRSKERLEAEEGWLAIGRERGVPAAILRLSGIYGPGRNAFCNLDK 119

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
             + RL+KK+QVFNRIRVED+     FL    LGGI+N++DD P PPQ+VI+EAA LM +
Sbjct: 120 GTARRLIKKDQVFNRIRVEDIGAATRFLSERGLGGIYNVTDDRPGPPQDVIVEAARLMGV 179

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
            PP EQ F+TA ++P  R FY +NKR+SNAK+K  GF+  +P Y  SL QLW++
Sbjct: 180 EPPPEQAFETAELTPMARTFYGENKRVSNAKLKKAGFEFSFPTYPQSLAQLWQD 233


>gi|254504585|ref|ZP_05116736.1| NAD dependent epimerase/dehydratase family [Labrenzia alexandrii
           DFL-11]
 gi|222440656|gb|EEE47335.1| NAD dependent epimerase/dehydratase family [Labrenzia alexandrii
           DFL-11]
          Length = 286

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 168/283 (59%), Gaps = 3/283 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY+ K I +       +  GTTRS      L+  GI PF+F  +   + + +
Sbjct: 1   MRLFVFGVGYSSKAIIEEVRDRFDWIGGTTRSAEKAGVLRENGIEPFIFDGETAGDGIAD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  I P+  GDP +     D     P  KW+GYLS+  +YGN +G WVDE +
Sbjct: 61  ALSTATHVLVSIAPNEAGDPVLNRHGADIAAASP--KWVGYLSTVGVYGNHDGAWVDETT 118

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + QR  AE+ WL+  ++ ++ + + RLSGIYGP RN F   ++  + RL+K 
Sbjct: 119 ACKPVSKRSVQRVAAEEAWLSFAERTSVPVQIFRLSGIYGPGRNTFENFKKGRARRLIKP 178

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI V D+A  V   M      +FN++DD+PAPPQ+V+  AA L+ +TPP E  F+
Sbjct: 179 GQVFNRIHVADIAGAVSIAMQSPKTRVFNVTDDQPAPPQDVVTYAAELLGVTPPPEVAFE 238

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           TA+++P  R FY +NKR+SN ++K  LG+   YP+YRI+L  L
Sbjct: 239 TADLTPMARSFYGENKRVSNQRVKDELGYTFRYPDYRIALNTL 281


>gi|148558697|ref|YP_001257954.1| hypothetical protein BOV_A0984 [Brucella ovis ATCC 25840]
 gi|148369982|gb|ABQ62854.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 289

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 173/283 (61%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ +FGAGY+ +  A           GTTR       L+  GI+P LF  +  +  L E
Sbjct: 1   MNIFLFGAGYSTQAFARRMAGEAGRIDGTTRHEQKFPLLEAAGIAPILFDGETPSPELLE 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           KL  ++HIV  I P+  GDP +  + +   +    ++WIGYLS+  +YG+ +G+WV+E +
Sbjct: 61  KLVRSSHIVISISPNESGDPAVAVVEEALCRRDNTIRWIGYLSTVGVYGDHQGEWVNETT 120

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + +R  AE+ W  ++K+    LA+LRLSGIYGP RN FI + +  + R+VK 
Sbjct: 121 ACKPVSRRSLERVKAEEAWTQLSKRHGTPLAILRLSGIYGPGRNAFINLERGTARRIVKA 180

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +  L   +  GIFN++D+EPAP Q+V+  AA LM +TPP    ++
Sbjct: 181 GQVFNRIHVEDIAGSLRLLAGTNADGIFNITDNEPAPLQDVVAYAAELMGVTPPPALPYE 240

Query: 241 TANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLW 283
            A+++P    FY +NKR+SN +IK+LG++  YP+Y+ +   +W
Sbjct: 241 EADMTPMAHSFYGENKRVSNERIKTLGYEFTYPDYKTAFSAMW 283


>gi|328545334|ref|YP_004305443.1| NAD dependent epimerase/dehydratase family [polymorphum gilvum
           SL003B-26A1]
 gi|326415076|gb|ADZ72139.1| NAD dependent epimerase/dehydratase family [Polymorphum gilvum
           SL003B-26A1]
          Length = 294

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 167/289 (57%), Gaps = 3/289 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L IFG GY+ +   D       +  GTTRS      LK  G+ PFLF   +    +R+
Sbjct: 1   MRLFIFGIGYSSRAFIDRVRDRFDWIGGTTRSPEKAARLKDVGVEPFLFDGTEPGGGIRD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   +H++  I P   GDP +I    D     PH  WIGYLS+  +YG+  G+WVDE +
Sbjct: 61  ALAQASHVLLSIAPDEAGDPALIHHGADIAAGRPH--WIGYLSTVGVYGDHHGEWVDEDT 118

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+S  + QR  AE+ WL    +  + +A+ RLSGIYGP RN  + +    + RLVK 
Sbjct: 119 PCRPVSKRSVQRVAAEQAWLRFADEHGVPVAIFRLSGIYGPGRNALVNLMSGTARRLVKP 178

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI VED+A  +   +      I+N++DDEP+PPQ+V+  AA L+ + PP E  F 
Sbjct: 179 GQVFNRIHVEDIAGALEASLARPRTRIYNVTDDEPSPPQDVVAYAADLLGVEPPPEIPFQ 238

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIEN 288
           +A++SP  R FY +NKR+SN +IK+ LGF   +  YRI+L+ L  EI++
Sbjct: 239 SADLSPMARSFYGENKRVSNQRIKAELGFNFRFSTYRIALEHLKAEIDS 287


>gi|118589654|ref|ZP_01547059.1| hypothetical protein SIAM614_04420 [Stappia aggregata IAM 12614]
 gi|118437740|gb|EAV44376.1| hypothetical protein SIAM614_04420 [Stappia aggregata IAM 12614]
          Length = 285

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 169/287 (58%), Gaps = 3/287 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L IFG G++ K   +       +  GTTRS      L++ G+ PF+F  +     + +
Sbjct: 1   MRLFIFGTGFSSKAFVEEVRDQFDWIGGTTRSPEKADALRNLGVEPFIFDGETKGEGIAD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  I P   GDP +   + +     P  +WIGYLS+  +YGN +G WVDE +
Sbjct: 61  ALKTATHVLVSIAPDEAGDPVLNQYASEIAAAKP--QWIGYLSTVGVYGNHDGAWVDEDT 118

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            ++P+S  + QR  AE+ WLA  ++ ++ + + RLSGIYGP RN F   ++  + RLVK 
Sbjct: 119 PLNPVSKRSVQRVTAEESWLAFAQENDVPVQIFRLSGIYGPGRNAFENFKKGTARRLVKP 178

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI V D+A  +   M      +FN++DDEPAPPQ+V+  AA L+ +  P E  F+
Sbjct: 179 GQVFNRIHVADIAGALKAAMAKPSTRVFNVTDDEPAPPQDVVAFAAQLLGVEAPPEIPFE 238

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEI 286
           TA++SP  R FY +NKR+SN ++K  LGF   YP+YR +LK L K +
Sbjct: 239 TADLSPMARSFYGENKRVSNQRLKEELGFTFRYPDYRTALKALLKTV 285


>gi|307943095|ref|ZP_07658440.1| NAD-dependent epimerase/dehydratase [Roseibium sp. TrichSKD4]
 gi|307773891|gb|EFO33107.1| NAD-dependent epimerase/dehydratase [Roseibium sp. TrichSKD4]
          Length = 291

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 168/284 (59%), Gaps = 3/284 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L +FG G++ + I +       +  GTTRS      L    ISP LF  +  ++ L   
Sbjct: 4   RLFVFGVGFSSRAIIENIRDQFDWIGGTTRSEGKAAQLAEANISPILFDGETASDELLSA 63

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L   TH++  I P++ GDP + +         P  KW+GYLS+  +YGN +G WVDE + 
Sbjct: 64  LEQATHVLVSIAPNASGDPVLNACRSALQTAKP--KWLGYLSTVGVYGNHDGAWVDEDTV 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P+S  + QR +AE  WLA  ++    + + RLSGIYGP RN F   ++  + RL+K  
Sbjct: 122 CKPVSERSIQRVDAENSWLAFAEETGTPVQIFRLSGIYGPGRNTFQNFKKGRARRLIKPG 181

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           QVFNRI V D+A  V   M +    I+N++DDEPA PQ+V+  AA L+ I PP E  F+T
Sbjct: 182 QVFNRIHVADIAGAVKAAMANPRTRIYNVTDDEPASPQDVVTYAAELLGIEPPPEVPFET 241

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
           A++SP  R FY +NKR+SNA++KS LG+Q  YP+YR++L  L++
Sbjct: 242 ADLSPMARSFYGENKRVSNARVKSELGYQFQYPSYRVALPALYQ 285


>gi|254461974|ref|ZP_05075390.1| NAD-dependent epimerase/dehydratase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678563|gb|EDZ43050.1| NAD-dependent epimerase/dehydratase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 288

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/283 (39%), Positives = 177/283 (62%), Gaps = 9/283 (3%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL+ FG G++ + +    L+ G    GTTRS      L+  G++  ++ D      LRE 
Sbjct: 4   HLLSFGHGFSARALTPLLLEQGFTITGTTRSSDKAAALEATGVTSVIWPDTN----LRET 59

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L+  TH++    P+++GDP + ++ +D  +  P+++W+GYLS+T +YG+ +G WVDE S 
Sbjct: 60  LHSATHLLISAAPNADGDPVLNALREDIVRHAPNLEWVGYLSTTGVYGDAKGGWVDESSP 119

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           + P +     R  AE +W +I    N+ L + RL+GIYGP R PF K+R   + R++K+ 
Sbjct: 120 LKPATKRGQMRVAAEADWQSIP---NLPLHIFRLAGIYGPGRGPFSKVRAGTARRIIKEG 176

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           QVF+RI VED+A+ ++  +   + G I+N+ DD+PAPPQ+VI  AA L+ +  P E  F+
Sbjct: 177 QVFSRIHVEDIAQILVASIAEPNAGAIYNMCDDDPAPPQDVIAHAAGLLGLPLPEEVDFE 236

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           TA ++P  R FYA++KR+ N +IKS LG +LLYP+YR  L  L
Sbjct: 237 TAEMTPMARSFYAESKRVRNDRIKSDLGVKLLYPDYRAGLAAL 279


>gi|110635923|ref|YP_676131.1| NAD-dependent epimerase/dehydratase [Mesorhizobium sp. BNC1]
 gi|110286907|gb|ABG64966.1| NAD-dependent epimerase/dehydratase [Chelativorans sp. BNC1]
          Length = 291

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 159/282 (56%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + IFGAGY+G+ IA           GTTRS      L   GI P ++A+      L   L
Sbjct: 4   VFIFGAGYSGRAIARVLAHKADSIAGTTRSAEKAEALARMGIKPLIYAEGGFTPELTGTL 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
             TTH++  I P   GD  +  + +     MP+++WI YLS+  +YG+     V E S  
Sbjct: 64  RETTHLILSIAPGENGDAVLAELIRRGRGAMPNLQWICYLSTVGVYGDHNCAEVTEESEC 123

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            PIS  + +R   EK W     ++ + +A+LRLSGIYGP RN  + + +  + R+VK  Q
Sbjct: 124 QPISARSHRRLETEKAWSRFGDEIGVPVAILRLSGIYGPGRNAIVNLVEGAARRIVKPGQ 183

Query: 183 VFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA 242
           VFNRI V+D+A     L+     G FN+SDDEP+PPQ+V+  AA L  + P  E  F+ A
Sbjct: 184 VFNRIHVDDIAGAARHLLNAKAHGTFNVSDDEPSPPQDVVAFAAHLTGVEPAPEIPFEEA 243

Query: 243 NISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWK 284
            +SP  R FY++ KR+SNAK+K LG+ L YPNYR  L  LWK
Sbjct: 244 KLSPMARSFYSECKRVSNAKLKGLGYSLRYPNYREGLSALWK 285


>gi|114706395|ref|ZP_01439297.1| hypothetical protein FP2506_01385 [Fulvimarina pelagi HTCC2506]
 gi|114538256|gb|EAU41378.1| hypothetical protein FP2506_01385 [Fulvimarina pelagi HTCC2506]
          Length = 298

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY+     D      V    T RSV    +L    +S F+F  +  +  +  
Sbjct: 1   MKLFVFGYGYSASHYVDRLPPSRVLGV-TVRSVEKAESLAKGRLSAFVFDGESFDPDVAN 59

Query: 61  KLYFTTHIVQCIKP--------------SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTS 106
            L   THI+  + P              + EGDP +    +   +  P ++WIGYLS+  
Sbjct: 60  ALGEATHILVSVPPGHTAPPEAQVGGANAPEGDPVLKVYGETIAEQCPELRWIGYLSTVG 119

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF 166
           +YG+  G WVDE + V P S  +  R  AE+ WL + ++  + LA+LRLSGIYGP RN F
Sbjct: 120 VYGDHGGGWVDEETPVDPRSERSKSRVTAERGWLTLAERRGVPLAILRLSGIYGPGRNQF 179

Query: 167 IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
             ++   + RL+K  QVFNRI V+D+A  +  L    +GGIFN++DDEPAPPQ+V+  AA
Sbjct: 180 ESLKSGKAKRLIKPGQVFNRIHVDDIAGSLELLAERTVGGIFNVTDDEPAPPQDVVTYAA 239

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
            L  + PP E  F+ A++S   R FY DNKR+SNAKIK+ G++  YP YR +L  L
Sbjct: 240 ELAGVEPPPEVNFEQADLSSMARSFYGDNKRVSNAKIKAAGYEFRYPTYREALAAL 295


>gi|90420739|ref|ZP_01228645.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335030|gb|EAS48791.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 306

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 158/296 (53%), Gaps = 15/296 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH  +FG GY+     D  L     T  T R+      L    + PF+F  +   + +  
Sbjct: 1   MHFFVFGHGYSAGHFVDT-LDPHDVTGVTVRTADKASRLAAHHLKPFVFDGEHPTDGISP 59

Query: 61  KLYFTTHIVQCIKP--------------SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTS 106
            LY  TH++  + P              +  GDP +           P ++WIGYLS+  
Sbjct: 60  ALYRATHLLVSVPPGHAAPTGASVGGANARPGDPVLRWYGDAIAHGCPKLEWIGYLSTVG 119

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF 166
           +YG+ +G WVDE S   P+S  +  R  AE  W        + LA+LRLSGIYGP RN F
Sbjct: 120 VYGDHDGGWVDEDSETRPVSERSKARIAAETAWQEAAATRRVPLAILRLSGIYGPGRNGF 179

Query: 167 IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           + + +  + RLVK  QVFNRI V+D+A  +  L    LGG++N++DDEPAPPQ V+  AA
Sbjct: 180 VNLAKGTAKRLVKPGQVFNRIHVDDIAGALSLLAEQRLGGLYNVTDDEPAPPQEVVAHAA 239

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           ++  + PP E  FD A +SP  R FY +NKR+SNA+IK  G+Q  +P YR  L+ +
Sbjct: 240 AMAGVEPPPEIPFDAAELSPMARSFYGENKRVSNARIKKAGYQFRHPTYREGLESV 295


>gi|218662908|ref|ZP_03518838.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli IE4771]
          Length = 206

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 140/201 (69%)

Query: 85  MSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITK 144
           M +D  +F+P ++WIGYLS+  +YG+ +G WV E +   P+S  + +R  AE+ WLA+ +
Sbjct: 1   MGEDSARFLPRLEWIGYLSTVGVYGDHKGAWVSEETPCVPVSGRSKERLEAEQGWLAMGR 60

Query: 145 KLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL 204
           +  +  AVLRLSGIYGP RN F  + +  + RL+KK+QVFNRIRVED+     FL    L
Sbjct: 61  ERGVPAAVLRLSGIYGPGRNAFCNLDKGTARRLIKKDQVFNRIRVEDIGAATRFLSDRGL 120

Query: 205 GGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK 264
            GI+N++DD P PPQ+VI+EAA LM + PP EQ F+TA ++P  R FY +NKR+SNAK+K
Sbjct: 121 DGIYNVTDDRPGPPQDVIVEAARLMGVEPPPEQAFETAELTPMARTFYGENKRVSNAKLK 180

Query: 265 SLGFQLLYPNYRISLKQLWKE 285
             GF+  +P + +SL QLW++
Sbjct: 181 KAGFEFSFPTFPMSLAQLWQD 201


>gi|151564662|gb|ABS17662.1| nucleoside-diphosphate-sugar epimerase [Arnebia euchroma]
          Length = 252

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 156/245 (63%)

Query: 28  GTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSK 87
           GTTR+  N  TL+  GI+P +F  +  +  L ++L  +TH+V  I P   GDP +  + +
Sbjct: 6   GTTRNEQNFPTLEKAGIAPIIFDGETASPELIDRLAKSTHVVISISPRENGDPSLAIVEE 65

Query: 88  DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN 147
              +    ++WIGYLS+  +YGN +G W+DE +   P S  + +R  AE  W A++++  
Sbjct: 66  ALRRPDNTIRWIGYLSTVGVYGNHDGNWIDETTPCEPSSRRSLERVEAENAWNALSERHG 125

Query: 148 IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI 207
             +A+LRLSGIYGP RN  I + +  + R++K+ QVFNRI VED+A  + FL   + GG 
Sbjct: 126 TPVALLRLSGIYGPGRNALINLERGTARRIIKEGQVFNRIHVEDIAGTLRFLAGTNTGGA 185

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
            N++D+EPAPPQ+V++ AA LM + PP E  F+ A+++P  R FY +NKR+S+ +IK LG
Sbjct: 186 LNITDNEPAPPQDVVVYAAELMGVAPPPEVPFEDADMAPMARSFYGENKRVSSQRIKDLG 245

Query: 268 FQLLY 272
           +  ++
Sbjct: 246 YDFIH 250


>gi|149203084|ref|ZP_01880055.1| hypothetical protein RTM1035_20116 [Roseovarius sp. TM1035]
 gi|149143630|gb|EDM31666.1| hypothetical protein RTM1035_20116 [Roseovarius sp. TM1035]
          Length = 304

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 165/282 (58%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG G++ + +    L  G    GTTRS      L+ +G++P L+ +      LR  L
Sbjct: 25  LLSFGHGFSARALTARLLPQGWQIIGTTRSADKAEVLRREGVTPALWPEDD----LRPAL 80

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P + GDP +        +  P + W+GYLS+T +YG+  G WVDE + +
Sbjct: 81  ASATHLLISAAPDAAGDPVLARYRDAITEAAPRLAWVGYLSTTGVYGDHAGGWVDEATPL 140

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R +AE +W AI     + L + RL+GIYGP R PF K+RQ  + R+VK  Q
Sbjct: 141 TPSTRRGQMRVDAEADWQAIP---GLPLHIFRLAGIYGPGRGPFEKVRQGTARRIVKPGQ 197

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +   + G ++NL DD+PAPPQ+VI  AA L+ +  P E  FD 
Sbjct: 198 VFSRIHVEDIAQVLEASINRPNPGAVYNLCDDDPAPPQDVIGHAADLLGLPLPEEVAFDE 257

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+SN +IK  LG +L+YP+YR  L+ L
Sbjct: 258 AEMTPMARSFYAESKRVSNRRIKEELGIKLIYPDYRSGLRAL 299


>gi|85706124|ref|ZP_01037219.1| hypothetical protein ROS217_11456 [Roseovarius sp. 217]
 gi|85669288|gb|EAQ24154.1| hypothetical protein ROS217_11456 [Roseovarius sp. 217]
          Length = 284

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 165/282 (58%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG G++ + +A   +  G    GTTRS      L+H+GI+P L+ +  ++ +L    
Sbjct: 5   LLSFGHGFSARALAARLVPQGWAIIGTTRSADKAEVLRHEGITPALWPEDDLSPVLAS-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P + GDP +        +  P + W+GYLS+T +YG+  G WVDE + +
Sbjct: 63  --VTHLLISAGPDAAGDPVLARYHDAIAQAAPRLDWVGYLSTTGVYGDHAGGWVDEETPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI     + L + RL+GIYGP R PF K+RQ  + R+VK  Q
Sbjct: 121 TPSTRRGQMRVTAEAAWQAIP---GLPLHIFRLAGIYGPGRGPFEKVRQGTARRIVKPGQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +   + G ++NL DD+PAPPQ+VI  AA L+ +  P    FD 
Sbjct: 178 VFSRIHVEDIAQVLEASINRPNPGAVYNLCDDDPAPPQDVIGHAAELLGLPLPEAVAFDE 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+SN +IK  LG +L+YP+YR  L+ L
Sbjct: 238 AEMTPMARSFYAESKRVSNRRIKEELGIELIYPDYRSGLQAL 279


>gi|163745282|ref|ZP_02152642.1| hypothetical protein OIHEL45_06825 [Oceanibulbus indolifex HEL-45]
 gi|161382100|gb|EDQ06509.1| hypothetical protein OIHEL45_06825 [Oceanibulbus indolifex HEL-45]
          Length = 298

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 163/282 (57%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   +  G    GTTRS   L  +   G+ P L+    +  LLRE  
Sbjct: 19  LLSLGHGYSARALATRLIPQGWRIIGTTRSPDKLAEIAATGVEPLLWPGDDLTQLLRE-- 76

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
               +++    P  EGDP ++ +  +     PH++W+GYLS+T +YG+  G WVDE + +
Sbjct: 77  --VPNLLVSAGPGQEGDPVLLELQDEIAAAAPHLRWVGYLSTTGVYGDHGGDWVDETTPL 134

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI    N+ L + RL+GIYGP R PF K+R+  + R++K+ Q
Sbjct: 135 APSTRRGAARVQAEAAWAAIP---NLPLHIFRLAGIYGPGRGPFAKVRKGTARRIIKEGQ 191

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ + + L T   G I+NL DD+PAPPQ+VI  AA L+ +  P    F+ 
Sbjct: 192 VFSRIHVEDIAQALELSLATPQPGAIYNLCDDDPAPPQDVIGHAAELLGLPLPPAVDFNE 251

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A ++P  R FYA++K++ N   K +LG+Q +YP YR  L  L
Sbjct: 252 AEMTPMARSFYAESKKVRNDHAKAALGWQPIYPVYRSGLAAL 293


>gi|260425663|ref|ZP_05779643.1| NAD-dependent epimerase/dehydratase [Citreicella sp. SE45]
 gi|260423603|gb|EEX16853.1| NAD-dependent epimerase/dehydratase [Citreicella sp. SE45]
          Length = 285

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 158/285 (55%), Gaps = 9/285 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTR       L+ +G+ P  +    +     E L
Sbjct: 5   LVSLGHGYSARALARRLLPQGWTVLGTTRDPGKADALRAEGVEPIAWDRAAVA----EAL 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P ++GDP +           P + W GYLS+T +YG+  G W+DE + +
Sbjct: 61  GRATHLLVSAGPDADGDPSLRLCRDAIAARAPALDWAGYLSTTGVYGDHGGDWIDEDTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE +W A+     + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 121 TPGTRRGQWRLQAETDWRAVP---GLPLHIFRLAGIYGPGRGPFEKVRNGTARRIVKPGQ 177

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +     G  +NL DD+PAPPQ+V++ AA L+ + PP E  FD 
Sbjct: 178 VFSRIHVEDIAQVLEASIRKPAPGSAYNLCDDDPAPPQDVLLHAAELLDVAPPPEIAFDA 237

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
           A +SP  R FYA+NKR+SN +IK  LG QL YP+YR  L+ L  E
Sbjct: 238 AEMSPMARSFYAENKRVSNRRIKDELGVQLRYPDYRAGLRALLDE 282


>gi|146278826|ref|YP_001168985.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557067|gb|ABP71680.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 279

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 165/282 (58%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTRS +    L+ +GI P L+       L +   
Sbjct: 4   LLSLGHGYSAQALARRLLPAGWRVIGTTRSAAKADALRAQGIEPLLWPGDPGPALAQ--- 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+    P  EGDP + + +    +  P  +W+GYLS+T +YG+ +G WVDE + +
Sbjct: 61  --ATHILASAAPGPEGDPFLATHASRMAEARP--EWVGYLSTTGVYGDHQGGWVDEDTAL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A    L + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 TPSTERGRSRVAAERQWQA----LGLPLHIFRLAGIYGPGRGPFEKVRDGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   + H   G I+N+ DD+PAPP++V+  AA L+ + PP E  +D 
Sbjct: 173 VFSRIHVEDIAQVLEASIRHPEPGAIYNVCDDDPAPPEDVLGYAAELIGLPPPPEVPYDE 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK  LG +L++P+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKRVRNDRIKERLGVRLIHPDYRSGLRAL 274


>gi|126460831|ref|YP_001041945.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102495|gb|ABN75173.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 279

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 161/282 (57%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTRS +    L+  GI P L+        L   L
Sbjct: 4   LLSLGHGYSAQALAHRLLPQGWTVIGTTRSAAKAAELEAGGIEPLLWPGD-----LGPAL 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +HI+    P  EGDP + +   +  +     +W+GYLS+T +YG+  G WVDE + +
Sbjct: 59  ARASHILASAAPGREGDPFLATHGAELARA--GARWVGYLSTTGVYGDHAGGWVDEDTPL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A    L + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 TPSTERGQARVQAERQWQA----LGLPLHIFRLAGIYGPGRGPFEKVRDGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   M H   G I+N+ DD+PAPP++V+  AA L+ + PP E  +D 
Sbjct: 173 VFSRIHVADIAQVLEASMQHPEPGAIYNVCDDDPAPPEDVLGYAAELLGLPPPPEVPYDA 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK+ LG  LL+P+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKRVRNDRIKARLGIALLHPDYRSGLRSL 274


>gi|332559861|ref|ZP_08414183.1| hypothetical protein RSWS8N_12400 [Rhodobacter sphaeroides WS8N]
 gi|332277573|gb|EGJ22888.1| hypothetical protein RSWS8N_12400 [Rhodobacter sphaeroides WS8N]
          Length = 279

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 161/282 (57%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTRS +    L+  GI P L+        L   L
Sbjct: 4   LLSLGHGYSAQALAHRLLPQGWTVIGTTRSAAKAAELEAGGIEPLLWPGD-----LGPAL 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +HI+    P  EGDP + +   +  +     +W+GYLS+T +YG+  G WVDE + +
Sbjct: 59  ARASHILASAAPGREGDPFLATHGAELARA--DARWVGYLSTTGVYGDHAGGWVDEDTPL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A    L + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 TPSTERGQARVEAERQWQA----LGLPLHIFRLAGIYGPGRGPFEKVRDGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   M H   G I+N+ DD+PAPP++V+  AA L+ + PP E  +D 
Sbjct: 173 VFSRIHVADIAQVLEASMQHPEPGAIYNVCDDDPAPPEDVLGYAAELLGLPPPPEVPYDE 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK+ LG  LL+P+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKRVRNDRIKARLGIALLHPDYRSGLRSL 274


>gi|77464962|ref|YP_354466.1| hypothetical protein RSP_1385 [Rhodobacter sphaeroides 2.4.1]
 gi|77389380|gb|ABA80565.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 279

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 161/282 (57%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTRS +    L+  GI P L+        L   L
Sbjct: 4   LLSLGHGYSAQALAHRLLPQGWTVIGTTRSAAKAAELEAGGIEPLLWPGD-----LGPAL 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +HI+    P  EGDP + +   +  +     +W+GYLS+T +YG+  G WVDE + +
Sbjct: 59  ARASHILASAAPGREGDPFLATHGAELARA--DARWVGYLSTTGVYGDHAGGWVDEDTPL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A    L + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 TPSTERGQARVQAERQWQA----LGLPLHIFRLAGIYGPGRGPFEKVRDGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   M H   G I+N+ DD+PAPP++V+  AA L+ + PP E  +D 
Sbjct: 173 VFSRIHVADIAQVLEASMQHPEPGAIYNVCDDDPAPPEDVLGYAAELLGLPPPPEVPYDE 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK+ LG  LL+P+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKRVRNDRIKARLGIALLHPDYRSGLRSL 274


>gi|221640883|ref|YP_002527145.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides KD131]
 gi|221161664|gb|ACM02644.1| NAD-dependent epimerase/dehydratase [Rhodobacter sphaeroides KD131]
          Length = 279

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 160/282 (56%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G    GTTRS +    L+  GI P L+        L   L
Sbjct: 4   LLSLGHGYSAQALAHRLLPQGWTVIGTTRSAAKAAELEAGGIEPLLWPGD-----LGPAL 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +HI+    P  EGDP + +      +     +W+GYLS+T +YG+  G WVDE + +
Sbjct: 59  ARASHILASAAPGREGDPFLATHGAALARA--DARWVGYLSTTGVYGDHAGGWVDEDTPL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A    L + L + RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 TPSTERGQARVEAERQWQA----LGLPLHIFRLAGIYGPGRGPFEKVRDGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   M H   G I+N+ DD+PAPP++V+  AA L+ + PP E  +D 
Sbjct: 173 VFSRIHVADIAQVLEASMQHPEPGAIYNVCDDDPAPPEDVLGYAAELLGLPPPPEVPYDE 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK+ LG  LL+P+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKRVRNDRIKARLGIALLHPDYRSGLRSL 274


>gi|149913081|ref|ZP_01901615.1| hypothetical protein RAZWK3B_03795 [Roseobacter sp. AzwK-3b]
 gi|149813487|gb|EDM73313.1| hypothetical protein RAZWK3B_03795 [Roseobacter sp. AzwK-3b]
          Length = 286

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 169/285 (59%), Gaps = 9/285 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG G++ + ++   L  G    GTTRS      L+ +G++P L+ D      L E L
Sbjct: 5   LLSFGHGFSARALSPLLLARGWTIHGTTRSPDKTEALRSEGVTPILWPDGD----LSEAL 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+    P ++GDP +             ++W+GYLS+T +YG+ +G WV E + +
Sbjct: 61  DSATHILISAGPDADGDPVLNQCGDRIAAIASRLEWVGYLSTTGVYGDHQGGWVTEDTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R +AE  W AI     + L + RL+GIYGP R PF K+RQ  + R+VK +Q
Sbjct: 121 TPSTRRGKMRVDAEAAWQAIP---GLPLHIFRLAGIYGPGRGPFEKVRQGTAQRIVKPDQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+A+ ++  +   + G  +N+ DD+PAPPQ+VI  AA L+ +  P E  FD 
Sbjct: 178 VFSRIHVDDIAQVLLASIDRPNPGAAYNVCDDDPAPPQDVIGHAAELLGLPLPPEVPFDE 237

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
           A+++P  R FYA++KR+ N+++K+ LG  L++P+YR  L+ L ++
Sbjct: 238 ADMTPMARSFYAESKRVDNSRMKNELGVTLIHPDYRTGLRALLEQ 282


>gi|56698573|ref|YP_168950.1| hypothetical protein SPO3755 [Ruegeria pomeroyi DSS-3]
 gi|56680310|gb|AAV96976.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 283

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 162/288 (56%), Gaps = 11/288 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GYT + ++ A    G    GT+R+   +  ++  G  P L+  ++        L
Sbjct: 5   LLSFGHGYTARVLSRALAPQGWRIIGTSRNPDQMEAIRASGAEPLLWPGEE------PSL 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P S GDP + ++           +W+GYLS+T++YG+ +G WVDE + +
Sbjct: 59  DGVTHLLISTAPDSGGDPVLAALGDQIAARAAQFRWVGYLSTTAVYGDHDGAWVDETTPL 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A+    N+ L V RL+GIYGP R PF K+ +    R++K  Q
Sbjct: 119 TPTAARGRWRVMAEQQWQAVP---NLPLHVFRLAGIYGPGRGPFSKLGKGGIRRIIKPGQ 175

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   M     G ++N+ DDEP PPQ+VI  AA L  +  P    FD 
Sbjct: 176 VFSRIHVEDIAQVLAASMARPDPGAVYNVCDDEPVPPQDVIAYAAELQGLPLPPAVDFDK 235

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           A+++P  R FY++NKR+ N +IK  LG +L YPNYR+ L+ L  + E 
Sbjct: 236 ADLTPMARSFYSENKRVRNDRIKEELGVRLKYPNYRVGLEALQADAET 283


>gi|154250658|ref|YP_001411482.1| NAD-dependent epimerase/dehydratase [Parvibaculum lavamentivorans
           DS-1]
 gi|154154608|gb|ABS61825.1| NAD-dependent epimerase/dehydratase [Parvibaculum lavamentivorans
           DS-1]
          Length = 291

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 154/283 (54%), Gaps = 2/283 (0%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L  FG G++ +  A      G    GT RS      L+  GI  FLF          + 
Sbjct: 5   RLFCFGMGFSARVFASRLAGRGFAVAGTCRSEEKAARLREAGIEAFLFDSGLPLRDAEQA 64

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  TTH++    P+  GDP + +      +  P ++W GYLS+T +YG+R+G WV E + 
Sbjct: 65  LDGTTHLLISTPPAEAGDPVLAAHRDALRRLAPRIEWAGYLSTTGVYGDRQGGWVTEETP 124

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           + P    + +R +AE  W A  ++  + L + RL+GIYGP RN    +    + R+VK+ 
Sbjct: 125 LDPAVARSDRRASAEAGWQAFARETGLPLHIFRLAGIYGPGRNQLQGVIDGTAKRIVKEG 184

Query: 182 QVFNRIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           Q+F+RI VED+A  +   M     G I+N+ DDEPAP   V+  AA L+   PPLE  ++
Sbjct: 185 QIFSRIHVEDIAGVLEASMAKKRPGAIYNVCDDEPAPAHEVVAYAAELLGREPPLEVPYE 244

Query: 241 TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
           TA++SP  R FYA ++R+SN ++ + LG+ L YP YR  LK L
Sbjct: 245 TADLSPMARSFYAASRRVSNVRLHEELGYDLRYPTYREGLKAL 287


>gi|86136861|ref|ZP_01055439.1| hypothetical protein MED193_14342 [Roseobacter sp. MED193]
 gi|85826185|gb|EAQ46382.1| hypothetical protein MED193_14342 [Roseobacter sp. MED193]
          Length = 290

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 165/282 (58%), Gaps = 16/282 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +A   L  G    GT R       +   G+    +  ++I        
Sbjct: 5   LLCLGYGYTARNLAPHLLARGWRVIGTARE-----PVDAPGVEMITWPGEQI------IW 53

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  I P++ GDP + ++S++     P ++W+GYLS+T++YG+R G WVDE + V
Sbjct: 54  PGVTHVLNSIGPNAMGDPVLAALSREISTIAPDLEWLGYLSTTAVYGDRGGDWVDEATPV 113

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S     R  AE++W  I    ++ L + RL+GIYGP R PF K+    + R+VK  Q
Sbjct: 114 APTSERGNWRALAERQWQEIP---DLPLHIFRLAGIYGPGRGPFAKLMAGKARRIVKPGQ 170

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+ + ++  M   + GGI+NL DD+PAPPQ+V+  AA L+ +  P E  FD 
Sbjct: 171 VFSRIHVDDIVQALLASMDQPNPGGIYNLCDDDPAPPQDVLGHAAELLGLPVPAEVPFDE 230

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A ++P  R FY +NKR+ N++IK +LG +LLYP+YR  L+ +
Sbjct: 231 AGMTPMARSFYGENKRVRNSRIKNALGVELLYPSYREGLQAV 272


>gi|163732514|ref|ZP_02139959.1| hypothetical protein RLO149_11770 [Roseobacter litoralis Och 149]
 gi|161393874|gb|EDQ18198.1| hypothetical protein RLO149_11770 [Roseobacter litoralis Och 149]
          Length = 281

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 159/282 (56%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + +A   +  G    GTTRS      +   G+ P ++    ++  +R   
Sbjct: 6   LLSFGHGYSARALAALLIPAGWRVIGTTRSADKAAGIAQTGVEPLIWPGSDVSGTIRN-- 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              T ++    P  +GDP +  +          +KW+GYLS+T +YG+ +G WVDE + +
Sbjct: 64  --ATALLISAGPDKDGDPVLRRLHAQIADHARQLKWVGYLSTTGVYGDHDGAWVDEDTPL 121

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI    ++ L + RL+GIYGP R PF K+R   + R++KK Q
Sbjct: 122 TPSTARGQARVAAEAAWQAIP---DLPLHIFRLAGIYGPGRGPFSKVRAGTARRIIKKGQ 178

Query: 183 VFNRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  VED+A+ ++  +     G I+N+ DD+PAPPQ+VI  AA L+ +  P E  F+T
Sbjct: 179 VFSRTHVEDIAQVLMASIQQPRPGAIYNVCDDDPAPPQDVIGHAAELLGLPLPPEVDFET 238

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA++K++ N  IK  LG  L YPNYR  L+ +
Sbjct: 239 ADMTPMARSFYAESKKVRNDLIKRELGVVLKYPNYRTGLEAM 280


>gi|89067293|ref|ZP_01154806.1| hypothetical protein OG2516_10651 [Oceanicola granulosus HTCC2516]
 gi|89046862|gb|EAR52916.1| hypothetical protein OG2516_10651 [Oceanicola granulosus HTCC2516]
          Length = 282

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 159/282 (56%), Gaps = 14/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+   +A   +  G    GTTRS      L   G+ P LF        L   L
Sbjct: 5   LLSLGHGYSAAALARLLMPRGWRVIGTTRSPEKAERLAADGVEPVLFP----GTDLAPHL 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P  +GDP + ++      F     W+GYLS+T +YG+R G WVDE S +
Sbjct: 61  AAATHLLASAAPGDDGDPFLAALDLADQTF----DWVGYLSTTGVYGDRAGGWVDETSEL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +    QR  AE+ W    ++  + L V RL+GIYGP R PF K+R   + R+VK  Q
Sbjct: 117 APSTRRGRQRVAAEQAW----RETGLPLHVFRLAGIYGPGRGPFAKVRGGTARRIVKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+A+ +   +   + G ++N+ DD+PAPPQ+VI EAA L+ +  P E+ F+T
Sbjct: 173 VFSRIHVDDIAQVLAASIARPNPGAVYNVCDDDPAPPQDVIAEAARLLGLPLPPEEDFET 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++K++ N +I+  LG  L YP+YR  L+ L
Sbjct: 233 AEMTPMARSFYAESKKVRNDRIRDELGVALHYPDYRSGLRAL 274


>gi|261825031|pdb|3IUS|A Chain A, The Structure Of A Functionally Unknown Conserved Protein
           From Silicibacter Pomeroyi Dss
 gi|261825032|pdb|3IUS|B Chain B, The Structure Of A Functionally Unknown Conserved Protein
           From Silicibacter Pomeroyi Dss
          Length = 286

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 160/288 (55%), Gaps = 11/288 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GYT + ++ A    G    GT+R+      ++  G  P L+  ++        L
Sbjct: 8   LLSFGHGYTARVLSRALAPQGWRIIGTSRNPDQXEAIRASGAEPLLWPGEE------PSL 61

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P S GDP + ++           +W+GYLS+T++YG+ +G WVDE + +
Sbjct: 62  DGVTHLLISTAPDSGGDPVLAALGDQIAARAAQFRWVGYLSTTAVYGDHDGAWVDETTPL 121

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W A+    N+ L V RL+GIYGP R PF K+ +    R++K  Q
Sbjct: 122 TPTAARGRWRVXAEQQWQAVP---NLPLHVFRLAGIYGPGRGPFSKLGKGGIRRIIKPGQ 178

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +         G ++N+ DDEP PPQ+VI  AA L  +  P    FD 
Sbjct: 179 VFSRIHVEDIAQVLAASXARPDPGAVYNVCDDEPVPPQDVIAYAAELQGLPLPPAVDFDK 238

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           A+++P  R FY++NKR+ N +IK  LG +L YPNYR+ L+ L  + E 
Sbjct: 239 ADLTPXARSFYSENKRVRNDRIKEELGVRLKYPNYRVGLEALQADAET 286


>gi|114764234|ref|ZP_01443472.1| hypothetical protein 1100011001320_R2601_10112 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543386|gb|EAU46402.1| hypothetical protein R2601_10112 [Roseovarius sp. HTCC2601]
          Length = 287

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/277 (37%), Positives = 156/277 (56%), Gaps = 9/277 (3%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L+  G GY+ + +A   L  G    GTTR  +     + +G+ P L+    +     E 
Sbjct: 4   RLLSLGHGYSAQALARQLLPQGWTVIGTTRDPAKAERFRAEGVVPLLWDRMAVE----EA 59

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L   +H++    P S+GDP +        +    + W+ YLS+T +YG+  G WVDE + 
Sbjct: 60  LGRVSHVLISAGPDSDGDPSLRLCGPAMAERAAQLDWVAYLSTTGVYGDHGGGWVDEDTP 119

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           + P +     R  AE  W AI    ++ L + RL+GIYGP R PF K+R   + R+VK  
Sbjct: 120 LTPGTRRGAMRLAAEDAWRAIP---DLPLHIFRLAGIYGPGRGPFAKVRAGTARRIVKPG 176

Query: 182 QVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           QVF+RI VED+A+ +   +     G I+NL DD+PAPPQ VI+ AA L+ +TPP E+ F+
Sbjct: 177 QVFSRIHVEDIAQVLEASIRLPDPGAIYNLCDDDPAPPQEVILHAAELLGVTPPPEEPFE 236

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
           +A +    R FYA++KR+SN +IK  LG +L YP+YR
Sbjct: 237 SAEMGAMARSFYAESKRVSNRRIKEELGVRLYYPDYR 273


>gi|312113310|ref|YP_004010906.1| NAD-dependent epimerase/dehydratase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218439|gb|ADP69807.1| NAD-dependent epimerase/dehydratase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 287

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/288 (39%), Positives = 162/288 (56%), Gaps = 8/288 (2%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           +L +FG GY+    A      G    GT RS   L  +   GI+P LF+D +    +   
Sbjct: 3   NLFVFGLGYSALATAVHLADGGWPVTGTVRSRDKLEQIARDGITPILFSDAEA---VAAG 59

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  T+H +  + P +EGDP +++  +D     P + WIGYLS+  +YG+  G+WVDE + 
Sbjct: 60  LQTTSHCLVSVPPDAEGDPALLAY-RDALLEAPELHWIGYLSTIGVYGDHGGKWVDEETH 118

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V       + R  AE EW A+ K+  I L + RL+GIYGP R+P  +IR   +  + K  
Sbjct: 119 VAATGGRRSARAEAEIEWTALAKEKGIALDIFRLAGIYGPGRSPIDRIRSGEARWIHKAG 178

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGG--IFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
           QVFNRI VED+A+ V+  +    LGG  IFN++DDEPAP  +V+  AA L+ +       
Sbjct: 179 QVFNRIHVEDIAQTVLAAIRRDRLGGVHIFNVTDDEPAPNPDVLAYAADLIDVPKQPLIP 238

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKE 285
           ++ A++SP  R FY  NKR+ NAKIK  LG  L YP YR  L+ L +E
Sbjct: 239 YEEADLSPMARSFYEGNKRVHNAKIKRELGVLLRYPTYREGLRALARE 286


>gi|217979782|ref|YP_002363929.1| NAD-dependent epimerase/dehydratase [Methylocella silvestris BL2]
 gi|217505158|gb|ACK52567.1| NAD-dependent epimerase/dehydratase [Methylocella silvestris BL2]
          Length = 291

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 165/293 (56%), Gaps = 8/293 (2%)

Query: 1   MHLMIFGAGYTGK-FIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M L  FG GY  + FIA     +     GT RS      L  + +  F+F   + +  + 
Sbjct: 1   MKLFAFGLGYCAQDFIARFG-DLFDRISGTVRSADKAKELASETVEVFVFGPDREDPGIT 59

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKF-MPHVKWIGYLSSTSIYGNREGQWVDE 118
           EK+     ++  I P    DP +    +       P +  I YLS+  +YG+R+G+WVDE
Sbjct: 60  EKMLAADVLLISIPPGVSVDPVLARYGQKIASLRTPQI--IVYLSTIGVYGDRQGEWVDE 117

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
                P S  +  R NAEK W AI +  +  + +LRL+GIYGP RN  + +++  + RL+
Sbjct: 118 SGVPTPTSQRSKTRLNAEKSWAAIGRSRDKTVHILRLAGIYGPGRNALLNLKEGRAHRLI 177

Query: 179 KKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           K +QVFNR+ VED++R +   + H   GG++N+SDD P+PPQ+V+  AASLM I PP EQ
Sbjct: 178 KPDQVFNRVHVEDISRAIAAAIAHEGPGGVWNVSDDAPSPPQDVVAYAASLMGIEPPPEQ 237

Query: 238 CFDTA-NISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
             + A +ISP TR FYA+NKR SN K+K  L   L +P YR+ L+ LW+  E 
Sbjct: 238 AIEEAQDISPMTRSFYAENKRASNRKLKEELHVDLAFPTYRVGLEALWEAGEG 290


>gi|126727244|ref|ZP_01743080.1| NAD-dependent epimerase/dehydratase [Rhodobacterales bacterium
           HTCC2150]
 gi|126703453|gb|EBA02550.1| NAD-dependent epimerase/dehydratase [Rhodobacterales bacterium
           HTCC2150]
          Length = 287

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 171/284 (60%), Gaps = 8/284 (2%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L  FG GY+   +A   L       GTTRS    + L  +GI+P ++     N + +  L
Sbjct: 5   LFTFGHGYSAHALAQI-LPSDWAKVGTTRSQERAVVLVTRGITPEIWP----NKMSKIDL 59

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
             TTH++  I P+  GDP    ++ D    MP++KW+GYLS+T +YG+ +G WVDE++ +
Sbjct: 60  QDTTHLLLSIAPNENGDPVYNELA-DEIAAMPNLKWLGYLSTTGVYGDHQGGWVDENTPL 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE +W  +  K ++ L + R++GIYGP R PF K+R   + R++K+NQ
Sbjct: 119 TPATKRGRMRVLAEGQWQELASKHDLPLHIFRIAGIYGPGRGPFAKVRSGTARRIIKENQ 178

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+A+ +   +   + GGI+NL DD  APPQ+VI  AA L+ +  P +  F+T
Sbjct: 179 VFSRIHVKDIAQILAASIDKPNPGGIYNLCDDLAAPPQDVIAFAAQLLNLPIPEDTPFET 238

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
           A ++   R FY+++KR+ N KIK+ LG +L++P+YR  L  + K
Sbjct: 239 AELTDMARSFYSESKRVRNDKIKNELGVRLIHPDYRAGLLSMIK 282


>gi|254474270|ref|ZP_05087660.1| nucleoside-diphosphate-sugar epimerase [Pseudovibrio sp. JE062]
 gi|211956644|gb|EEA91854.1| nucleoside-diphosphate-sugar epimerase [Pseudovibrio sp. JE062]
          Length = 281

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 159/279 (56%), Gaps = 3/279 (1%)

Query: 7   GAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTT 66
           GAGY+ +           +  GTTRS   +  L+ KGI P LF  +  ++ L E +   T
Sbjct: 1   GAGYSARHFVKMYGTEFSWIGGTTRSEEKMADLQSKGIHPILFDGETASDELLEAISSAT 60

Query: 67  HIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS 126
           HI+    P+ +GDP + +      +  P    I YLS+  +YG+ EG+WV E +  +P S
Sbjct: 61  HILVSAAPTDDGDPLLYAARDAVVESKPTA--ICYLSTIGVYGDHEGRWVTETAECNPTS 118

Query: 127 CVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNR 186
             +  R  AEKEWL  +++  I +++LRL+GIYG  +N    + +  + R++K+ QVFNR
Sbjct: 119 KRSKLRLEAEKEWLVFSEESGIPVSILRLAGIYGRGQNALCNLDKGKARRIIKEGQVFNR 178

Query: 187 IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISP 246
           I V D+A  V      +  GIFN+SDD P PP++V+  AA LM + PP    F+ A++SP
Sbjct: 179 IHVSDIAGAVQHAFEDNASGIFNVSDDAPCPPEDVVEYAARLMGVEPPPAIAFEDADLSP 238

Query: 247 FTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
               FY + KR SNAK+K +LG++  +P YR +L  +W+
Sbjct: 239 MAISFYGEVKRASNAKLKGALGYKFKFPTYREALDYMWE 277


>gi|126730370|ref|ZP_01746181.1| hypothetical protein SSE37_11459 [Sagittula stellata E-37]
 gi|126709103|gb|EBA08158.1| hypothetical protein SSE37_11459 [Sagittula stellata E-37]
          Length = 291

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 166/290 (57%), Gaps = 11/290 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++ +F+A   L  G    GTTRS + L  L+  G+   L+    +   L E  
Sbjct: 5   LLSLGHGFSARFLAADLLAEGWRVIGTTRSANKLGPLEATGVEAILWTHDSVARALSE-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P +EGDP +  +  +       + W+GYLS+T +YGN +G WVDE S +
Sbjct: 63  --ATHVLMSAAPDAEGDPALRLIGPELADRAGGLAWVGYLSTTGVYGNADGAWVDETSPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
              S  A  R  AE  W AI     + +   RL+GIYGP R PF K+R   + R++K +Q
Sbjct: 121 DGHSRRARARIEAEAAWRAIP---GLPVHSFRLAGIYGPGRGPFEKLRNGTARRIIKDDQ 177

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           +F+RI  ED+++ +   +   + G  +N+ DDEPAPPQ+VI  AA L+ + PP E  F+ 
Sbjct: 178 IFSRIHGEDISQVLRASIARPNPGAAYNVCDDEPAPPQDVIAFAAELLDVPPPPEVAFED 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLW--KEIEN 288
           A++SP  R FYADNKR+SN +I+  LG  L YP+Y+  L+ +   +E++N
Sbjct: 238 ADMSPMARSFYADNKRVSNRRIREELGVTLRYPDYKSGLRAVLAAEELQN 287


>gi|182680217|ref|YP_001834363.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636100|gb|ACB96874.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 291

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 155/290 (53%), Gaps = 3/290 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY+     D          GT R+   +  L    I+P LF  +K +  + +
Sbjct: 1   MKLFVFGLGYSALHFIDRFGASFETISGTVRTEEKVQQLASDQITPLLFGPEKEDPAILD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L     ++  I P    DP +    +         + I YLS+  +YG+R+GQWVDE  
Sbjct: 61  WLGAADAVIVSIPPGVSVDPVLSRFGRRIAGLH-RPQTIIYLSTIGVYGDRQGQWVDESR 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P S  A  R  AEK W A+ K     + VLRL+GIYGP RN  + +R   + R++K 
Sbjct: 120 PATPTSERARTRVQAEKSWAALGKSKEKNVHVLRLAGIYGPGRNALVNLRAGTAHRIIKP 179

Query: 181 NQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
           +QVFNRI V+D+A  +   + +     ++N+SDDEPAPPQ+V+  AA L+ +TPP E   
Sbjct: 180 DQVFNRIHVDDIASAIAGALAYDGRNEVWNVSDDEPAPPQDVVTYAAELLGVTPPPEITL 239

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           + A ISP TR FYA+NKR SN K+K  L  +L YP YR  L  LW+  E 
Sbjct: 240 EAAEISPLTRSFYAENKRASNLKLKQELRMELAYPTYREGLTALWEGGEG 289


>gi|254486086|ref|ZP_05099291.1| NAD-dependent epimerase/dehydratase [Roseobacter sp. GAI101]
 gi|214042955|gb|EEB83593.1| NAD-dependent epimerase/dehydratase [Roseobacter sp. GAI101]
          Length = 284

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 160/282 (56%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   +  G    GTTRS  N   +   G+ P ++    +  L+ E  
Sbjct: 5   LLSIGHGYSARALAARLIPQGWRILGTTRSADNADEIAATGVEPVVWPGADLGALIAE-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
               +I+    P  +GDP + +++ D  +  P++ W+GYLS+T +YG+  G WVDE + +
Sbjct: 63  --VPNILVSAGPGPDGDPVLNAVADDIARAAPNLSWLGYLSTTGVYGDHGGDWVDETTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI    ++ L + RL+GIYGP R PF K+R   + R++K  Q
Sbjct: 121 TPSTKRGHARVAAEARWQAIP---DLPLHIFRLAGIYGPGRGPFAKVRAGTARRIIKDGQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   + H   G I+NL DD+PAPP++VI  AA L+ +        + 
Sbjct: 178 VFSRIHVADIAQALDLSLHHPDPGAIYNLCDDDPAPPEDVIAHAAELLGLPVSPAIAIED 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA++K++ N +IK +LG+Q  +P YR+ L  +
Sbjct: 238 ADMTPMARSFYAESKKVRNDRIKQALGWQPSFPTYRVGLAAM 279


>gi|259417986|ref|ZP_05741905.1| NAD-dependent epimerase/dehydratase [Silicibacter sp. TrichCH4B]
 gi|259346892|gb|EEW58706.1| NAD-dependent epimerase/dehydratase [Silicibacter sp. TrichCH4B]
          Length = 315

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 160/282 (56%), Gaps = 14/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GYT + +A    +   +  GTTR   +     H  +  +   D  + N+     
Sbjct: 28  LLCFGYGYTARALAKILPRNEWHIIGTTRDTPDHSDDAHVELITWPGDDLPLQNV----- 82

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  I PS  GDP + ++       +P ++W+GYLS+T++YG+ +G+WVDE +  
Sbjct: 83  ---THILLSISPSEAGDPVLNALGTQI-AALPSLEWVGYLSTTAVYGDHDGRWVDEATPA 138

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S     R  AE +W A+ K   + L + RL+GIYGP R PF K+    + R+VK  Q
Sbjct: 139 TPSSQRGDWRVQAENDWSAVPK---LPLHIFRLAGIYGPGRGPFAKLMAGKARRIVKPGQ 195

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  V+D+A+ +   + H   G I+N+ DDEPAPPQ+V+  AA L+ +  P E  FD 
Sbjct: 196 VFSRAHVDDIAQVLKASIAHPDPGAIYNVCDDEPAPPQDVLGYAAELLGLPIPSEVPFDE 255

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A +SP  R FY +NKR+ N +IK  LG  LLYP+YR  L+ +
Sbjct: 256 AGMSPMARSFYGENKRVRNDRIKEDLGVDLLYPDYRSGLQAV 297


>gi|83950619|ref|ZP_00959352.1| hypothetical protein ISM_05955 [Roseovarius nubinhibens ISM]
 gi|83838518|gb|EAP77814.1| hypothetical protein ISM_05955 [Roseovarius nubinhibens ISM]
          Length = 287

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 157/282 (55%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + +A   L+ G    GTTR       L  +G+ P ++    I  +L +  
Sbjct: 5   LLSFGHGYSARALAAELLEHGWTIYGTTRDAEKAEALAEEGVQPIIWGQGDIEPILAK-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
             +THI+    P   GDP + +       +   + W GYLS+T +YG+  G WVDE + +
Sbjct: 63  --STHILISAGPDEAGDPVLNTYGDLIRDYAAQLDWAGYLSTTGVYGDHGGGWVDEETPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE +W A+     + L + RL+GIYGP R PF K+R+  + R++K  Q
Sbjct: 121 APSTRRGEMRQAAEAQWRAVP---GLPLHIFRLAGIYGPGRGPFAKVRRGTARRIIKPGQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +     G ++NL DD+PAPP+ VI  AA L+ +  P    FD 
Sbjct: 178 VFSRIHVEDIAQVLAASIARPDPGAVYNLCDDDPAPPEEVIAYAAELLGLPVPEAVDFDA 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A ++P  R FYA++KR+ N +IK +LG  L YP+YR  L+ L
Sbjct: 238 AEMTPMARSFYAESKRVRNDRIKEALGVTLRYPDYRAGLQAL 279


>gi|255264210|ref|ZP_05343552.1| NAD-dependent epimerase/dehydratase [Thalassiobium sp. R2A62]
 gi|255106545|gb|EET49219.1| NAD-dependent epimerase/dehydratase [Thalassiobium sp. R2A62]
          Length = 284

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 165/289 (57%), Gaps = 11/289 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + +A   L +     GTTRS     TL   GI P ++        L   L
Sbjct: 5   LLSFGHGYSAQALA-RILPLDWRIIGTTRSEDKAATLMADGIEPRVWP----GANLAPAL 59

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P +EGDP +     +  +  P ++W GYLS+T +YG+  G WVDE++ +
Sbjct: 60  NAATHLLISAAPDAEGDPVLRQFRDEITEIAPKLEWAGYLSTTGVYGDHNGDWVDENTAL 119

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE +W  I +   + L + RL+GIYGP R PF K+R   + R++K+ Q
Sbjct: 120 TPSTKRGLGRVEAEADWQTIPQ---LPLHIFRLAGIYGPGRGPFAKVRNGTARRIIKQGQ 176

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +   + G I+N+ DD+PAPP++VI  AA L+ +  P    F+T
Sbjct: 177 VFSRIHVEDIAQILAASIERPNPGAIYNMCDDDPAPPEDVIAHAAELLDMPIPPALDFET 236

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIENL 289
           A+++P  R FYA++K++ N +IK  LG  L YP YR  L  L K IEN+
Sbjct: 237 ADMTPMARSFYAESKKVRNDRIKDELGVALKYPTYRDGLAALLK-IENV 284


>gi|260431890|ref|ZP_05785861.1| NAD-dependent epimerase/dehydratase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415718|gb|EEX08977.1| NAD-dependent epimerase/dehydratase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 286

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 158/282 (56%), Gaps = 11/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L  FG GYT + ++      G    GTTR  +    ++  G  P ++  +  +      L
Sbjct: 5   LFSFGHGYTARALSRRLAPKGWRIVGTTRDAAEKDAIRAAGAEPLVWPGEAPD------L 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P+++GDP + ++  +         W+GYLS+T++YG+ +G WVDE +  
Sbjct: 59  DGVTHLLISTAPTAKGDPVLAALRDEIAARARQFAWVGYLSTTAVYGDHQGGWVDETTPA 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE++W AI     + L + RL+GIYGP R PF K+++    R++K  Q
Sbjct: 119 TPTAERGRWRLQAEQDWAAIP---GLPLHIFRLAGIYGPGRGPFSKLKKGGLRRIIKPGQ 175

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   M     G I+N+ DDEP PPQ+VI  AA L  +  P    FDT
Sbjct: 176 VFSRIHVEDIAQVLEASMRRPDPGAIYNVCDDEPVPPQDVIGYAAQLQGLPLPPAVDFDT 235

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A+++P  R FY +NKR+ N +IK+ LG  L YP+YR+ L+ L
Sbjct: 236 ADLTPMARSFYNENKRVRNDRIKADLGVTLKYPDYRVGLEAL 277


>gi|83942122|ref|ZP_00954584.1| hypothetical protein EE36_07798 [Sulfitobacter sp. EE-36]
 gi|83847942|gb|EAP85817.1| hypothetical protein EE36_07798 [Sulfitobacter sp. EE-36]
          Length = 284

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 161/282 (57%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++ + +A   +  G    GTTRS      +   G+ P ++    +  L+ +  
Sbjct: 5   LLSIGHGFSARALAARLVPQGWRIIGTTRSPDKADAIADTGVEPVVWPGADLGALIAQ-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
            F   +V    P S GDP + ++     +  P ++W+GYLS+T +YG+ +G WVDE + +
Sbjct: 63  -FPNVLVSA-GPDSAGDPVLNAVEDAVIRAAPDLRWVGYLSTTGVYGDHDGNWVDEDTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI    ++ L + RL+GIYGP R PF K+R   + R++K+ Q
Sbjct: 121 TPSTKRGRARVTAEARWQAIP---DLPLHIFRLAGIYGPGRGPFAKVRAGTARRIIKQGQ 177

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ + + L     G ++NL DD+PAPPQ+VI  AA+L+ +  P    FD 
Sbjct: 178 VFSRIHVEDIAQALELSLQRPDPGAVYNLCDDDPAPPQDVIAHAAALLGLPVPPAIPFDQ 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA++K++ N +IK +LG+   +P YR  L  L
Sbjct: 238 ADMTPMARSFYAESKKVRNDRIKQALGWAPQFPTYRAGLAAL 279


>gi|119383156|ref|YP_914212.1| NAD-dependent epimerase/dehydratase [Paracoccus denitrificans
           PD1222]
 gi|119372923|gb|ABL68516.1| NAD-dependent epimerase/dehydratase [Paracoccus denitrificans
           PD1222]
          Length = 287

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 156/277 (56%), Gaps = 8/277 (2%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M +++FG GY+  F+    L  G    GTTR  ++   +   G  P  +  Q+  + +R+
Sbjct: 2   MRMLVFGHGYSAGFLTPLLLAEGWQVTGTTRGATD--RVAQAGAEPLRWPGQE--DAVRK 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +     I+  + P    DP + +   +     P  +W+GYLS+T +YG+R+G WVDE +
Sbjct: 58  AIAQADAILISVGPEQGADPVLAAFGTEIAAARP--RWLGYLSTTGVYGDRDGGWVDEDT 115

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P +    +R  AE  W A   +  + L + RL+GIYGP R PF K+R   + R+VK 
Sbjct: 116 PCTPSTRRGRERVAAELGWQAFAAEHGLPLHIFRLAGIYGPGRGPFAKVRAGTARRIVKP 175

Query: 181 NQVFNRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            Q+F+RI  ED+A+ ++  +   H G I+N+ DD+PAPP+ VI  AA L+ +  P  + +
Sbjct: 176 GQIFSRIHAEDIAQVLLASIKAPHPGAIYNVCDDDPAPPEAVIGHAAELLGLPMPPAEDY 235

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
            +A ++P  R FYA+NKR+SN +IK  LG  L YP+Y
Sbjct: 236 ASAEMTPMARSFYAENKRVSNHRIKRELGVTLRYPDY 272


>gi|83953177|ref|ZP_00961899.1| hypothetical protein NAS141_12751 [Sulfitobacter sp. NAS-14.1]
 gi|83842145|gb|EAP81313.1| hypothetical protein NAS141_12751 [Sulfitobacter sp. NAS-14.1]
          Length = 284

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 159/282 (56%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++ + +A   +  G    GTTRS      +   G+ P ++    +  L+ +  
Sbjct: 5   LLSIGHGFSARALAARLVPQGWRIVGTTRSPDKADAIADTGVEPVVWPGADLGALIAQ-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
            F   +V    P S GDP + ++     +  P ++W+GYLS+T +YG+ +G WVDE + +
Sbjct: 63  -FPNVLVSA-GPDSAGDPVLNAVEDAVTRAAPDLRWVGYLSTTGVYGDHDGDWVDEDTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI    ++ L + RL+GIYGP R PF K+R   + R++K  Q
Sbjct: 121 TPSTKRGRARVTAEARWQAIP---DLPLHIFRLAGIYGPGRGPFAKVRAGTARRIIKPGQ 177

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ + + L     G ++NL DD+PAPPQ+VI  AA L+ +  P    FD 
Sbjct: 178 VFSRIHVEDIAQALELSLQRPDPGAVYNLCDDDPAPPQDVIAHAAELLGLPVPPAIPFDQ 237

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA++K++ N +IK +LG+   +P YR  L  L
Sbjct: 238 ADMTPMARSFYAESKKVRNDRIKQALGWAPQFPTYRAGLAAL 279


>gi|161170309|gb|ABX59279.1| nucleoside diphosphate sugar epimerase [uncultured marine bacterium
           EB000_55B11]
 gi|297183837|gb|ADI19960.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 291

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 164/282 (58%), Gaps = 12/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++   +    +K G    GTTRSV     L + G++  ++    +   +++  
Sbjct: 19  LLSIGHGFSASVLGAHLIKDGWTVYGTTRSVEKAKKLNNDGVNSIIWPGTNLTPYIQK-- 76

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  + P+S+GDP +   ++ F K      W+GYLS+T +YGN  G WVDE+S +
Sbjct: 77  --ATHILTSVSPNSQGDPVLDQYNEVFSKNT--FDWVGYLSTTGVYGNHNGGWVDENSPL 132

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W     KLN+ L + RL+GIYGP R PF K+R   + R++KK Q
Sbjct: 133 KPTTTRGQLREEAEFAW----SKLNVNLHIFRLAGIYGPGRGPFSKVRNGTARRIIKKGQ 188

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           +F+RI V+D+A+ ++  + +   G I+N+ DD PAPP++VI  AA L+ +  PL   ++ 
Sbjct: 189 LFSRIHVDDIAQVLLASIXYPRQGAIYNVCDDXPAPPEDVIAYAAELLGMPIPLAVDYNE 248

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA+NKR+ N  IK  LG +L +P+Y   L+ L
Sbjct: 249 ADMTPMARSFYAENKRVRNDLIKEELGIELKFPDYXTGLQSL 290


>gi|119713557|gb|ABL97609.1| hypothetical protein MBMO_EB0-39F01.0020 [uncultured marine
           bacterium EB0_39F01]
          Length = 277

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 165/282 (58%), Gaps = 12/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++   +    +K G    GTTRSV     L + G++  ++    +   +++  
Sbjct: 5   LLSIGHGFSASVLGAHLIKDGWTVYGTTRSVEKAKKLNNDGVNSIIWPGTNLTPYIQK-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  + P+S+GDP +   ++ F K      W+GYLS+T +YGN  G WVDE+S +
Sbjct: 63  --ATHILTSVSPNSQGDPVLDQYNEVFSKNT--FDWVGYLSTTGVYGNHNGGWVDENSPL 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W     KLN+ L + RL+GIYGP R PF K+R   + R++K+ Q
Sbjct: 119 KPTTTRGQLREEAEFAW----SKLNVNLHIFRLAGIYGPGRGPFSKVRNGTARRIIKEGQ 174

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           +F+RI V+D+A+ ++  + +   G I+N+ DD PAPP++VI  AA L+ +  PL   ++ 
Sbjct: 175 LFSRIHVDDIAQVLLASIRYPRQGAIYNVCDDTPAPPEDVIAYAAELLGMPIPLAVDYNE 234

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA+NKR+ N  IK  LG +L +P+Y+  L+ L
Sbjct: 235 ADMTPMARSFYAENKRVRNDLIKEELGIELKFPDYKTGLQSL 276


>gi|16125307|ref|NP_419871.1| hypothetical protein CC_1055 [Caulobacter crescentus CB15]
 gi|221234045|ref|YP_002516481.1| nucleoside-diphosphate-sugar epimerase [Caulobacter crescentus
           NA1000]
 gi|13422353|gb|AAK23039.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963217|gb|ACL94573.1| nucleoside-diphosphate-sugar epimerase [Caulobacter crescentus
           NA1000]
          Length = 286

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 155/286 (54%), Gaps = 5/286 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY G   ADA    G     + R       L+ KGI+P   AD    + +  
Sbjct: 1   MRLFVFGLGYVGAAFADALQDRGWDIAASARDPGQAQALRDKGITP---ADPADRDAMIA 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L     I+    P  +G P + S+     +   +  WIGYLS+T +YG+ EG+WV E S
Sbjct: 58  ALAGVNAILITAPPGPDGCPALESIVPALAQAQAYPDWIGYLSTTGVYGDFEGRWVFETS 117

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +   S    +R  AE++W  + + + + +   RL GIYGP R+   ++R     R+VK 
Sbjct: 118 PLKAQSVEGARRVGAERDWRQVGRGMGLTVTTFRLPGIYGPGRSALDRLRAGEGRRIVKP 177

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+   ++  + H   GG++NL DDEPAPPQ+V+  AA L+ +  P +  F
Sbjct: 178 GQVFSRIHVDDIVSGLLASLDHPRAGGVYNLVDDEPAPPQDVMEHAARLLGVPVPPDLPF 237

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
           +    SP TR FYA+NKR+SNA+ K+ LG++  +P YR  L  + K
Sbjct: 238 NELGTSPATRRFYAENKRVSNARAKAELGWRPKHPTYREGLAAILK 283


>gi|114769812|ref|ZP_01447422.1| hypothetical protein OM2255_09596 [alpha proteobacterium HTCC2255]
 gi|114549517|gb|EAU52399.1| hypothetical protein OM2255_09596 [alpha proteobacterium HTCC2255]
          Length = 277

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 165/282 (58%), Gaps = 12/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++   +    +K G    GTTRSV     L + G++  ++    +   +++  
Sbjct: 5   LLSIGHGFSASVLGAHLIKDGWTVYGTTRSVEKAKKLNNDGVNSIIWPGTNLTPYIQK-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  + P+S+GDP +   ++ F K      W+GYLS+T +YGN  G WVDE+S +
Sbjct: 63  --ATHILTSVSPNSQGDPVLDQYNEVFSKNT--FDWVGYLSTTGVYGNHNGGWVDENSPL 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W     KLN+ L + RL+GIYGP R PF K+R   + R++K+ Q
Sbjct: 119 KPTTTRGQLREEAEFAW----SKLNVNLHIFRLAGIYGPGRGPFSKVRNGTARRIIKEGQ 174

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           +F+RI V+D+A+ ++  + +   G I+N+ DD PAPP++VI  AA L+ +  PL   ++ 
Sbjct: 175 LFSRIHVDDIAQVLLASIRYPRQGAIYNVCDDTPAPPEDVIAYAAELLGMPIPLAVDYNE 234

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA+NKR+ N  IK  LG +L +P+Y+  L+ L
Sbjct: 235 ADMTPMARSFYAENKRVRNDLIKEELGIELKFPDYKTGLQSL 276


>gi|84514692|ref|ZP_01002056.1| hypothetical protein SKA53_10739 [Loktanella vestfoldensis SKA53]
 gi|84511743|gb|EAQ08196.1| hypothetical protein SKA53_10739 [Loktanella vestfoldensis SKA53]
          Length = 286

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 154/282 (54%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG G++   +A   L  G    GTTRS      L   GI P ++        +R  L
Sbjct: 5   LLSFGHGFSADALARILLPQGWRIIGTTRSEDKAARLHQAGIEPRIWPGAD----MRPAL 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P   GDP +  +  +         W+GYLS+T +YG+  G WVDE + +
Sbjct: 61  DAATHLLVSAAPDDNGDPVLAQLQAEITARAGQFAWVGYLSTTGVYGDHAGDWVDETTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W  I    ++ L + RL+GIYGP R PF K+R  ++ R++K  Q
Sbjct: 121 APATKRGIARVQAEAAWATIP---DLALHIFRLAGIYGPGRGPFAKVRDGSARRIIKPGQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  V D+A+ +   +   + G I+N+ DD+PAPP++VI  AA L+ +  P  Q F T
Sbjct: 178 VFSRTHVADIAQVLAASIARPNPGAIYNVCDDDPAPPEDVIGYAAELLGLPLPPAQDFAT 237

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FYA++K++ N +IK  LG +L+YP+YR  L+ L
Sbjct: 238 AEMTPMARSFYAESKKVRNDRIKDELGVRLIYPDYRRGLQAL 279


>gi|99082772|ref|YP_614926.1| NAD-dependent epimerase/dehydratase [Ruegeria sp. TM1040]
 gi|99039052|gb|ABF65664.1| conserved hypothetical protein [Ruegeria sp. TM1040]
          Length = 301

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 159/282 (56%), Gaps = 14/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GYT + +A    +      GTTR           G+    +  Q +       L
Sbjct: 14  LLCFGFGYTARALAKILPRDAWRIIGTTRDRCE--DQSESGVELMTWPGQDV------PL 65

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  I PS +GDP + ++  +    +P ++WIGYLS+T++YG+ +G WVDE +  
Sbjct: 66  RDVTHILLSISPSEDGDPVLNALGAEIAA-LPSLEWIGYLSTTAVYGDHDGGWVDEMTPA 124

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S     R  AE+EW ++     + L + RL+GIYGP R PF K+    + R+VK  Q
Sbjct: 125 TPSSQRGNWRVRAEEEWSSLA---GLPLHIFRLAGIYGPGRGPFAKLMAGKARRIVKPGQ 181

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  VED+A+ +   +   + G I+N+ DDEPAPPQ+V+  AA L+ +  P E  FD 
Sbjct: 182 VFSRAHVEDIAQVLKASIQAPNPGAIYNVCDDEPAPPQDVLGYAAELLGLPIPSEVPFDE 241

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A +SP  R FY +NKR+ NA+IK  LG +L YP+YR  L+ +
Sbjct: 242 AGMSPMARSFYGENKRVRNARIKDELGVKLRYPDYRSGLQAV 283


>gi|254510820|ref|ZP_05122887.1| NAD-dependent epimerase/dehydratase [Rhodobacteraceae bacterium
           KLH11]
 gi|221534531|gb|EEE37519.1| NAD-dependent epimerase/dehydratase [Rhodobacteraceae bacterium
           KLH11]
          Length = 274

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 149/260 (57%), Gaps = 11/260 (4%)

Query: 28  GTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSK 87
           GTTR    L  ++  G  P ++   + +      L   TH++    P+++GDP +  +  
Sbjct: 14  GTTRDPKQLEAIRASGAEPRIWPGAQPD------LEGVTHLLISTAPTADGDPVLAELRA 67

Query: 88  DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN 147
                    KW+GYLS+T++YG+ +G WVDE +   P +     R  AE +W  +    N
Sbjct: 68  GIAAHAGQFKWVGYLSTTAVYGDHQGGWVDETTPTAPTAERGRWRVRAETQWAGVP---N 124

Query: 148 IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGG 206
           + L + RL+GIYGP R PF K+R+    R++K  QVF+R+ VED+A+ +I  M   + G 
Sbjct: 125 LPLHIFRLAGIYGPGRGPFSKLRRAGLRRIIKPGQVFSRVHVEDIAQVLIASMGRPNPGA 184

Query: 207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS- 265
           I+N+ DDEP PPQ+VI  AA L  +  P    FD A+++P  R FY +NKR+ N +IK  
Sbjct: 185 IYNVCDDEPVPPQDVIGYAAELQGLPLPPAVPFDKADLTPMARSFYNENKRVRNNRIKDE 244

Query: 266 LGFQLLYPNYRISLKQLWKE 285
           LG  LLYPNYR+ L+ L ++
Sbjct: 245 LGVSLLYPNYRLGLEALMRD 264


>gi|254450939|ref|ZP_05064376.1| NAD-dependent epimerase/dehydratase [Octadecabacter antarcticus
           238]
 gi|198265345|gb|EDY89615.1| NAD-dependent epimerase/dehydratase [Octadecabacter antarcticus
           238]
          Length = 285

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 157/276 (56%), Gaps = 11/276 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + +    L       GTTRS      L  +GI P ++    +   L+   
Sbjct: 5   LLSFGHGYSARALT-TLLPDDWRVIGTTRSEDKAAALMAEGIEPRIWPGADLTPALKS-- 61

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    PS  GDP +  +  +        +W+GYLS+T +YG+ +G WVDE++ +
Sbjct: 62  --ATHLLISAGPSEAGDPVLNELRDEIADRRDQFEWVGYLSTTGVYGDHDGGWVDENTPL 119

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R +AE  W    + L + L + RL+GIYGP R PF K+R   + R++K  Q
Sbjct: 120 SPSTKRGQMRVDAELAW----QLLGLPLHIFRLAGIYGPGRGPFSKVRNGTARRIIKDGQ 175

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   +   + G I+NL DD+PAPPQ+VI  AA L+ +  P EQ F  
Sbjct: 176 VFSRIHVADIAQTLAASIAQPNPGAIYNLCDDDPAPPQDVIAHAAELLGLPIPPEQDFAN 235

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYR 276
           A+++P  R FYA++K++ N +IK+ LG +L YP+YR
Sbjct: 236 ADLTPMARSFYAESKKVRNDRIKTDLGVKLTYPDYR 271


>gi|254439038|ref|ZP_05052532.1| RmlD substrate binding domain superfamily [Octadecabacter
           antarcticus 307]
 gi|198254484|gb|EDY78798.1| RmlD substrate binding domain superfamily [Octadecabacter
           antarcticus 307]
          Length = 308

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 155/276 (56%), Gaps = 11/276 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + +    L       GTTRS      L   G  P ++        L   L
Sbjct: 28  LLSFGHGYSARALT-TLLSDDWRVIGTTRSDEKAAALMAGGTEPRIWPGAD----LTPAL 82

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    PS  GDP +  +  +        +W+GYLS+T +YG+ +G WVDE++ +
Sbjct: 83  NAATHLLISAGPSDAGDPVLNELRSEIASRRDQFEWVGYLSTTGVYGDHDGGWVDENTPL 142

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
           +P +     R +AE  W    + L + L + RL+GIYGP R PF K+R   + R++K  Q
Sbjct: 143 NPSTKRGQMRVDAETAW----QSLGLPLHIFRLAGIYGPGRGPFAKVRNGTARRIIKDGQ 198

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V D+A+ +   +   + G I+NL DD+PAPPQ+VI  AA L+ +  P  Q F  
Sbjct: 199 VFSRIHVADIAQTLAASIAQPNSGAIYNLCDDDPAPPQDVIAHAAELLGMATPPAQNFAV 258

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYR 276
           A+++P  R FYA++K++ N +IKS LG +L+YP+YR
Sbjct: 259 ADLTPMARSFYAESKKVRNDRIKSELGVKLIYPDYR 294


>gi|294675809|ref|YP_003576424.1| NAD-dependent epimerase/dehydratase family protein [Rhodobacter
           capsulatus SB 1003]
 gi|294474629|gb|ADE84017.1| NAD-dependent epimerase/dehydratase family protein [Rhodobacter
           capsulatus SB 1003]
          Length = 275

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 160/282 (56%), Gaps = 13/282 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY+ + +A   L  G     TTRS +    L+ +G+ P ++   ++       L
Sbjct: 4   LLSIGHGYSARALARLLLPEGWRIIATTRSAAKAEMLRAEGVEPLVWTGGEL------PL 57

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  + P   GDP +++  ++      H++W+GYLS+  +YG+  G WVDE + +
Sbjct: 58  AEATHLLTSVAPDGAGDP-VLAAQRNAIAASRHLEWVGYLSTVGVYGDHGGGWVDEDTPL 116

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +    QR  AE  W A    L + L V RL+GIYGP R PF K+R   +  ++K  Q
Sbjct: 117 TPSTTRGLQRVAAEAAWQA----LGLPLHVFRLAGIYGPGRGPFEKVRDGTARLVIKPGQ 172

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI VED+A+ +   +   + G ++N+ DD P+PP++V+  AA L+ +  P E  FD 
Sbjct: 173 VFSRIHVEDIAQVLAASIARPNPGRVYNVCDDAPSPPEDVLAYAAELLGLPRPPEVPFDP 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A+++P    FYA+NKR+ N +IK+ LG  L YP+YR  L+ +
Sbjct: 233 ASMTPMAASFYAENKRVRNDRIKTELGVTLRYPDYRAGLEAM 274


>gi|126741032|ref|ZP_01756715.1| hypothetical protein RSK20926_07998 [Roseobacter sp. SK209-2-6]
 gi|126717958|gb|EBA14677.1| hypothetical protein RSK20926_07998 [Roseobacter sp. SK209-2-6]
          Length = 290

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 161/284 (56%), Gaps = 16/284 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +            GTTR    +      G    L+    +       L
Sbjct: 5   LLCLGFGYTARALVRQLPLDQWRIIGTTRDAVEV-----DGAEMLLWPGSSL------PL 53

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  I P ++GDP +  + ++       +KW+GYLS+T++YG+R+G WVDE S +
Sbjct: 54  EQVTHLLVSISPDAQGDPVLAQLREEIAARTNQLKWVGYLSTTAVYGHRDGAWVDEASPL 113

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S     R  AE++W  +    ++ L + RL+GIYGP R PF K+    + R++K  Q
Sbjct: 114 APTSERGRWRVRAEEQWQEVP---DLPLHIFRLAGIYGPGRGPFAKLMAGKARRIIKPGQ 170

Query: 183 VFNRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+A+ ++  +   + G I+NL DD+PAPPQ+V+  AA L+++  P E  +D 
Sbjct: 171 VFSRIHVDDIAQVLLASIQRPNPGSIYNLCDDDPAPPQDVLGYAAELLQLPMPAEVPYDE 230

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
           A +SP  R FY++NKR+ N +IKS LG +LLYP YR  L+ + K
Sbjct: 231 AGMSPMARSFYSENKRVRNNRIKSELGVELLYPTYREGLQAVLK 274


>gi|288941406|ref|YP_003443646.1| NAD-dependent epimerase/dehydratase [Allochromatium vinosum DSM
           180]
 gi|288896778|gb|ADC62614.1| NAD-dependent epimerase/dehydratase [Allochromatium vinosum DSM
           180]
          Length = 294

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 151/286 (52%), Gaps = 3/286 (1%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L  FG GYTG  +A AA+  G    GT R       L+ +GI   +F   + +  +RE L
Sbjct: 6   LFCFGLGYTGTRLAQAAIAHGWRVAGTCRDAGKAQALRTQGIQALVFDGHQSSPEVREAL 65

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  I P ++GDP      K        + WIGYLS+T +YG+  G W+DE    
Sbjct: 66  AGATHLLVSIPPEADGDPAWRLHGKTLEARGGSLAWIGYLSTTGVYGDCGGDWIDETRTP 125

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPK-RNPFIKIRQKNSLRLVKKN 181
           +P +    +R  AE  WL +  +      + RL GIYGP  R+    +    + R++K  
Sbjct: 126 NPATLENQRRLEAESVWLDLGARTASPTHIFRLPGIYGPAGRSVIDALESGRARRILKPG 185

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           QVFNRI V+D+   ++  M     G I+N++DD+PAP   V+  AA L+ + PP    F+
Sbjct: 186 QVFNRIHVDDLVTVLLASMERPSAGRIYNVADDQPAPADTVLCHAAVLIGVEPPPAVRFE 245

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKE 285
            A +SPF R FYA+ KR+SN +IK  LG QL YP YR  L  +  E
Sbjct: 246 EAELSPFARHFYAECKRLSNERIKQELGVQLRYPTYREGLHAIAAE 291


>gi|159045831|ref|YP_001534625.1| hypothetical protein Dshi_3291 [Dinoroseobacter shibae DFL 12]
 gi|157913591|gb|ABV95024.1| hypothetical protein Dshi_3291 [Dinoroseobacter shibae DFL 12]
          Length = 290

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 157/285 (55%), Gaps = 8/285 (2%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + ++   L  G    GTTRS      L+ +GI   ++        L   +
Sbjct: 5   LLSFGHGYSARALSRLLLPGGWRIIGTTRSAEKAAALEAEGIEARVWPGAD----LSADI 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+    P+  GDP +    +      P   W+GYLS+T +YG+ +G WVDE + +
Sbjct: 61  AAATHILTSAAPTDAGDPVLAEWREALAAAQP--DWVGYLSTTGVYGDHQGDWVDETAAL 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE EW A+  + ++ L + RL+GIYGP R PF K+R   + R++K+ Q
Sbjct: 119 TPATRRGQLRVAAEAEWRALADEADLPLHIFRLAGIYGPGRGPFSKVRNGTARRIIKEGQ 178

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  V+D+A+ +   +   + G  +N+ DD+PAPP++VI  AA L+ +  P       
Sbjct: 179 VFSRTHVDDIAQVLAASIARPNPGAAYNVCDDDPAPPEDVIAHAAELLGLPIPPAIPIAE 238

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
           A +SP  R FYA++K++ N +IK  LG +L+YP+YR  L  +  E
Sbjct: 239 AEMSPMARSFYAESKKVRNDRIKDELGVRLIYPDYRAGLAAMLAE 283


>gi|295690584|ref|YP_003594277.1| NAD-dependent epimerase/dehydratase [Caulobacter segnis ATCC 21756]
 gi|295432487|gb|ADG11659.1| NAD-dependent epimerase/dehydratase [Caulobacter segnis ATCC 21756]
          Length = 286

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 156/284 (54%), Gaps = 5/284 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY G+  A+A    G     T R+      L+ KG+S     D    + +  
Sbjct: 1   MRLFVFGLGYVGEAFANALRARGWEIAATARTPQQAQALQAKGVS---VVDPGDRDAMAR 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L     I+    P  +G P + S+     +      WIGYLS+T +YG+ +G+WV E S
Sbjct: 58  VLTGVNAILVTAPPGPDGCPALESIVPALAQAQAFPDWIGYLSTTGVYGDFDGRWVFETS 117

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +   S    +R  AE++W  + + + + + V RL GIYGP R+   ++R     R+VK 
Sbjct: 118 PLKAQSVEGARRVGAERDWQEVGRGMGLTVTVFRLPGIYGPGRSALDRLRAGEGRRIVKP 177

Query: 181 NQVFNRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+   ++  L     GG++NL DDEPAPPQ+V+ +AA L+    P +  F
Sbjct: 178 GQVFSRIHVDDIVSGLLASLDKPRAGGVYNLVDDEPAPPQDVMEQAARLLGAPVPPDLPF 237

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           +   +SP TR FYA+NKR+SNA++K+ LG++  YP YR  L+ +
Sbjct: 238 NELGLSPATRRFYAENKRVSNARVKAELGWRPAYPTYREGLQAI 281


>gi|254475770|ref|ZP_05089156.1| NAD-dependent epimerase/dehydratase [Ruegeria sp. R11]
 gi|214030013|gb|EEB70848.1| NAD-dependent epimerase/dehydratase [Ruegeria sp. R11]
          Length = 320

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 165/291 (56%), Gaps = 16/291 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +A   L+ G    GTTRS  + + +   G+    +    ++      L
Sbjct: 30  LLCLGFGYTARALAPQLLQAGWKVIGTTRSADDAVPVH--GVELITWPGAPLS------L 81

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQWVDEHS 120
              THI+  + P++EGDP +  ++    +      ++W+GYLS+T++YG+ +G WVDE +
Sbjct: 82  DGVTHILSSVGPTAEGDPVLNDLADALAEAAQGDTLEWVGYLSTTAVYGDHDGAWVDEDT 141

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V P S     R  AE  W  I    ++ L + RL+GIYGP R PF K+    + R+VK 
Sbjct: 142 AVTPSSQRGRWRAAAETGWQTIP---DLPLHIFRLAGIYGPGRGPFAKLMAGKARRIVKP 198

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+A+ +   +     G I+NL DD+PAPPQ+V+  AA L+ +  P E  F
Sbjct: 199 GQVFSRIHVDDIAQVLAASIARPDPGAIYNLCDDDPAPPQDVLGFAAELLGLPVPAEVPF 258

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIENL 289
           D A ++P  R FY +NKR+ N +IK  LG  LLYP+YR  L+ + +  E+L
Sbjct: 259 DEAGMTPMARSFYGENKRVRNQRIKDDLGVDLLYPSYREGLRAV-RAAEDL 308


>gi|163737899|ref|ZP_02145315.1| NAD-dependent epimerase/dehydratase [Phaeobacter gallaeciensis
           BS107]
 gi|161388515|gb|EDQ12868.1| NAD-dependent epimerase/dehydratase [Phaeobacter gallaeciensis
           BS107]
          Length = 295

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 168/292 (57%), Gaps = 18/292 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +A   L+ G    GTTRSV + + +    +  +  A   ++ +     
Sbjct: 5   LLCLGFGYTARALAPRLLQAGWRVIGTTRSVEDAVPVPGVDLITWPGAPLSLDGV----- 59

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH---VKWIGYLSSTSIYGNREGQWVDEH 119
              THI+  + P+  GDP +++   D      H   ++W+GYLS+T++YG+ +G WVDE 
Sbjct: 60  ---THILSSVGPTEAGDP-VLAELADALAAAAHGDTLEWVGYLSTTAVYGDHDGAWVDED 115

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           + V P S     R  AE  W AI    ++ L + RL+GIYGP R PF K+    + R+VK
Sbjct: 116 TAVTPSSQRGRWRAAAETGWQAIP---DLPLHIFRLAGIYGPGRGPFAKLMAGKARRIVK 172

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             QVF+RI V+D+A+ +   +   + G ++NL D++PAPPQ+V+  AA L+ +  P E  
Sbjct: 173 PGQVFSRIHVDDIAQVLAASIAQPNPGAVYNLCDNDPAPPQDVLGFAAELLGLPVPAEVP 232

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIENL 289
           FD A ++P  R FY +NKR++N +IK  LG +LLYP YR  L+ + +  E+L
Sbjct: 233 FDEAGMTPMARSFYGENKRVANQRIKDDLGVELLYPTYREGLRAV-RAAEDL 283


>gi|254463772|ref|ZP_05077183.1| NAD-dependent epimerase/dehydratase [Rhodobacterales bacterium Y4I]
 gi|206684680|gb|EDZ45162.1| NAD-dependent epimerase/dehydratase [Rhodobacterales bacterium Y4I]
          Length = 289

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 158/282 (56%), Gaps = 17/282 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +A      G    GT+R       ++  G+    +  Q++       L
Sbjct: 5   LLCLGFGYTARALAPRLQAGGWRVIGTSRD-----PVEADGVEMITWPGQEV------PL 53

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              THI+  I P++EGDP + ++          ++W+GYLS+T++YG+ +G WVDE + V
Sbjct: 54  DGVTHILNSIGPNAEGDPVLAAIGSRIAAAS-GLEWVGYLSTTAVYGHHDGAWVDEDTPV 112

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S     R  AE +W AI     + L + RL+GIYGP R PF K+    + R++K  Q
Sbjct: 113 TPSSQRGDWRALAEAQWQAIP---GLPLHIFRLAGIYGPGRGPFAKLMAGKARRIIKPGQ 169

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+RI V+D+A+ +   +     G I+N+ DD+PAPPQ+V+  AA L+ +  P E  FD 
Sbjct: 170 VFSRIHVDDIAQVLAASIAQPRPGAIYNVCDDDPAPPQDVLGHAAELLGLPMPAEVPFDE 229

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A ++P  R FY +NKR+ N +IK  LG +LLYP YR  L+ +
Sbjct: 230 AGMTPMARSFYGENKRVRNRRIKDELGVELLYPTYREGLRAV 271


>gi|110677993|ref|YP_681000.1| hypothetical protein RD1_0614 [Roseobacter denitrificans OCh 114]
 gi|109454109|gb|ABG30314.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 281

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 152/282 (53%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G G++ + +A   +  G    GTTRS      +   G+ P ++       +L++  
Sbjct: 6   LLSLGHGFSARALATRLIPAGWRVIGTTRSADKAAEIAQTGVEPLIWPGADAETVLQD-- 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              T ++    P  +GDP +  +           +W+GYLS+T +YG+  G WVDE + +
Sbjct: 64  --ATALLISAGPDKDGDPVLRQLHAQIASHAKQFQWVGYLSTTGVYGDHGGDWVDEDTPL 121

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI     + L + RL+GIYGP R PF K+R   + R++KK Q
Sbjct: 122 TPSTARGQARVEAEAAWQAIP---GLPLHIFRLAGIYGPGRGPFSKVRAGTARRIIKKGQ 178

Query: 183 VFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  V+D+A+ +   +     G I+N+ DD PAPPQ+VI  AA L+ +  P    F+T
Sbjct: 179 VFSRTHVDDIAQVLEASIRQPRPGAIYNVCDDNPAPPQDVIGHAAELLGLPLPPAVDFET 238

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           A+++P  R FYA++K++ N  IK  LG  L YP+YR  LK +
Sbjct: 239 ADMTPMARSFYAESKKVRNDLIKRELGVVLKYPDYRSGLKAM 280


>gi|167645165|ref|YP_001682828.1| NAD-dependent epimerase/dehydratase [Caulobacter sp. K31]
 gi|167347595|gb|ABZ70330.1| NAD-dependent epimerase/dehydratase [Caulobacter sp. K31]
          Length = 294

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 157/286 (54%), Gaps = 5/286 (1%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG GY G+  A+A +  G    G TR V     L+ KGI   + AD K    +  
Sbjct: 1   MRLFVFGLGYVGQAFAEALIARGWSVVGATRDVDKARALRAKGID-TVDADDKAA--MTT 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L     ++    P+++G P + ++            WIGYLS+T +YG+ EG+WV E S
Sbjct: 58  ALTGVNAVLITAPPTADGCPGLEAVIPALAAAQAFPDWIGYLSTTGVYGDFEGRWVFESS 117

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +   S    +R  AE++W  + + + + +   RL GIYGP R+   ++R     R+VK 
Sbjct: 118 PLKAQSVEGARRVGAERDWQEVGRGMGLTVTTFRLPGIYGPGRSALDRLRAGEGRRIVKP 177

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI ++D+   ++  +     GG++NL DDEPAPPQ+V+  AA L+ +  P +  F
Sbjct: 178 GQVFSRIHLDDIVSGLLASLDRPRAGGVYNLCDDEPAPPQDVMEHAARLLGVAVPPDLPF 237

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
           +   +SP TR FYA+NKR+SNA  K+ LG++  YP YR  L  + K
Sbjct: 238 NELGLSPATRRFYAENKRVSNALAKAELGWRPKYPTYREGLAAILK 283


>gi|163743325|ref|ZP_02150705.1| hypothetical protein RG210_07475 [Phaeobacter gallaeciensis 2.10]
 gi|161383319|gb|EDQ07708.1| hypothetical protein RG210_07475 [Phaeobacter gallaeciensis 2.10]
          Length = 295

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 163/291 (56%), Gaps = 16/291 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GYT + +    L+ G    GTTRS  + + +    +  +  A   ++ +     
Sbjct: 5   LLCLGFGYTARALVPRLLQAGWRVIGTTRSAEDAVPVPGVDLITWPGAPLSLDGV----- 59

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWVDEHS 120
              THI+  + P+  GDP +  ++           ++W+GYLS+T++YG+ +G WVDE +
Sbjct: 60  ---THILSSVGPTEAGDPVLAELADALAAAARGDTLEWVGYLSTTAVYGDHDGAWVDEDT 116

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V P S     R  AE +W AI    ++ L + RL+GIYGP R PF K+    + R+VK 
Sbjct: 117 AVTPSSQRGRWRAAAEADWQAIA---DLPLHIFRLAGIYGPGRGPFAKLMAGKARRIVKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+A+ +   +     G I+NL DD+PAPPQ+V+  AA L+ +  P E  F
Sbjct: 174 GQVFSRIHVDDIAQALAASIAQPAPGAIYNLCDDDPAPPQDVLGFAAELLGLPIPAEVPF 233

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIENL 289
           D A ++P  R FY +NKR++N +IK  L  +LLYP YR  L+ + +  E+L
Sbjct: 234 DEAGMTPMARSFYGENKRVANQRIKDELEVELLYPTYREGLRAV-RAAEDL 283


>gi|126734207|ref|ZP_01749954.1| hypothetical protein RCCS2_08609 [Roseobacter sp. CCS2]
 gi|126717073|gb|EBA13937.1| hypothetical protein RCCS2_08609 [Roseobacter sp. CCS2]
          Length = 286

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 155/282 (54%), Gaps = 9/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+ FG GY+ + ++   L       GTTRS      L ++G+ P ++        +   L
Sbjct: 5   LLSFGHGYSARALSRILLPQDWRIIGTTRSEDKAPRLMNEGVEPRIWPGAD----MIPAL 60

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P   GDP +  +  +        +W+GYLS+T +YG+  G WVDE++ +
Sbjct: 61  NAATHLLISAGPDDAGDPVLAKLHDEIASRAAQFEWVGYLSTTGVYGDHSGDWVDENTPL 120

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE  W AI     + L + RL+GIYGP R PF K+R   + R++KK Q
Sbjct: 121 TPATKRGIARVEAEAAWSAIP---GLPLHIFRLAGIYGPGRGPFAKVRNGTARRIIKKGQ 177

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VF+R  V D+AR +   +   + G  +N+ D++PAPPQ+VI  AA L+ +  P    F+T
Sbjct: 178 VFSRTHVADIARVLAASINKPNAGTAYNVCDNDPAPPQDVIAYAAELLGLPIPEAVDFET 237

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A +S   R FYA++K++ N +IK  LG +LLYP+Y+  LK L
Sbjct: 238 AEMSAMARSFYAESKKVRNDRIKDELGVELLYPDYKSGLKAL 279


>gi|89052764|ref|YP_508215.1| NAD-dependent epimerase/dehydratase [Jannaschia sp. CCS1]
 gi|88862313|gb|ABD53190.1| NAD-dependent epimerase/dehydratase [Jannaschia sp. CCS1]
          Length = 282

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 160/284 (56%), Gaps = 11/284 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+L+IFG G++ K +A A  +    T  T  S      +  +G  P LF      + L +
Sbjct: 1   MNLLIFGYGFSSKALARALPQTWTITATTRTSEK---AMNMRGAEPRLFP----GDDLSQ 53

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +   TH++    P    DP + +    F K  P  +W+GYLS+T +YG+ +G WV E +
Sbjct: 54  DIADATHVLISAGPDDGHDPVLATYRDAFAKAKP--EWVGYLSTTGVYGDHQGGWVTEDT 111

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            + P +     R  AE EW+A+ +   + + + RL+GIYGP R PF K+R   + R++K+
Sbjct: 112 PLVPSTKRGEARVAAEAEWMALHQDHGLPVHIFRLAGIYGPGRGPFAKVRNGTARRIIKE 171

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+R  V+D+A+ ++  +   + G  +N+ DD+PAPPQ+VI  AA L+ +  P    F
Sbjct: 172 GQVFSRTHVDDIAQVLMASIARPNPGAAYNVCDDDPAPPQDVIAHAADLLGLPIPEAIPF 231

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           + A ++P  R FYA++KR+ N +IK  LG  LLYP+YR  L  L
Sbjct: 232 EDAEMTPMGRSFYAESKRVDNTRIKDELGVTLLYPDYRSGLAAL 275


>gi|84500594|ref|ZP_00998843.1| hypothetical protein OB2597_11566 [Oceanicola batsensis HTCC2597]
 gi|84391547|gb|EAQ03879.1| hypothetical protein OB2597_11566 [Oceanicola batsensis HTCC2597]
          Length = 255

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 139/238 (58%), Gaps = 5/238 (2%)

Query: 50  ADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYG 109
           A   +   L   L   TH++    P   GDP +  + ++  +  P ++W GYLS+T +YG
Sbjct: 13  AGHAVPGDLSGPLSEATHLLISAGPDEGGDPMLKVLREEILRKAPQLEWAGYLSTTGVYG 72

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           + +G WVDE + + P +     R  AE EW +I     + L + RL+GIYGP R PF K+
Sbjct: 73  DHDGAWVDESTPLTPTTRRGALRVAAEAEWRSIP---GLPLHIFRLAGIYGPGRGPFFKV 129

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASL 228
           R   + R+VK  QVF+RI VED+A+ +   +     G ++NL DD+PAPPQ+VI  AA L
Sbjct: 130 RSGRARRIVKPGQVFSRIHVEDIAQVLAASIERPDPGAVYNLCDDDPAPPQDVIAYAAQL 189

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
           + +  P E+ F+TA ++P  R FYA++KR+ N KIK+ L  +L YP YR  L  L  E
Sbjct: 190 LGLPLPPEEDFETAEMTPMARSFYAESKRVRNRKIKTDLDVRLKYPTYREGLAALLAE 247


>gi|220925266|ref|YP_002500568.1| NAD-dependent epimerase/dehydratase [Methylobacterium nodulans ORS
           2060]
 gi|219949873|gb|ACL60265.1| NAD-dependent epimerase/dehydratase [Methylobacterium nodulans ORS
           2060]
          Length = 293

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 105/287 (36%), Positives = 160/287 (55%), Gaps = 10/287 (3%)

Query: 1   MHLMIFGAGYT-GKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M+L +FG GYT G F+     + G      T     L     +G++  +F+  + +  + 
Sbjct: 1   MNLFVFGLGYTAGHFVERE--RGGFARVAAT--AQALRAPAPEGVAMRIFSPGEADPRIV 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           E L  +  I+  + P  +GDP + + + D     P  +WIGYLS+  +YG++ G W+DE 
Sbjct: 57  EDLARSDAILVSVPPQ-DGDPVLRAYA-DAIAASP-ARWIGYLSTIGVYGDQGGAWIDEA 113

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +   P      +R   E+ WLA+  +    + + RLSGIYGP RN F+K+R+  + R+VK
Sbjct: 114 TPPAPTHARTRERVAVEEAWLALGARTAKAVQIFRLSGIYGPGRNAFVKLREGRAQRIVK 173

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             QVFNRI V+D+A  +   +     G I+N++DDEPAPPQ+V   AA+L  +  P E  
Sbjct: 174 AGQVFNRIHVDDIATALAASLDRPRAGAIYNVTDDEPAPPQDVTAFAAALAGLPLPPEVD 233

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
           FDTA +SP  R FY +NKR+ N ++K  LG  L +P YR  L+ L +
Sbjct: 234 FDTAALSPMARSFYGENKRVRNRRLKEELGVTLRFPTYREGLRGLME 280


>gi|27381950|ref|NP_773479.1| hypothetical protein blr6839 [Bradyrhizobium japonicum USDA 110]
 gi|27355120|dbj|BAC52104.1| blr6839 [Bradyrhizobium japonicum USDA 110]
          Length = 283

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 149/289 (51%), Gaps = 8/289 (2%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L I G GY+ +           +  GT R  +    L   GI    F+  +      E
Sbjct: 1   MRLFILGFGYSARHFVRRFGGTFSHIAGTVRDPAKRDDLA--GIEVHPFSGSRPARETAE 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           ++     ++  I P S GDP I + + D        K I YLS+  +YG+  G WVDE +
Sbjct: 59  RISDADVLLISIPPGSAGDPAIAACA-DVLAGGRQRKII-YLSTIGVYGDHAGSWVDEST 116

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                      R  AE+ W  I +     +A+LRL+GIYGP RN  + +R   + R++K 
Sbjct: 117 PPQAALDRTRMRLAAEQAWTDIGRG---DVAILRLAGIYGPGRNALVTLRAGTARRIIKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI  +D+A  ++  + H   G +N+ DDEPAPPQ+VI  AA LM + PP E+ F+
Sbjct: 174 GQVFNRIHTDDIASAIMAAVRHQGSGTWNVCDDEPAPPQDVIAYAAQLMGVAPPPEEAFE 233

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           TA +S   R FYA + R+SNAK+K  LG  L YP YR +L  LW+  E 
Sbjct: 234 TAEMSAMARSFYASSARVSNAKLKRELGVTLAYPTYRHALDALWRAGEG 282


>gi|144897862|emb|CAM74726.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 280

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 163/286 (56%), Gaps = 17/286 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRS-VSNLLTLKHKGISPFLFADQKINNLLRE 60
           HL IFG G++ + IA AA   G    GTTRS  S+ L     GI+   F   + + L  +
Sbjct: 4   HLFIFGLGFSARVIARAAQDRGWRVSGTTRSGQSDGL----DGITVHAF--DRDHPLPVQ 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  + P  +GDP +        +  P   W+GYLS+T +YG+ +G WVDE +
Sbjct: 58  ALDAVTHVLSSVPPDHDGDPVLDMAGAALCQLAP--TWVGYLSTTGVYGDCQGDWVDEDA 115

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            + P    + +R  AE+ W    +   + + V RL+GIYGP R+    +RQ  + R++K 
Sbjct: 116 PLRPDLDRSRRRVLAEQAW----QGSGLPVQVFRLAGIYGPGRSAIDTVRQGRARRIIKP 171

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
           +QVF+RI V+D+A+ V+  +   H G ++NL DD+ APPQ+VI  A +L+ + PP E  +
Sbjct: 172 DQVFSRIHVDDIAQVVLASIERPHPGRVYNLCDDDCAPPQDVITHACALLGVEPPPEVEW 231

Query: 240 DTAN--ISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           + A   +SP    FYADNKR+ N +IK  LG +L YP+YR  L  +
Sbjct: 232 EQAQATLSPMALSFYADNKRVRNDRIKQELGVRLRYPSYRQGLAAI 277


>gi|300021923|ref|YP_003754534.1| NAD-dependent epimerase/dehydratase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523744|gb|ADJ22213.1| NAD-dependent epimerase/dehydratase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 287

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 155/284 (54%), Gaps = 5/284 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L  FG GY+   ++      G    GT  +      LK  G   F+F  ++ ++ + + 
Sbjct: 3   RLFCFGLGYSAGVLSRRLAAKGWSISGTATTAEKAEALKQHGYEAFVFDGRERDSAIADA 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  +THI+  I P  +GDP     + D     P + WIGY SS S+YG+ +G+WVDE + 
Sbjct: 63  LSRSTHILLSIPPGEDGDPAYRVYASDI-AASPSIAWIGYFSSISVYGDSKGEWVDETTP 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P++    +R +AE  W+ + +     + VLRL GIYGP R+   ++R   + R+ K  
Sbjct: 122 PGPVTDRGKRRLDAENAWIELGRASGKTIVVLRLPGIYGPGRSAIDQLRAGKARRIFKPG 181

Query: 182 QVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIMEAASLMKIT-PPLEQCF 239
           QV NR+ V+D+A      +    G  +FN++DD PAPPQ+VI   A ++ +  PP     
Sbjct: 182 QVTNRVHVDDIATATEAALGLASGIHVFNVTDDLPAPPQDVIAYGAEILGVPCPPATDPT 241

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           D A++SP  R FYA++K++SNA++K+ LG +L YP Y   LK +
Sbjct: 242 D-ASLSPMARSFYAESKKVSNARMKNDLGVKLAYPTYIEGLKAI 284


>gi|218530613|ref|YP_002421429.1| hypothetical protein Mchl_2661 [Methylobacterium chloromethanicum
           CM4]
 gi|218522916|gb|ACK83501.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 289

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 151/290 (52%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIADA------ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G++ +  A+       A++  V      RS++        G +   F  +  
Sbjct: 1   MNLFVFGLGFSARHFAERERARFNAVRATVTEPERARSLA-----AETGFTLRAFGPEAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  + E L  T  ++    P  +GD  +        K    + WIGYLS+  +YG++ G 
Sbjct: 56  DTRIAEDLADTDVLLISAPPGRDGDTVLARYRDTIAK--SRIGWIGYLSTIGVYGDQGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W+DE +   P S  +  R   E  WLA+  +    + V RLSGIYGP RNP +K+R   +
Sbjct: 114 WIDETTPATPKSARSRDRLAVENAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLRDGRT 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVFNRI V D+A  +   +    GG ++N++DDEPAPPQ V   AA L  +  
Sbjct: 174 QRIVKPGQVFNRIHVADIAATLAASIERPRGGAVYNVTDDEPAPPQTVTEHAARLTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P E  F+TA++SP  R FY +NKR+ N  I+  LG QL +P YR  L  L
Sbjct: 234 PPEIDFETADLSPMARSFYGENKRVRNRLIREELGVQLAFPTYREGLAAL 283


>gi|254561579|ref|YP_003068674.1| epimerase [Methylobacterium extorquens DM4]
 gi|254268857|emb|CAX24818.1| putative epimerase with NAD(P)-binding Rossmann-fold domain
           (yeeZ-like) [Methylobacterium extorquens DM4]
          Length = 289

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 151/290 (52%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIADA------ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G++ +  A+       A++  V      RS++        G +   F  +  
Sbjct: 1   MNLFVFGLGFSARHFAERERARFNAVRATVTEPERARSLA-----AETGFTLRAFGPEAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  + E L  T  ++    P  +GD  +        K    + WIGYLS+  +YG++ G 
Sbjct: 56  DPRIAEDLADTDVLLISAPPGRDGDTVLARYRDTIAKS--RIGWIGYLSTIGVYGDQGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W+DE +   P S  +  R   E  WLA+  +    + V RLSGIYGP RNP +K+R   +
Sbjct: 114 WIDETTPATPKSARSRDRLAVENAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLRDGRT 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVFNRI V D+A  +   +    GG ++N++DDEPAPPQ V   AA L  +  
Sbjct: 174 QRIVKPGQVFNRIHVADIAATLAASIERPRGGAVYNVTDDEPAPPQTVTEHAAELTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P E  F+TA++SP  R FY +NKR+ N  I+  LG QL +P YR  L  L
Sbjct: 234 PPEVDFETADLSPMARSFYGENKRVRNRLIREELGVQLAFPTYREGLAAL 283


>gi|209966535|ref|YP_002299450.1| hypothetical protein RC1_3276 [Rhodospirillum centenum SW]
 gi|209960001|gb|ACJ00638.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 298

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 152/290 (52%), Gaps = 11/290 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L +FG GY+   +    L  G    GTTR  +    L+  GI   LF   +  +     L
Sbjct: 5   LFVFGLGYSALALTRLVLAEGWRVAGTTRDPAKAAALREAGIEAHLFGPGRPLDDPAAAL 64

Query: 63  YFTTHIVQCIKP--------SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
             T+H++    P           G   +++   D    +P + W GYLS+T +YG+  G 
Sbjct: 65  AGTSHLLDSAPPEPGPDGTRDGSGHDPVLAQHADVIAALP-LTWAGYLSTTGVYGDTGGA 123

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WVDE S + P +    +R  AE+ WL++ ++  + + + RL+GIYGP R+P  ++R   +
Sbjct: 124 WVDEDSPLRPGNARGRERVEAEEGWLSLWREHGVPVHLFRLAGIYGPGRSPVDQLRAGRA 183

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVF+RI V+D+A  +   M     G  +N+ DDEP P   V+  AA L+ + P
Sbjct: 184 RRIVKPGQVFSRIHVDDIAAVLRASMERPRPGTAYNVCDDEPTPADEVMAYAAGLLGMEP 243

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           P  + +D A  SP  R FY++ +R+ N +I++ LG +L YP YR  ++ L
Sbjct: 244 PPAEPYDPATASPMQRSFYSETRRVRNDRIRTDLGVRLAYPTYREGMQAL 293


>gi|240138971|ref|YP_002963446.1| putative epimerase with NAD(P)-binding Rossmann-fold domain
           (yeeZ-like) [Methylobacterium extorquens AM1]
 gi|240008943|gb|ACS40169.1| putative epimerase with NAD(P)-binding Rossmann-fold domain
           (yeeZ-like) [Methylobacterium extorquens AM1]
          Length = 289

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 151/290 (52%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIADA------ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G++ +  A+       A++  V      RS++        G +   F  +  
Sbjct: 1   MNLFVFGLGFSARHFAERERARFNAVRATVTEPERARSLA-----AETGFTLRAFGPEAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  + E L  T  ++    P  +GD  +        K    + WIGYLS+  +YG++ G 
Sbjct: 56  DPRIAEDLADTDVLLISAPPGRDGDTVLARYRDTIAKS--RIGWIGYLSTIGVYGDQGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W+DE +   P S  +  R   E  WLA+  +    + V RLSGIYGP RNP +K+R   +
Sbjct: 114 WIDEATPATPKSARSRDRLAVENAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLRDGRT 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVFNRI V D+A  +   +    GG ++N++DDEPAPPQ V   AA L  +  
Sbjct: 174 QRIVKPGQVFNRIHVADIAATLAASIERPRGGAVYNVTDDEPAPPQTVTEHAARLTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P E  F+TA++SP  R FY +NKR+ N  I+  LG QL +P YR  L  L
Sbjct: 234 PPEVDFETADLSPMARSFYGENKRVRNRLIREELGVQLAFPTYREGLAAL 283


>gi|23011217|ref|ZP_00051643.1| COG0451: Nucleoside-diphosphate-sugar epimerases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 289

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 151/285 (52%), Gaps = 5/285 (1%)

Query: 1   MHLMIFGAGYTGKFIADAA-LKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M+L +FG G++ +  A++   + G      T            G +   F  +  +  + 
Sbjct: 1   MNLFVFGLGFSARHFAESERARFGAVRGTVTEPARADALAAETGFTIRAFGPEADDPGIA 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
             L  T  ++    P+ +GD  +++  +D       ++WIGYLS+  +YG+  G W+DE 
Sbjct: 61  GDLADTDMLLVSAPPAKDGD-TVLARYRDVIAGS-RIRWIGYLSTIGVYGDHGGAWIDET 118

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +   P S  +  R   E+ WLA+  +    + V RLSGIYGP RNP +K+R+  + R+VK
Sbjct: 119 TPAVPKSARSQGRLAVEEAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLREGRTQRIVK 178

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             QVFNRI V D+A  +   +     G I+N++DDEPAPPQ VI  AA+L  +  P E  
Sbjct: 179 PGQVFNRIHVADIATTLAASIDRPRAGAIYNVTDDEPAPPQVVIEHAAALTGLPLPPEVD 238

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           F TA +SP  R FY +NKR+ N  I+  LG +L YP YR  L  L
Sbjct: 239 FGTAELSPMARSFYGENKRVRNRLIREELGVRLRYPTYREGLADL 283


>gi|270159916|ref|ZP_06188572.1| putative NAD-dependent epimerase/dehydratase [Legionella
           longbeachae D-4968]
 gi|289165332|ref|YP_003455470.1| hypothetical protein LLO_2001 [Legionella longbeachae NSW150]
 gi|269988255|gb|EEZ94510.1| putative NAD-dependent epimerase/dehydratase [Legionella
           longbeachae D-4968]
 gi|288858505|emb|CBJ12386.1| hypothetical protein LLO_2001 [Legionella longbeachae NSW150]
          Length = 294

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 155/286 (54%), Gaps = 7/286 (2%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
             IFG GYT    A   +++G    GTTR      T     I+   F    I+  L +  
Sbjct: 5   FFIFGFGYTANRFAQKLIQLGFNVIGTTRQERKKATSHPPAITLIDFESSDIDFYLSQ-- 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
             TTHI+  I P+   D  ++S      K    H++WIGYLSST +YG+ +G WV+E S 
Sbjct: 63  --TTHILISIPPAEGMDDLVLSYYSALIKRHATHIEWIGYLSSTGVYGDHQGNWVNEESI 120

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P S  A  R+ AEK W++  K   + L + RL+GIYG  RNP  +IR   +  + K+ 
Sbjct: 121 CRPNSTSAIIRWEAEKAWISYAKGEQLPLHLFRLAGIYGSDRNPLERIRSGKNFSIFKEG 180

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           QVF+RI V+D+   ++  + + H   I+N++DDEP     V   AASL+ + P     F+
Sbjct: 181 QVFSRIHVDDIVSVLLASIKNPHPLSIYNVADDEPVASHIVDAYAASLLNLVPLPLIPFE 240

Query: 241 TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKE 285
            A++SP  + FY  N+R+SN KI K LG  L YP++R  L Q+W+E
Sbjct: 241 KASLSPREQEFYLSNRRVSNLKIKKKLGVILHYPSFREGLTQIWRE 286


>gi|288959565|ref|YP_003449906.1| NAD-dependent epimerase/dehydratase [Azospirillum sp. B510]
 gi|288911873|dbj|BAI73362.1| NAD-dependent epimerase/dehydratase [Azospirillum sp. B510]
          Length = 291

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 148/281 (52%), Gaps = 3/281 (1%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L +FG GY+ +  A+     G     T R       L+ +GI  FLF   +     R  
Sbjct: 5   RLFVFGLGYSARVFAERLRAEGWRIAATCRGEEKKAALEAEGIEAFLFDRGRPLADARAA 64

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L  TTH++  + P  +GDP +   ++D       + W GYLS+T +YG+  G+WV E ++
Sbjct: 65  LAGTTHLLVSVPPDGKGDPVLDQHARDLADLR-TLDWAGYLSTTGVYGDTGGEWVGEAAW 123

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           + P      +R  AE+ WL + ++  + + + RL+GIYGP R+    +R   + R+ K  
Sbjct: 124 LKPTGERQKRRVEAERGWLNLYRQYGVPMHLFRLAGIYGPGRSAIDSVRDGTARRVDKPG 183

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           QVF RI V+D+A  +   M    LG ++N++DD P+P   V+  A  L+ + PP    FD
Sbjct: 184 QVFCRIHVDDIANTLRASMDRPTLGAVYNVADDLPSPSHEVVEYACRLLGVEPPPLVPFD 243

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLK 280
            A +SP    FYAD +R+ N +IK  LG  L +P+YR  L+
Sbjct: 244 QAEMSPMAASFYADCRRVRNDRIKRQLGVTLTHPDYRAGLE 284


>gi|188581593|ref|YP_001925038.1| hypothetical protein Mpop_2341 [Methylobacterium populi BJ001]
 gi|179345091|gb|ACB80503.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 289

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 154/290 (53%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIAD------AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G++ +  A+       A++  V      +S++        G +   F     
Sbjct: 1   MNLFVFGLGFSARHFAERERARFQAVRATVTEPERAKSLA-----AETGFALRAFGPDAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  +  +L  T  ++    P  +GD  +++  +D       ++WIGYLS+  +YG+  G 
Sbjct: 56  DPRIAGELADTDVLLISAPPGRDGD-TVLARYRDAIAGS-RIRWIGYLSTIGVYGDHGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W+DE +   P S  +  R   E  WLA+  +    + V RLSGIYGP RNP +K+R   +
Sbjct: 114 WIDETTPATPKSARSRGRLEVENAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLRDGRT 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVFNRI V+D+A  +   +    GG ++N++DDEPAPPQ V   AA+L  +  
Sbjct: 174 QRIVKPGQVFNRIHVDDIATTLTASIERPRGGAVYNVTDDEPAPPQTVTEHAAALTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P E  F+TA +SP  R FY +NKR+ N  I+  LG QL YP YR  L  L
Sbjct: 234 PPEIDFETAELSPMARSFYGENKRVRNRLIREELGVQLAYPTYREGLAAL 283


>gi|192291987|ref|YP_001992592.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris
           TIE-1]
 gi|192285736|gb|ACF02117.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris
           TIE-1]
          Length = 285

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 151/284 (53%), Gaps = 9/284 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L+IFG GY+  +IA      G+    T R+ +    L  +GI+  +F+   I+ L+ +
Sbjct: 1   MRLLIFGLGYSANYIAQHLQGAGIEVTATVRTSAKAEELVRRGITARVFSSSSIDPLIAD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  +  ++  I P+  GDP + S            +WIGYLS+  +YG+  G W+DE +
Sbjct: 61  DIKLSDAVLSSIPPNESGDPVLASFLGSITSDS-RPRWIGYLSTIGVYGDHLGNWIDETT 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                   +  R  AE+ WLA+         V RLSGIYGP RN   K+    + R++K 
Sbjct: 120 PAKSEKPRSQLRIAAEQRWLALDAH------VFRLSGIYGPGRNQLEKLASGTATRIIKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVFNRI V D+A  V   ++    G I+N++D+EPAPPQ V+  AA L   TPP E  F
Sbjct: 174 GQVFNRIHVADIAAVVAASLSRPRAGAIYNVTDNEPAPPQQVVEFAAELCGRTPPPEVAF 233

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           D A +SP  R FY +N R+ N  I++ LG  L YP+YR  L  L
Sbjct: 234 DDAELSPMARSFYLENCRVRNDLIRTELGVTLAYPSYREGLSAL 277


>gi|316933571|ref|YP_004108553.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris
           DX-1]
 gi|315601285|gb|ADU43820.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris
           DX-1]
          Length = 285

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 155/284 (54%), Gaps = 9/284 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M ++IFG GY+  +IA      G+    T R+ +    L  +GI+  +F+   ++ L+ +
Sbjct: 1   MRILIFGLGYSASYIAQHLQGAGIEVAATVRTSAKAEELGRRGITARVFSSSHVDPLIAD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  +  I+  I P+  GDP + S +          +WIGYLS+  +YG+  G WVDE +
Sbjct: 61  DIKSSDAILSSIPPNESGDPVLASFTGAITSDS-RPRWIGYLSTIGVYGDHLGGWVDETT 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                   +  R  AE+ WLA+  +      V RLSGIYGP RN   K+    ++R++K 
Sbjct: 120 PAKSEKPRSQLRIAAEQRWLALGAQ------VFRLSGIYGPGRNQLEKLAAGTAMRIIKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVFNRI V D+A  V   ++    G I+N++D+EPAPPQ V+  AA L  +TPP E  +
Sbjct: 174 GQVFNRIHVADIAAVVAASLSRPRPGAIYNVTDNEPAPPQQVVEFAAELCGLTPPPEIAY 233

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           + A +SP  R FY +N R+ N  I++ LG  L YP+YR  L  L
Sbjct: 234 EHAELSPMARSFYLENCRVRNDLIRTELGVALAYPSYREGLSAL 277


>gi|163851807|ref|YP_001639850.1| hypothetical protein Mext_2384 [Methylobacterium extorquens PA1]
 gi|163663412|gb|ABY30779.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 289

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 150/290 (51%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIADA------ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G++ +  A+       A++  V      RS++        G +   F  +  
Sbjct: 1   MNLFVFGLGFSARHFAERERARFNAVRATVTEPERARSLA-----AETGFTLRAFGPEAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  + E L  T  ++    P  +GD  +        K    + WIGYLS+  +YG++ G 
Sbjct: 56  DPRIAEDLADTDVLLISAPPGRDGDTVLARYRDTIAKS--RIGWIGYLSTIGVYGDQGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W+DE +   P S  +  R   E  WLA+  +    + V RLSGIYGP RNP +K+R   +
Sbjct: 114 WIDETTPATPKSARSRDRLAVETAWLALGAETGKAVQVFRLSGIYGPGRNPIVKLRDGRT 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
             +VK  QVFNRI V D+A  +   +    GG ++N++DDEPAPPQ V   AA L  +  
Sbjct: 174 QGIVKPGQVFNRIHVADIAATLAASIERPRGGAVYNVTDDEPAPPQTVTEHAARLTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P E  F+TA++SP  R FY +NKR+ N  I+  LG QL +P YR  L  L
Sbjct: 234 PPEVDFETADLSPMARSFYGENKRVRNRLIREELGVQLAFPTYREGLAAL 283


>gi|310817202|ref|YP_003965166.1| NAD-dependent epimerase/dehydratase [Ketogulonicigenium vulgare
           Y25]
 gi|308755937|gb|ADO43866.1| NAD-dependent epimerase/dehydratase [Ketogulonicigenium vulgare
           Y25]
          Length = 267

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 155/284 (54%), Gaps = 24/284 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L+  G GY  + +A   L  G    GT+RS    +      ++P              
Sbjct: 1   MRLLTLGHGYVAQALARI-LPEGWQLRGTSRSDGAAIQWPGSDLAP-------------- 45

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            + + THI+    P    DP   +++       P   W+GYLS+T +YG+ +G WVDE +
Sbjct: 46  HIAWATHILISAAPVGGQDPFFTTVAGLVAHRRP--DWLGYLSTTGVYGDHQGAWVDEET 103

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V P++  +  R  AE+ W  ++ + +I     R++GIYGP R PF ++R   + R+ ++
Sbjct: 104 PVSPVANRSADRLMAERAWADVSDQAHI----FRIAGIYGPGRAPFARLRAGQARRIHRE 159

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI-TPPLEQCF 239
            QVF+RI V+D+A+ ++  M     GI+NL+DD PAP  +VI  AA L  +  PPLE  F
Sbjct: 160 GQVFSRIHVDDIAQVLLAAMVQRKPGIYNLADDLPAPNADVIAYAAGLAGLPVPPLED-F 218

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           DTA ++P  R FY +++RI N KIK+ LG  LLYP+YR  L+ L
Sbjct: 219 DTAEMTPMARSFYEESRRICNKKIKADLGVSLLYPDYRRGLQAL 262


>gi|146343330|ref|YP_001208378.1| hypothetical protein BRADO6556 [Bradyrhizobium sp. ORS278]
 gi|146196136|emb|CAL80163.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 282

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 139/290 (47%), Gaps = 11/290 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+L + G GY+ +   D          GT R            +  F   D  +      
Sbjct: 1   MNLFVIGFGYSAQRFVDLHGSGFAAIGGTVRGAEKRAQFARYALDLF---DGTMPAAATL 57

Query: 61  KLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
                  +V    P   G DP +             V    YLS+  +YG+ +G W+DE 
Sbjct: 58  AKAAKADVVLISAPPGAGEDPALTHFGDAITSGRARVV---YLSTVGVYGDHQGAWIDED 114

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           + + P       R   E++W A   ++  +LAVLRL GIYGP RN  +++R   + R+VK
Sbjct: 115 TPLAPEHGRVQARVRVEEDWRA---RIGDRLAVLRLGGIYGPGRNALVELRAGRARRIVK 171

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
             QVFNRI V+D+A  +   +    GG +N+ DDEPAPPQ+VI  AA LM I PP E  F
Sbjct: 172 PGQVFNRIHVDDIAAAIQGAIRRERGGAWNIVDDEPAPPQDVIAYAARLMGIAPPPELPF 231

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           D+A++SP  R FYA N+RI N + K  LG    YP YR  L  LW   E 
Sbjct: 232 DSADLSPMARSFYASNRRIRNTRAKQDLGLVFAYPTYREGLDALWAAGEG 281


>gi|83594707|ref|YP_428459.1| hypothetical protein Rru_A3378 [Rhodospirillum rubrum ATCC 11170]
 gi|83577621|gb|ABC24172.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 308

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 152/288 (52%), Gaps = 8/288 (2%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL+ FG GY+   +A   L+ G    GT RS      L  +GI+ F+F   +   L  E 
Sbjct: 7   HLLCFGLGYSALRLARGLLRDGWRVSGTCRSEEKRQALSAQGITAFVF--DETTPLPAEA 64

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               TH++  I P  +GDP +     D     P  +W+GY S+T +YG+  G WVDE   
Sbjct: 65  WTGVTHVLVSIPPGPDGDPVLALHRADLLALRP--EWLGYFSTTGVYGDTGGAWVDEGKP 122

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V P    + +R  AE++WL + +  ++ + +LRL+GIYGP R+ F ++R   + R+++  
Sbjct: 123 VRPTQERSKRRVAAEEDWLDLWRDEDLPVHLLRLAGIYGPGRSVFDQLRAGTAKRIIRPG 182

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
             F+RI V+D+       M     G I+NL DDEPA P  V+  A +L+ I PP  Q FD
Sbjct: 183 HAFSRIHVDDIGLITRASMADPDPGAIYNLVDDEPAEPSEVMDHACALLGIDPPPAQSFD 242

Query: 241 --TANISPFTRFFYADNKRISN-AKIKSLGFQLLYPNYRISLKQLWKE 285
                +SP    F+ADN+++SN      L  +LLYP +R  L+ +  E
Sbjct: 243 EVAPGLSPMALSFWADNRKVSNERLWDDLRLRLLYPTFRQGLEAILAE 290


>gi|170749536|ref|YP_001755796.1| NAD-dependent epimerase/dehydratase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656058|gb|ACB25113.1| NAD-dependent epimerase/dehydratase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 287

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 148/290 (51%), Gaps = 15/290 (5%)

Query: 1   MHLMIFGAGYTGKFIADA------ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M+L +FG G+TG+  A         ++  V        ++   +   +   P     +  
Sbjct: 1   MNLFVFGLGFTGRHFAARARARFETVRATVTDPAAADRIAAETSFAMRAFGP-----EAD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           +  +   L  T  ++    P   GDP +   +         ++WIGYLS+  +YG++ G 
Sbjct: 56  DPRIAADLADTDVLLVSAPPGEAGDPVLARYADAVAAS--RIRWIGYLSTIGVYGDQGGA 113

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           W DE +   P S  +  R +AE  WLA+       + + RLSGIYGP RNP +K+R+  S
Sbjct: 114 WTDEATPATPRSARSKVRLDAETAWLALGAATGKAVQIFRLSGIYGPGRNPIVKLREGRS 173

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
            R+VK  QVFNRI V+D+A  ++  +     G I+N++DDEPA PQ V   AA+L  +  
Sbjct: 174 QRIVKAGQVFNRIHVDDIATTLLASIDRPRPGAIYNVTDDEPAAPQTVTEHAAALTGLPL 233

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           P    F+TA++SP  R FY +NKR+ N  I+  LG  L YP YR  L  L
Sbjct: 234 PPAIDFETADLSPMARSFYGENKRVRNRLIRDELGVALAYPTYREGLAAL 283


>gi|39936265|ref|NP_948541.1| hypothetical protein RPA3202 [Rhodopseudomonas palustris CGA009]
 gi|39650120|emb|CAE28643.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 285

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 150/284 (52%), Gaps = 9/284 (3%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M  +IFG GY+  +IA      G+    T R+ +    L  +GI+  +F+   ++ L+ +
Sbjct: 1   MKFLIFGLGYSASYIAQHLQGAGIEVTATVRTSAKAEELGRRGITARVFSSSYVDPLISD 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  +  I+  + P+  GDP + S            +WIGYLS+  +YG+  G WVDE +
Sbjct: 61  DIKSSDAILSSVPPNESGDPVLASFIGSITSDS-RPRWIGYLSTIGVYGDHLGNWVDETT 119

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                   +  R  AE+ WLA+         V RLSGIYGP RN   K+    + R++K 
Sbjct: 120 PETSEKPRSQLRIAAEQRWLALGAH------VFRLSGIYGPGRNQLEKLASGTATRIIKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVFNRI V D+A  V   ++    G I+N++D+EPAPPQ V+  AA L   TPP E  F
Sbjct: 174 GQVFNRIHVADIAAVVAASLSRPRAGAIYNVTDNEPAPPQQVVEFAAELCGRTPPPEVAF 233

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           D A +SP  R FY +N R+ N  I++ LG  L YP+YR  L  L
Sbjct: 234 DDAELSPMARSFYLENCRVRNDLIRTELGVTLAYPSYREGLSAL 277


>gi|197106428|ref|YP_002131805.1| Nucleoside-diphosphate-sugar epimerase [Phenylobacterium zucineum
           HLK1]
 gi|196479848|gb|ACG79376.1| Nucleoside-diphosphate-sugar epimerase [Phenylobacterium zucineum
           HLK1]
          Length = 284

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 152/284 (53%), Gaps = 7/284 (2%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L +FG G++G  +A      G     + R+      L+  G+ P    D+K    L E
Sbjct: 1   MRLFVFGYGFSGAALARRLKARGWDVAASYRTSPE--PLEADGVRPVHVEDRKG---LAE 55

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L  T  ++    P ++G P + ++            W GYLS+T +YG+R G+WV E S
Sbjct: 56  ALSTTRALLATAPPQADGCPALNALVPALASAGAFPDWTGYLSTTGVYGDRRGRWVTEKS 115

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            +   S    +R  AE++WL   + + + +AV RL GIYGP+R+ F ++R+  + R+   
Sbjct: 116 RLAAQSVEGARRVRAERDWLDAGRGMGLTIAVFRLPGIYGPRRSAFDRLREGRARRIAAP 175

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+A  +   +     GGI+NL DDEPAP  +V+  AA L+ +  P E   
Sbjct: 176 GQVFSRIHVDDLAAGLEASIDRPRAGGIYNLCDDEPAPNSDVVAYAAGLLGLPVPPEVSL 235

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           + A + P    FYA++KR+SNA  K+ LG++  YP YR  L+ +
Sbjct: 236 EEARLPPAALRFYAESKRVSNALAKAELGWRPAYPTYREGLRAI 279


>gi|170738565|ref|YP_001767220.1| NAD-dependent epimerase/dehydratase [Methylobacterium sp. 4-46]
 gi|168192839|gb|ACA14786.1| NAD-dependent epimerase/dehydratase [Methylobacterium sp. 4-46]
          Length = 283

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 154/287 (53%), Gaps = 8/287 (2%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+L++FG GYT +   +           T ++         +G+   +F+  + +  + +
Sbjct: 1   MNLLVFGLGYTARHFVERERARFSRIAATAQAPR---PDAPEGVIARVFSPVRADPAILD 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +  +  ++  I P  +GDP + + ++         +WIGYLS+  +YG++ G W+DE +
Sbjct: 58  DVARSDAVLVSIPPQ-DGDPVLRAYAEALAAG--PARWIGYLSTIGVYGDQGGAWIDEAT 114

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P       R   E+ W A+  +    + V RLSGIYGP RN F+K+R+  + R+VK 
Sbjct: 115 PPAPTHERTRDRVAVEEAWRALGARTGKAVQVFRLSGIYGPGRNAFVKLREGRAQRIVKD 174

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVFNRI V+D+A  +   +     G ++N++DDEPAPPQ+V   AA+L  +  P E  F
Sbjct: 175 GQVFNRIHVDDIATVLAASLDRPRAGAVYNVTDDEPAPPQDVTAHAAALAGLPLPPEIDF 234

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKE 285
           +TA++SP  R FY +NKR+ N  I+  LG  L +P YR  L  L  E
Sbjct: 235 ETASLSPMARSFYGENKRVRNRLIREELGVALRFPTYREGLAGLVAE 281


>gi|114799475|ref|YP_761681.1| hypothetical protein HNE_3004 [Hyphomonas neptunium ATCC 15444]
 gi|114739649|gb|ABI77774.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 287

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 155/284 (54%), Gaps = 18/284 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L +FG GY+ + +A   L  G    GT RS +    L+ +GI   +++ +    +     
Sbjct: 8   LFVFGLGYSAQQLASRLLAAGWQVAGTVRSEAKAAELRSRGIDARVWSGEGPVEVPEGAH 67

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSK--DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           +  T     + P  +G P   S+ K  D  +       + YLS+T +YG+  G WV E S
Sbjct: 68  WLVT-----LPPGKDGCPAAQSVLKCPDLSRS------VTYLSTTGVYGDLNGGWVTERS 116

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V+P S  A  R  AE +W A+T        ++RL GIYGP R+ F ++R   + R+VK+
Sbjct: 117 PVNPGSPRAAARVKAEGQWQALTGD---TARLVRLPGIYGPGRSAFDRLRDGTARRIVKE 173

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+RI V+D+A  +  LM    + G+F+L D+ PAPPQ+VI  AA L+ I PP E  F
Sbjct: 174 GQVFSRIHVDDIASGLEALMQRPEITGVFHLCDELPAPPQDVIAHAAGLLGIDPPPEVPF 233

Query: 240 DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           D A++SP    FYA+ KR+SNA+ K +L ++  YP YR  L  +
Sbjct: 234 DAASLSPMAASFYAECKRVSNARAKAALRWRPAYPTYREGLAAI 277


>gi|148252555|ref|YP_001237140.1| hypothetical protein BBta_0978 [Bradyrhizobium sp. BTAi1]
 gi|146404728|gb|ABQ33234.1| hypothetical protein BBta_0978 [Bradyrhizobium sp. BTAi1]
          Length = 283

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 145/289 (50%), Gaps = 8/289 (2%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M+L + G GYT + + D          GT RS      L    I   LF   +  +    
Sbjct: 1   MNLFVIGFGYTAQRVVDLHGSGFSRITGTVRSAEKRALLAADDI--HLFDGTRPADATLA 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           K      ++  + P S  DP + +            + + YLS+  +YG+ +G W+DE +
Sbjct: 59  KAAQADIVLISVPPGSGDDPALTAFGDAITTG--RARRVIYLSTVGVYGDHQGAWIDEAT 116

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            + P       R   E+EW A   ++  +L VLRL GIYGP RN  +++R   + R+VK 
Sbjct: 117 PLAPEHDRVQARVRVEQEWQA---RIGDRLTVLRLGGIYGPGRNALVELRAGRARRIVKP 173

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            QVFNRI V+D A  V+  +    GG +N+ DDEPAPPQ+VI  AA LM + PP E  FD
Sbjct: 174 GQVFNRIHVDDAAAAVMAAVRCGKGGAWNIVDDEPAPPQDVIAYAAKLMGVAPPPELAFD 233

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           +A +SP  R FYA N+RI N + K  LG    YP YR  L  LW   E 
Sbjct: 234 SAELSPMARSFYASNRRIRNIRAKQELGLVFTYPTYRAGLDALWAAGEG 282


>gi|154245762|ref|YP_001416720.1| NAD-dependent epimerase/dehydratase [Xanthobacter autotrophicus
           Py2]
 gi|154159847|gb|ABS67063.1| NAD-dependent epimerase/dehydratase [Xanthobacter autotrophicus
           Py2]
          Length = 288

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 140/260 (53%), Gaps = 6/260 (2%)

Query: 27  CGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMS 86
            GT R+   L  L   G+ P LF  + ++ +L + L  T  I+    P + GDP +    
Sbjct: 28  VGTARTAERLAVLP-AGVEPVLFDGESLSAVLADALAGTDLIIASAPPDARGDPILRCAG 86

Query: 87  KDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKL 146
                    ++ + YL++  +YG+  G WVDE +     S    +R  AE EW A  +K 
Sbjct: 87  TVLEAG--QLRQVVYLTTLGVYGDHGGDWVDEATPPRAGSPRLERRLAAEHEWFAFGQKR 144

Query: 147 NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG 206
            I ++VLRL+GIYGP RN   ++R   + R+ K  QVFNRI V D+AR +  ++     G
Sbjct: 145 GIPVSVLRLAGIYGPGRNALEQLRAGEARRIDKPGQVFNRIHVADIARTIRAVVDRRFDG 204

Query: 207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA--NISPFTRFFYADNKRISNAKIK 264
           I N++DD PAPP + I  AA L+ +  P    FD A  ++SP    F+A NKR++N ++K
Sbjct: 205 ILNVTDDLPAPPGDPIAYAAGLLGLPVPPAIPFDEAARDMSPMALTFWAANKRVANHRLK 264

Query: 265 S-LGFQLLYPNYRISLKQLW 283
           S LG  L YP YR  LK L+
Sbjct: 265 SELGVSLAYPTYREGLKALY 284


>gi|194367656|ref|YP_002030266.1| NAD-dependent epimerase/dehydratase [Stenotrophomonas maltophilia
           R551-3]
 gi|194350460|gb|ACF53583.1| NAD-dependent epimerase/dehydratase [Stenotrophomonas maltophilia
           R551-3]
          Length = 296

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 153/286 (53%), Gaps = 11/286 (3%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTR---SVSNLLTLKHKGISPFLFADQKINNLL 58
            ++I G G++G  +A     +GV   GT R   S  +   L+H+     L AD   +  L
Sbjct: 9   RMLILGMGWSGCVLATHLQALGVRVVGTVRDPASAPHDGLLRHQ-----LRADATPSTAL 63

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            +++     ++  + P +EGD   +S+     +  P ++W+GYLSSTS+Y +R G W++E
Sbjct: 64  LDEIAQAEAVLCSVPPDAEGD-PALSLLLPALQESPALRWVGYLSSTSVYADRAGGWINE 122

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            S          QR  AE +W A+ ++  I  AV RL G+YGP RN  +++ Q  +  +V
Sbjct: 123 TSVADATETTGMQRRRAEDQWRALAEQRGIASAVFRLPGLYGPGRNALLQLAQGRARHVV 182

Query: 179 KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           +   VFNR+ V+D+A  +I  M    L G++  SDDEPAPPQ+V+  AA L     P   
Sbjct: 183 RPGLVFNRLHVQDLAAVIIAAMRRPALNGLYLPSDDEPAPPQDVLAYAAQLGGFAMPPAM 242

Query: 238 CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
            +D   +SP  R FY  +KRI +   + +LG++  +P YR  L+ L
Sbjct: 243 AWDDPAVSPTLRRFYESSKRIDSTGTRGALGWEPSFPTYREGLRAL 288


>gi|46202228|ref|ZP_00208439.1| COG0451: Nucleoside-diphosphate-sugar epimerases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 261

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 146/271 (53%), Gaps = 17/271 (6%)

Query: 14  FIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIK 73
            IA    + G    GTTRS      +   G+    F   + + L    L     ++  + 
Sbjct: 1   MIARNLTQAGWSVMGTTRSGE---AVDCPGVEVLAF--DRGHPLPPGCLTGVDAVLSSVP 55

Query: 74  PSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF 133
           P S+GDP +  M++      P   WIGYLS+T +YG+  G WVDE +  HP    + +R 
Sbjct: 56  PDSQGDPVLDHMAESIRAAAP--AWIGYLSTTGVYGDHGGAWVDEETAPHPNLDRSRRRL 113

Query: 134 NAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVA 193
            AE  W       ++   + RL+GIYGP R+    +R+  + R+VK  QVF+RI VED+A
Sbjct: 114 AAETGWR------DLGAQIFRLAGIYGPGRSAVDTVREGQARRVVKPGQVFSRIHVEDIA 167

Query: 194 RCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT--ANISPFTRF 250
             V+  +   + G ++NL DD+ APPQ VI  A +L+ + PP E  ++   A +SP  + 
Sbjct: 168 AAVLASLDRPNAGAVYNLCDDDAAPPQEVIAYACALLGVEPPPEIAWEEAKATLSPMAQS 227

Query: 251 FYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
           FYADNKR+ N K+K+ LG +L YP+YR  LK
Sbjct: 228 FYADNKRVHNGKMKAELGVRLAYPSYREGLK 258


>gi|254498359|ref|ZP_05111094.1| NAD-dependent epimerase/dehydratase [Legionella drancourtii LLAP12]
 gi|254352420|gb|EET11220.1| NAD-dependent epimerase/dehydratase [Legionella drancourtii LLAP12]
          Length = 289

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 155/290 (53%), Gaps = 9/290 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
             IFG GYT  F+A    ++     GTTR+   +     K  + +   +  ++ + +  L
Sbjct: 5   FFIFGFGYTANFLAQKLSELNFRVIGTTRAQEKI-----KQSTTYELINFSLDEVTK-YL 58

Query: 63  YFTTHIVQCIKPSSE-GDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
            F THI+    P +E GDP + + +     +   V+W+GYLS+T +YG+ +G WVDE S 
Sbjct: 59  SFATHILVSTPPIAESGDPVLTNFADLIRAYSSQVQWLGYLSTTGVYGDHQGAWVDELSA 118

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
                     R +AE+ W++      + L + RL+GIYGPKRN   +I       + K+ 
Sbjct: 119 SISPGKSGRLRLDAEQSWMSFAIAQQLPLHIFRLAGIYGPKRNALERIIAGKQYSIYKEG 178

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
             F+RI V+D+   ++  + H     I+N++DDEP P   +   AASL+       Q ++
Sbjct: 179 HFFSRIHVDDIVSILLASIKHPQPFAIYNVADDEPTPSHILDAYAASLLHCPLLPLQPYE 238

Query: 241 TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIENL 289
           TA +SP    FYA+N+R+SNAKIK +LG  L YP+Y+  LKQL+  +  L
Sbjct: 239 TAKLSPLELDFYANNRRVSNAKIKQALGINLHYPSYKQGLKQLYNSVNAL 288


>gi|302381603|ref|YP_003817426.1| NAD-dependent epimerase/dehydratase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192231|gb|ADK99802.1| NAD-dependent epimerase/dehydratase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 287

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 152/282 (53%), Gaps = 7/282 (2%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L+IFGAGY G   A  A + G+    T+R  +   +L+ +GI+P    D   +  ++  
Sbjct: 5   SLLIFGAGYLGISAAREAQRRGMTAAATSRDPARRASLEAEGIAPV---DPLDDAAMQAA 61

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           +   + I+    P + G P + ++S        +  WIGY+SST++YG+R G WV E   
Sbjct: 62  VVNASAILITAPPDARGCPGLRALSPALSASGAYPDWIGYVSSTAVYGDRAGGWVFEDDA 121

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK- 180
           ++  S    +R  AE +WL   + + + + + RL GIYGP R+   ++R   S R+V+K 
Sbjct: 122 LNAASLEGARRVRAEADWLDAGRGMGLTVQIFRLPGIYGPGRSVVDRLRD-GSARIVRKP 180

Query: 181 NQVFNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            Q+FNR+ VED V      +     GG +NL DDEP+    V+  AA  M +  P E  +
Sbjct: 181 GQIFNRVHVEDAVGGMFASIARPRPGGTYNLCDDEPSSADVVMSWAADRMGLPSPPEVEW 240

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
              ++S   R FY D+KRISNA+ K+ LG+Q +YP +R  L+
Sbjct: 241 TDPSVSDAMRRFYLDSKRISNARAKAELGWQPMYPTWREGLE 282


>gi|33239482|ref|NP_874424.1| NAD dependent epimerase/dehydratase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33237007|gb|AAP99076.1| NAD dependent epimerase/dehydratase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 297

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/295 (34%), Positives = 166/295 (56%), Gaps = 25/295 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++IFG G+TG+ IA  A ++G     + R ++       K  + F F   K   +    L
Sbjct: 18  MLIFGGGFTGQHIAKVARQLGANVLCSRRELN-------KEGADFAFDSSKKVGIPDHIL 70

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              TH++ CI P+ EG DP + + S+      P+  WIGYLS+T +YG+ +G+WV E SF
Sbjct: 71  NHVTHVISCIPPTKEGEDPVLNNFSEKLKAIKPN--WIGYLSTTGVYGDYKGEWVTEKSF 128

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
            HP    + +R + EK+W A    L + + +LRL GIYGP R+    ++ + +L + K  
Sbjct: 129 THPKQKRSIRRLSCEKKWEA----LGLPVQILRLPGIYGPGRSTLEAVKSQKNLVVNKPG 184

Query: 182 QVFNRIRVEDVARCVIFLMTHHL------GGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           QVF+R+ ++D+A  V+ L+  HL        I N++D+ PA    V+  AA+L+KI  P 
Sbjct: 185 QVFSRVHIDDIAGAVMHLI--HLFSSKTSPKIINIADNVPATNVEVMSYAANLLKIPLPP 242

Query: 236 EQCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIE 287
            + FD A  N+SP    F+ +N+R+SN  + K+LG+QL++ +Y+  L    K I+
Sbjct: 243 IESFDIACKNMSPMALSFWQENRRVSNHVLCKTLGYQLIHSDYKSGLTDCLKCID 297


>gi|254523533|ref|ZP_05135588.1| nucleoside-diphosphate-sugar epimerase [Stenotrophomonas sp. SKA14]
 gi|219721124|gb|EED39649.1| nucleoside-diphosphate-sugar epimerase [Stenotrophomonas sp. SKA14]
          Length = 286

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 152/285 (53%), Gaps = 11/285 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTR---SVSNLLTLKHKGISPFLFADQKINNLLR 59
           ++I G G++G+ +A      GV+  GT R   S  +    +H+     L AD  ++  L 
Sbjct: 1   MLILGLGWSGRVLAAQLQARGVHVAGTVRDPASAPHDDVRRHQ-----LRADATLSPALL 55

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           +++     ++  + P +EGD   + +     +  P ++W+GYLSSTS+Y +R G W+D+ 
Sbjct: 56  DEVAQADAVLCSVPPDAEGD-PALRLLLPALQASPALRWVGYLSSTSVYADRAGGWIDDT 114

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           S          QR  AE +W A+ ++  I  AV+RL G+YGP RN  +++ Q  +  +V+
Sbjct: 115 SVADATGIAGVQRRLAEAQWRALAEERGIASAVMRLPGLYGPGRNALLQLAQGRARHVVR 174

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
              VFNR+ V+D+A  +I  M    L  ++  SDDE APPQ+V+  AA L     P    
Sbjct: 175 PGLVFNRLHVQDLAAVIIAAMRRPTLHAVYLPSDDEAAPPQDVLAFAAQLGGFAMPPAVA 234

Query: 239 FDTANISPFTRFFYADNKRI-SNAKIKSLGFQLLYPNYRISLKQL 282
           +D   + P  R FY  NKRI S+   ++LG++  +P YR  L+ L
Sbjct: 235 WDDPLLGPTLRRFYESNKRIDSHGTREALGWEPQFPTYREGLRAL 279


>gi|304320352|ref|YP_003853995.1| hypothetical protein PB2503_03892 [Parvularcula bermudensis
           HTCC2503]
 gi|303299254|gb|ADM08853.1| hypothetical protein PB2503_03892 [Parvularcula bermudensis
           HTCC2503]
          Length = 291

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 149/289 (51%), Gaps = 14/289 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           +++ GAGY+ +  AD AL  G    GTTR       L   GI P+L+  +    L R  +
Sbjct: 4   VLLLGAGYSARVFADQALAEGWLVSGTTRDTHKAKALSQAGIEPYLW--EAGTPLPRAAI 61

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
                IV  I P  +GD C  + +       P  + I YLSS+ +YG+  G W+DE +  
Sbjct: 62  STADLIVVSISP--QGDGCPAAAALAEACPSPSTRVI-YLSSSGVYGDHGGAWIDETTPP 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN-------SL 175
            P      +R  AE  W  +     + L + RL+GIYGP RN    +   +       S 
Sbjct: 119 SPSGERGRRRLAAEAAWQDLAAAFGLDLVLCRLAGIYGPGRNALNSLMTDSQGAKSGLSQ 178

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
           R++K+ QVFNRI VED+AR ++ L        I N +DD P+PPQ+VI+ AA+L+   PP
Sbjct: 179 RVIKEGQVFNRIHVEDIARLLLALAEAETWPAIVNGADDLPSPPQDVILYAAALLGKEPP 238

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
               F+ A +SP  R FY DNKR+ N ++ + L   L YP+YR  L+ L
Sbjct: 239 PAVAFEAAALSPMARSFYVDNKRLKNQRLHTLLPTGLRYPSYREGLRAL 287


>gi|190576314|ref|YP_001974159.1| putative NAD epimerase/dehydratase protein [Stenotrophomonas
           maltophilia K279a]
 gi|190014236|emb|CAQ47880.1| putative NAD epimerase/dehydratase protein [Stenotrophomonas
           maltophilia K279a]
          Length = 308

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 149/287 (51%), Gaps = 13/287 (4%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTR----SVSNLLTLKHKGISPFLFADQKINNL 57
            ++I G G++G+ +A      GV   GT R    +  N L  +H+     L AD   +  
Sbjct: 13  RVLILGLGWSGRVLAAQLRARGVQVAGTVRDPAAAPGNGLR-RHR-----LQADASPSPT 66

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
           L E++     ++  + P +EGDP +  +          ++W+GYLSSTS+Y +R G W+D
Sbjct: 67  LLEEIAHAEAMLCSVPPDAEGDPALRLLLPALLASP-ALRWVGYLSSTSVYADRAGGWID 125

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S       V  QR  AE +W A+  +  I  AV RL G+YGP RN  +++ Q  +  +
Sbjct: 126 ETSAADATGAVGVQRLLAEAQWRALAGQRGIASAVFRLPGLYGPGRNVLLQLAQARARHV 185

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           V+   VFNR+ V+D+A  VI  M    + G++  +DDEPAPPQ+V+  AA L     P  
Sbjct: 186 VRPGLVFNRLHVDDLATVVIASMQRPCVEGLYLPADDEPAPPQDVLTFAAKLGGFAMPPA 245

Query: 237 QCFDTANISPFTRFFYADNKRI-SNAKIKSLGFQLLYPNYRISLKQL 282
             +D   +SP  + FY  NKRI S     +LG+   +P YR  L+ L
Sbjct: 246 VAWDDPALSPTLQRFYQSNKRIDSRGTRAALGWAPRFPTYREGLQAL 292


>gi|123965263|ref|YP_001010344.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9515]
 gi|123199629|gb|ABM71237.1| Nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9515]
          Length = 293

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 151/287 (52%), Gaps = 25/287 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK- 61
            +IFG G++G + A +  K+G     ++RS +N          P  F     NNLL E  
Sbjct: 14  FVIFGGGFSGDYFAKSIRKLGCTALTSSRSANN---------DPNSFIFNSENNLLPEDS 64

Query: 62  -LYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
            L   THI+ CI P   G DP + S+          VKW+GYLS+T +YGN  G WV E 
Sbjct: 65  ILDGVTHILSCIPPDKNGNDPVLKSLKNKINNL--SVKWVGYLSTTGVYGNTHGDWVSEK 122

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
              +P+   + +R N EKEW+      N+ + + RL GIYGP R+    I  K    + K
Sbjct: 123 DEPNPLQQRSQRRLNCEKEWI----HSNLPIQIFRLPGIYGPGRSTLEAITTKKIKVIHK 178

Query: 180 KNQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
            NQVF+RI V D+A  +I+L+ +        I N++DDEP     VI     L+ +  P 
Sbjct: 179 DNQVFSRIHVADIANAIIYLIQNKNKLDFHQIINIADDEPCSQIEVIRYGYQLLGLRMPK 238

Query: 236 EQCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISL 279
           +  F+ A  ++SP  + F+ +N+R+SN  + + LG++L+Y NY++ L
Sbjct: 239 KILFEEAKKDLSPIAQSFWLENRRVSNKLLCEELGYKLIYKNYQVGL 285


>gi|33860589|ref|NP_892150.1| hypothetical protein PMM0029 [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33633531|emb|CAE18488.1| conserved hypothetical protein [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 295

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 154/286 (53%), Gaps = 23/286 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            +IFG G++G + A +  K+G     ++RS+SN          P  F     +N + E  
Sbjct: 14  FLIFGGGFSGDYFAKSIRKLGCIALASSRSISN---------EPNSFIFNSEDNSIPEDS 64

Query: 63  YF--TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G+  ++   K+  K +  +KW+GYLS+T +YGN  G WV E  
Sbjct: 65  IFEGATHILSCIPPDKNGNDPVLKRLKNKIKKL-SLKWVGYLSTTGVYGNTHGDWVCEED 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R N E+EW+      N+ + + RL GIYGP R+    IR K    + K+
Sbjct: 124 QPNPFQERSQRRLNCEREWI----NSNLPIQIFRLPGIYGPGRSTLEAIRTKKIKVIDKE 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+A  +I+L+ +        I N++DDEP     VI  +  L+ +  P +
Sbjct: 180 NQVFSRIHVADIANAIIYLIQNKNNLDFHQIINIADDEPCSQIEVIRYSYQLLGLEMPKK 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISL 279
             F+ A  ++SP  + F+ +N+R+SN  + K LG++L+Y NY+  L
Sbjct: 240 ILFEEAKKDLSPIAQSFWKENRRVSNKLLCKKLGYKLIYKNYKAGL 285


>gi|83313009|ref|YP_423273.1| nucleoside-diphosphate-sugar epimerase [Magnetospirillum magneticum
           AMB-1]
 gi|82947850|dbj|BAE52714.1| Nucleoside-diphosphate-sugar epimerase [Magnetospirillum magneticum
           AMB-1]
          Length = 276

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 144/280 (51%), Gaps = 17/280 (6%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYF 64
           +FG G++G+ IA   ++ G     TTRS           + PF     + + L    L  
Sbjct: 7   LFGLGFSGRVIARGLVEAGWEVMATTRS-GEAADCPGVQVLPF----DRDHRLPAGCLDG 61

Query: 65  TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP 124
              ++  + P   GDP +  M+           W+GYLS+T +YG+  G WVDE +  +P
Sbjct: 62  VEAVLSSVPPDDRGDPVLDLMADAIRAAA--PAWLGYLSTTGVYGDHGGAWVDEATPPNP 119

Query: 125 ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF 184
               + +R  AE +W            + RL+GIYGP R+    +R   + R+VK  QVF
Sbjct: 120 GLDRSRRRLAAETQWRERGAH------IFRLAGIYGPGRSAVDTVRAGQARRVVKPGQVF 173

Query: 185 NRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD--T 241
           +RI VED+A  ++  L     G I+NL DD+ APPQ VI  A +L+ + PP E  ++   
Sbjct: 174 SRIHVEDIAAAILASLGRPDPGAIYNLCDDDAAPPQEVIAHACALLGLEPPPEIPWEQAE 233

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLK 280
           A +SP    FYADNKR+ NA++K  LG +L YP YR  LK
Sbjct: 234 ATLSPMALSFYADNKRVDNARMKRDLGVRLKYPTYREGLK 273


>gi|126695366|ref|YP_001090252.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9301]
 gi|126542409|gb|ABO16651.1| Nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9301]
          Length = 292

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 155/290 (53%), Gaps = 23/290 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            +I G GY+G + A    K G     ++RS+S           P  F     N ++ +  
Sbjct: 14  FLILGCGYSGSYFAKTIKKFGCTVLTSSRSISG---------DPNSFVFNSENGVVPDAK 64

Query: 63  YF--TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G+  ++   K+  K M  ++W+GYLS+T +YGN +G WV E +
Sbjct: 65  IFDGVTHILSCIPPDKNGNDPVLKSLKNKLKSM-SLEWVGYLSTTGVYGNTKGDWVSEIN 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R N EKEW+    +  + + + RL GIYGP R+ F  I+ K    + KK
Sbjct: 124 EPNPFQKRSYKRLNCEKEWI----ESGLPVQIFRLPGIYGPGRSTFEAIKNKKIRVISKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+A  +I+L+ +        I N++DDEP     VI     L+ +T P  
Sbjct: 180 NQVFSRIHVADIANAIIYLLQNKNSLKFYQIINIADDEPCSQIEVIQFCYDLLGLTMPKP 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
             F+ A   +SP  + F+ +N+R+SN  + ++LG++L+Y NY++ LK  +
Sbjct: 240 ILFEDAKEELSPIAKSFWMENRRVSNKLLCETLGYKLIYKNYKVGLKNCY 289


>gi|116074310|ref|ZP_01471572.1| hypothetical protein RS9916_37707 [Synechococcus sp. RS9916]
 gi|116069615|gb|EAU75367.1| hypothetical protein RS9916_37707 [Synechococcus sp. RS9916]
          Length = 311

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 155/295 (52%), Gaps = 20/295 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ GAG++G  IA  A  +G     T R     LT      +   F  Q       E+L
Sbjct: 18  LLVLGAGFSGSRIASLARALGTRVITTNR-----LTDDSDPETALCFDSQLGRLPSPEQL 72

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              TH+V  I P  +G DP +  +       MP ++W+GYLS+T +YG+R+GQWV E   
Sbjct: 73  RGVTHLVSTIAPERDGQDPVLRCLGTQLLD-MP-LQWVGYLSTTGVYGDRQGQWVSEMDP 130

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    + +R   E+ WL+      + + +LRL GIYGP R+PF  IR+     +    
Sbjct: 131 AAPTQERSKRRLGCEQAWLST----GLPVQILRLPGIYGPGRSPFQAIRRGEIRPIDNPG 186

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
            VF+R+ VED+A   + L+     G    + N+ DD PA P  V   AA L+ ++ P  +
Sbjct: 187 HVFSRVHVEDIAGACLHLIDRAASGLRPTLVNVCDDLPAEPAQVQQHAAELLGLSLPQSR 246

Query: 238 CFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIENL 289
            +  A  ++S   R F+A+++R+SN  + + LG+QLL+P++R  ++  W++ ENL
Sbjct: 247 PYADAVDSMSAMARSFWAEHRRVSNRLLCEELGYQLLHPDFRNGIRDCWEQ-ENL 300


>gi|114327371|ref|YP_744528.1| nucleoside-diphosphate-sugar epimerases [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315545|gb|ABI61605.1| nucleoside-diphosphate-sugar epimerases [Granulibacter bethesdensis
           CGDNIH1]
          Length = 318

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 138/285 (48%), Gaps = 15/285 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+IFG GYTG   A  AL  G    GT R   +       G     F D  I     E+L
Sbjct: 31  LLIFGLGYTGTATARLALSDGWSVSGTKRQADSSAL---PGGEVLAFDDPAIA----ERL 83

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
           +  TH++    P   GDP ++   +   +  P ++WIGY SST +YG+ +G WVDE +  
Sbjct: 84  FSATHLLVTAAPDEAGDPVLVRWGEAI-RGAPRLRWIGYYSSTGVYGDWDGAWVDEATPP 142

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P    + +R  AE+ W A+     +   ++RL+GIYGP R+    +R   + R++K   
Sbjct: 143 RPAHARSQRRLEAEQAWEALADHHAVD--IIRLAGIYGPGRSALDDVRAGRARRVIKPGH 200

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG--IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            F RI  +D+AR  +   +    G  I N  DD PA    V+ EAA L+    P    F 
Sbjct: 201 AFGRIHRDDIARATLVAASRAGAGVRILNFVDDCPAESAAVVEEAARLLHAPLPPSVLFK 260

Query: 241 --TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
              A +SP  R F+ DN+R+S    K+ L    LYP++R  L  +
Sbjct: 261 EAVATMSPMARSFWDDNRRVSCVATKAELDIDWLYPSFREGLNAI 305


>gi|158336771|ref|YP_001517945.1| NAD dependent epimerase/dehydratase [Acaryochloris marina
           MBIC11017]
 gi|158307012|gb|ABW28629.1| NAD dependent epimerase/dehydratase [Acaryochloris marina
           MBIC11017]
          Length = 285

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 153/288 (53%), Gaps = 18/288 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA-DQKINNLLR 59
           M ++I G GYTG  + D   +  +    T RS          G+S F FA D   N +L 
Sbjct: 4   MKVLILGCGYTGLRLVDRLTQDNIRVHVTNRSGDI------PGLSAFPFAHDLDTNPVLP 57

Query: 60  EKLYF--TTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
               +   TH++  I P  +G DP  + +     K    +KW GYLS+T +YG+ +G WV
Sbjct: 58  PAAAYEGVTHVLSSIPPDQQGNDPVAVHLLSTLEKLP--LKWFGYLSTTGVYGDSQGAWV 115

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE S V P S  +  R +AE ++L    +  +   + RL GIYGP R+   ++++  +  
Sbjct: 116 DEESPVQPQSVRSQNRVHAETQFL----QSALPTHIFRLPGIYGPGRSILDRLKKGTARN 171

Query: 177 LVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + K   VF+RI V+D+ + V   ++    G I+N +DD P+ P  +I E + L+ I PP 
Sbjct: 172 IFKPGHVFSRIHVDDIVQTVYQSMLNPQPGSIYNAADDLPSEPNTLIEEGSRLLGIQPPP 231

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
              ++   +SP    F+ + +R+SN+KIK+ LG QLL+P+YR  L+ +
Sbjct: 232 VVAYEDVQMSPMAHSFWQECRRVSNSKIKTDLGIQLLHPSYREGLQSI 279


>gi|56751299|ref|YP_172000.1| hypothetical protein syc1290_c [Synechococcus elongatus PCC 6301]
 gi|81299033|ref|YP_399241.1| hypothetical protein Synpcc7942_0222 [Synechococcus elongatus PCC
           7942]
 gi|56686258|dbj|BAD79480.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81167914|gb|ABB56254.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 288

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 147/289 (50%), Gaps = 18/289 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRS----VSNLLTLKHKGISPFLFADQKINN 56
           M ++I G GYTG+ +A       +    TTRS    +         G +P L  D     
Sbjct: 1   MKVLILGGGYTGQRLAQLLAAQSIPVLATTRSGQWPLDEPCVTFDAGSTPLLLPDPA--- 57

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
                L   TH++  I P  +G   ++S      +++  ++W GYLS+T +YG+ +G WV
Sbjct: 58  ----ALAGVTHVLSTIPPLGDGGDPVLSTLLPTLQYL-SLQWCGYLSTTGVYGDTQGAWV 112

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE S +   +  + QR   E +WLA      +   + RL GIYGP R+ F ++R+ ++ R
Sbjct: 113 DEDSPLQSTNRRSQQRIAIEAQWLAS----GLPAHIFRLPGIYGPGRSSFDRLRRGDNQR 168

Query: 177 LVKKNQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           L+K   VF RI V+D+A  +   L   + G I+N+SDD P  P  +I  AA LM +  P 
Sbjct: 169 LLKPGHVFCRIHVDDIAAALWASLQQPNPGRIYNVSDDFPCEPALLIEAAAQLMGVELPP 228

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLW 283
               D   +SP    F+++ +R+ N ++K  LG QL YP+YR  L  +W
Sbjct: 229 PLPVDAVELSPMAASFWSECRRVRNDRLKQELGVQLRYPSYREGLAAIW 277


>gi|123967565|ref|YP_001008423.1| nucleoside-diphosphate-sugar epimerases [Prochlorococcus marinus
           str. AS9601]
 gi|123197675|gb|ABM69316.1| Nucleoside-diphosphate-sugar epimerases [Prochlorococcus marinus
           str. AS9601]
          Length = 292

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 154/290 (53%), Gaps = 23/290 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            ++FG G++G + A    K G     ++RS         +G+ P  F     N ++ +  
Sbjct: 14  FLVFGCGFSGSYFAKTIKKFGCTVLTSSRS---------RGMDPNNFVFNSENGVVPDAK 64

Query: 63  YF--TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G   ++ + K+  K +  ++W+GYLS+T +YGN  G WV E  
Sbjct: 65  IFDGVTHILSCIPPDKNGKDPVLRILKNKLKSL-SLEWVGYLSTTGVYGNTNGDWVSEIH 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R N EKEW+    +  + + + RL GIYGP R+ F  I+ K    + KK
Sbjct: 124 KPNPFQKRSYKRLNCEKEWI----ESGLPIQIFRLPGIYGPGRSTFEAIKNKKIRVISKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+   +I+L+ +        I N++DDEP     VI     L+ +T P  
Sbjct: 180 NQVFSRIHVADIVNAIIYLLQNKNSLKFYQIINIADDEPCSQLEVIQYCYDLLGLTMPKP 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
             F+ A   +SP  + F+ +N+R+SN  + ++LG++L+Y NY+I LK  +
Sbjct: 240 ILFEDAREELSPIAQSFWMENRRVSNKLLCETLGYKLIYKNYKIGLKNCY 289


>gi|58697167|ref|ZP_00372587.1| nucleoside-diphosphate-sugar epimerases [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630668|ref|YP_002727459.1| hypothetical protein WRi_009560 [Wolbachia sp. wRi]
 gi|58536522|gb|EAL59894.1| nucleoside-diphosphate-sugar epimerases [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592649|gb|ACN95668.1| hypothetical protein WRi_009560 [Wolbachia sp. wRi]
          Length = 268

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 32/286 (11%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GY  KF++   L +G    GT+RS  N+  +        LF  +K++  L  
Sbjct: 1   MHLFCFGYGYVAKFLSKKLLNLGWKVSGTSRS-KNIQDV-------ILFNYEKVSQDL-- 50

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  I P  +GD  +    + +   + +VKW+GYLS+TS+YG+  G WVDE S
Sbjct: 51  -LKSATHVLISIPP--DGDDVV----ERYGDCLQNVKWLGYLSATSVYGDHSGNWVDEES 103

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNPFIKIRQKNSLRLV 178
              PI     +R  +EK+W      LN KL V   RL+GIYGP RN  I ++   +  + 
Sbjct: 104 ETRPIEIRGEKRLKSEKKW------LNSKLPVHIFRLAGIYGPGRNVLIDLQLGKARNVK 157

Query: 179 KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           K+   F+RI VED++  +   M +   G I+N +DD P     V++ A  L+ ++PP   
Sbjct: 158 KEGHFFSRIHVEDISNILFSSMQNIKPGEIYNCADDLPTTQSEVVIYATKLLNVSPP--- 214

Query: 238 CFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
             +   +  + + FY  +KR+SN KI K L   L+YPNY++ L+ L
Sbjct: 215 --EPIELPDYAQSFYLGSKRVSNVKIKKDLNVSLIYPNYKVGLESL 258


>gi|87123314|ref|ZP_01079165.1| hypothetical protein RS9917_05625 [Synechococcus sp. RS9917]
 gi|86169034|gb|EAQ70290.1| hypothetical protein RS9917_05625 [Synechococcus sp. RS9917]
          Length = 304

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 156/291 (53%), Gaps = 21/291 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR-EK 61
           L++ GAG++G   A  A ++G      TR ++++     +     L  D ++N L   E+
Sbjct: 18  LLVLGAGFSGSHFAALARQLG------TRVLTSVRLPADRSDPSTLRFDSQLNQLPDPEQ 71

Query: 62  LYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           L   TH++  I P  +G DP I  + +   +    ++W+GYLS+T +YG+R+G WV E  
Sbjct: 72  LQGVTHVLSTIPPERDGQDPVIRCLGETLQRL--PLQWLGYLSTTGVYGDRQGAWVHESD 129

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P+   + +R   E+ W    + L+  + +LRL GIYGP R+PF  I + +   + K 
Sbjct: 130 PATPMQERSQRRLACEEAW----QSLDGPVQILRLPGIYGPGRSPFQAILRGDLQPIDKP 185

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
            QVF+R+ V+D+A     L+     G    + N+SDDEPA    +   AA L+ IT P  
Sbjct: 186 GQVFSRVHVDDIAGACWHLIQQAAQGRRPPVVNISDDEPAASAQIQGYAAELLGITLPQP 245

Query: 237 QCFDTAN--ISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWK 284
           + +  A+  +S   R F+A+N+R+SN  + + LG+ LL+P YR  L   W+
Sbjct: 246 RPYSDASQTMSAMARSFWAENRRVSNTLLCEELGYTLLHPTYRSGLLDCWE 296


>gi|78211591|ref|YP_380370.1| hypothetical protein Syncc9605_0036 [Synechococcus sp. CC9605]
 gi|78196050|gb|ABB33815.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 317

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 149/292 (51%), Gaps = 26/292 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G GY+G+ +A  A  +G     T RS+ +         +  LF     + L    L
Sbjct: 18  LLVLGGGYSGRCLAGLARALGTPVLCTRRSLDS-------AEADLLFDSNGQDQLDPASL 70

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              TH++  I P  +G DP ++ +          ++W GYLS+T +YG+R+G WV EH  
Sbjct: 71  EGITHLLSTIPPDRDGNDPVLLKLLPTLGNL--PLRWAGYLSTTGVYGDRQGGWVSEHDD 128

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    + +R N E+ WL    +  + + +LRL GIYGP R+    + Q  +  + K  
Sbjct: 129 PAPALDRSMRRLNCEQAWL----RSGLPIQILRLPGIYGPGRSVLNGLEQGRARLIDKPG 184

Query: 182 QVFNRIRVEDVARCVIFLM---------THHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           QVF RI VED+A     LM         +   G I N+ DD PAP   ++  AA L+   
Sbjct: 185 QVFCRIHVEDIAGACWHLMHRAEQGVPASPGNGSIVNVVDDLPAPTAELMRHAADLLGCA 244

Query: 233 PPLEQCFD--TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQ 281
            P  + FD    ++SP  + F+++N+R+SN K+ + LG+ LL+PNYR+ L+ 
Sbjct: 245 LPPLKPFDQIVESMSPMAQSFWSENRRVSNHKLCQELGYALLHPNYRVGLQD 296


>gi|78778414|ref|YP_396526.1| hypothetical protein PMT9312_0029 [Prochlorococcus marinus str. MIT
           9312]
 gi|78711913|gb|ABB49090.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9312]
          Length = 292

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 156/288 (54%), Gaps = 23/288 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
             IFG G++G F A    ++G     T+RS       ++K    F+F  +  NN++  + 
Sbjct: 14  FFIFGCGFSGSFFAKTIRQLGYTALTTSRS-------ENKDPHSFVFNSE--NNIVPNEK 64

Query: 63  YF--TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G+  ++   K+  K +  ++W GYLS+T +YG+ +G WV E  
Sbjct: 65  IFDGVTHILSCIPPDKNGNDPVLGSLKNKLKSL-SLEWAGYLSTTGVYGHTKGDWVSETD 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R N EKEW+    +  + + + RL GIYGP R+ F  IR K    + KK
Sbjct: 124 QPNPFQNRSHKRLNCEKEWI----ESGLPVQIFRLPGIYGPGRSTFEAIRNKKIRVISKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+   +I+L+ +    +   I N++DDEP     VI     L+ +  P  
Sbjct: 180 NQVFSRIHVADITNAIIYLLENKNSLNFHQIINITDDEPCSQIEVIQYCYDLLGLKMPKP 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQ 281
             F+ A   +SP  + F+ +N+++SN  + ++LG++L+Y NY+I LK 
Sbjct: 240 ILFEDAKKKLSPIAQSFWMENRKVSNKLLCETLGYKLIYKNYKIGLKN 287


>gi|190571046|ref|YP_001975404.1| hypothetical protein WPa_0639 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019567|ref|ZP_03335373.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357318|emb|CAQ54747.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994989|gb|EEB55631.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 259

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 160/286 (55%), Gaps = 33/286 (11%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GY  KF++   L +G    GT+R         +K I   LF  +K++  L  
Sbjct: 1   MHLFCFGYGYVAKFLSKKLLNLGWKVNGTSR---------NKDIQ--LFDYEKVDQDL-- 47

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  I P  +GD  +    + +   + ++KW+GYLS+T++YG+  G WV+E S
Sbjct: 48  -LKSVTHVLVSIPP--DGDDVM----ERYGHCLENIKWLGYLSATNVYGDHCGNWVNEES 100

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              PI     +R  +EK+WL+      + + + RL+GIYGP RN  I + Q    R VKK
Sbjct: 101 ETKPIEIRGEKRLESEKKWLSS----KLPVHIFRLAGIYGPGRNALIDL-QLGKARNVKK 155

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLG--GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             +F+R+ VED++  ++F    ++    I+N +DD PA    V+  AA L+ I+PP  + 
Sbjct: 156 --IFSRVHVEDISN-ILFSSMQNIKPYEIYNCADDLPATQSEVVTYAAELLNISPP--EP 210

Query: 239 FDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
            + +++  + R FY  +K++SN KI K LG  L+YP+Y++ LK L+
Sbjct: 211 VEISSVPNYARGFYLGSKKVSNTKIKKDLGVSLVYPDYKVGLKSLY 256


>gi|260436386|ref|ZP_05790356.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 8109]
 gi|260414260|gb|EEX07556.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 8109]
          Length = 317

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 153/292 (52%), Gaps = 28/292 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G GY+G+ +A  A  +G     T RS+ +         +  LF     + L    L
Sbjct: 18  LLVLGGGYSGRCLASLARALGTPVLCTRRSLDS-------AEADLLFDSNGQDQLDPAAL 70

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              TH++  I P  EG DP ++ +     + +P ++W GYLS+T +YG+R+G WV E   
Sbjct: 71  EGVTHLLSTIPPDCEGNDPVLLKLLPTL-RSLP-LRWAGYLSTTGVYGDRQGGWVSEQDD 128

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    + +R N E+ WL    +  + + +LRL GIYGP R+    ++Q  +  + K  
Sbjct: 129 PAPALNRSMRRLNCEQAWL----RSGLPIQILRLPGIYGPGRSVLNGLQQGRARLIDKPG 184

Query: 182 QVFNRIRVEDVARCVIFLM---------THHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           QVF RI VED+A     LM         +   G I N+ D+ PAP   ++  AA L+   
Sbjct: 185 QVFCRIHVEDIAGACWHLMHSAGQDAPASPGNGSIVNVVDNLPAPTAELMRHAADLLGCA 244

Query: 233 -PPLEQCFD--TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLK 280
            PPLE  FD    ++SP  + F+++N+R+SN K+   LG+ LL+PNYR+ L+
Sbjct: 245 LPPLEP-FDQIVHSMSPMAQSFWSENRRVSNHKLCHELGYTLLHPNYRVGLQ 295


>gi|42520816|ref|NP_966731.1| hypothetical protein WD1005 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99035964|ref|ZP_01315008.1| hypothetical protein Wendoof_01000144 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410556|gb|AAS14665.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 268

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 150/284 (52%), Gaps = 28/284 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GY  KF++   L +G    GT+RS  N+  +        LF  +K++  L  
Sbjct: 1   MHLFCFGYGYVAKFLSKKLLNLGWKVSGTSRS-KNIQDV-------ILFNYEKVSQDL-- 50

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            L   TH++  I P  +GD  +    + +   + +VKW GYLS+TS+YG+  G WV+E S
Sbjct: 51  -LKSATHVLISIPP--DGDDVV----ERYGDCLQNVKWFGYLSATSVYGDHSGNWVNEES 103

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              PI     +R  +EK WL       + + + RL+GIYGP RN  I ++   +  + K+
Sbjct: 104 ETKPIEIRGEKRLRSEKRWL----NSRLPVHIFRLAGIYGPGRNVLIDLQLGKARNVKKE 159

Query: 181 NQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
              F+RI VED++  +   M +   G I+N +DD P     V++ A  L+ ++PP     
Sbjct: 160 GHFFSRIHVEDISNILFSSMQNIKPGEIYNCADDLPTTQSEVVIYATKLLNVSPP----- 214

Query: 240 DTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
           +   +  + + FY  +KR+SN KI K L   L+YPNY++ L+ L
Sbjct: 215 EPIELPDYAQSFYLGSKRVSNVKIKKDLNVSLIYPNYKVGLESL 258


>gi|254418712|ref|ZP_05032436.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Brevundimonas
           sp. BAL3]
 gi|196184889|gb|EDX79865.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Brevundimonas
           sp. BAL3]
          Length = 303

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 146/282 (51%), Gaps = 7/282 (2%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++FG GY G+  A  A++ G     T+R      +L  +GI+    AD +    L+  L
Sbjct: 16  LLVFGGGYLGRAAALEAIRRGGRAVATSRDAERRRSLSAEGITAIDPADPEA---LKTAL 72

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              T ++    P + G P + ++     +  P   WIGY+SSTS+YG+R G WV E   +
Sbjct: 73  EAATAVLVTAAPDAHGCPGLRALGPVASQAWPD--WIGYVSSTSVYGDRAGGWVFEDGPL 130

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
           +  S    +R   E++WL   + + + + + RL G YGP R+   ++R   +  + K  Q
Sbjct: 131 NAASLEGARRVRVERDWLDGGQGMGLTVQIFRLPGFYGPGRSVVERLRDGTARLVRKPGQ 190

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VFNRI V+DV   +   M     G  +NL+DDEPA    V+  AA+ M +  P E  +  
Sbjct: 191 VFNRIHVDDVVSALFASMDRPRPGAAYNLTDDEPAAADVVVEWAAAKMGLPRPPEIDWTD 250

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            ++S   R FY D+KR+SNA  K+ LG++  YP +R  L  +
Sbjct: 251 DSVSEAMRRFYLDSKRVSNALAKAELGWRPKYPTWREGLATM 292


>gi|124024741|ref|YP_001013857.1| nucleoside-diphosphate-sugar epimerases [Prochlorococcus marinus
           str. NATL1A]
 gi|123959809|gb|ABM74592.1| Nucleoside-diphosphate-sugar epimerases [Prochlorococcus marinus
           str. NATL1A]
          Length = 298

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 159/290 (54%), Gaps = 24/290 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYT-CGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           L+IFG G++G+ IA     +GV   C   R  S       KG +     DQ+  N   E 
Sbjct: 18  LIIFGGGFSGQRIASVGRHLGVKVLCSRRREGS-------KGANFIFNTDQEFTN---EV 67

Query: 62  LYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           L   TH++ CI P   G DP ++ +          +KW+GYLS+T +YG+ +G WV+E++
Sbjct: 68  LEGATHVLSCIPPLLSGEDPVLLKLKTQLLN-AKKIKWVGYLSTTGVYGDSKGNWVNENT 126

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P+   + +R + EK+WL       + + +LRL GIYGP R+ F  +    +  + K 
Sbjct: 127 PPNPLQERSIRRLSCEKQWLDT----KLPIQILRLPGIYGPGRSVFESLLNGTTKMIDKP 182

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
            QVF+RI V+D+A  V+FL+  +  G    I N++D+ PA   +VI  AA++ K + P +
Sbjct: 183 GQVFSRIHVDDIAGSVLFLINLYFQGKTPSIVNVADNLPANNLDVINFAANIAKKSLPSK 242

Query: 237 QCFDTAN--ISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
             F+ A   +SP  + F+ +N+++ N  + K LG+ L+YP+++  LK  +
Sbjct: 243 VPFEIAQKTMSPMAKSFWQENRKVDNKLLCKKLGYSLIYPDFKSGLKNCY 292


>gi|149919577|ref|ZP_01908056.1| hypothetical protein PPSIR1_06888 [Plesiocystis pacifica SIR-1]
 gi|149819520|gb|EDM78948.1| hypothetical protein PPSIR1_06888 [Plesiocystis pacifica SIR-1]
          Length = 300

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 140/284 (49%), Gaps = 15/284 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTR---SVSNLLTLKHKGISPF-LFADQKINNLL 58
           L+  G GYT   +A      G    GTTR   + +  L        P+ L A      L 
Sbjct: 15  LLCLGLGYTATRLALRLHARGFEIVGTTRDPEAKAATLPASAAATRPWELVAFDGSAPLP 74

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
              L   TH+V  I+P  + DP ++    +F   +P ++W  YLS+T +YG+ EG WVDE
Sbjct: 75  ARALAGVTHVVHSIRPGPD-DP-VLRHHPEFAAELPGLRWAAYLSTTGVYGDHEGAWVDE 132

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
                P      +R  AE  WLA          V RL+GIYGP R+   ++    + R+V
Sbjct: 133 DGPRRPSKERTRRRVAAEDRWLAAGAH------VFRLAGIYGPGRSALERVESGRARRVV 186

Query: 179 KKNQVFNRIRVEDVARCVIFLMT--HHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           K  +VFNRI V+D+   ++  +         +NLSD +P     VI  AA L+ + PP  
Sbjct: 187 KAGKVFNRIHVDDIVEVLVRSIDGPRRSPRAYNLSDGQPCSSAEVIEYAAQLLGVDPPPP 246

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISL 279
             F+ A +SP  R F++DN R++N +I+  LG +L YP+YR  L
Sbjct: 247 VAFEDAELSPMARSFWSDNLRVANTRIREELGVELRYPDYRAGL 290


>gi|254525548|ref|ZP_05137600.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9202]
 gi|221536972|gb|EEE39425.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9202]
          Length = 292

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 155/293 (52%), Gaps = 23/293 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            +I G G++G F A    ++G     ++RS             P+ F     ++++  K 
Sbjct: 14  FLILGCGFSGSFFAKTIRQLGCTALTSSRSEKK---------DPYSFVFNSDSDVVPHKK 64

Query: 63  YFT--THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G+  ++   K+  K +  ++W+GYLS+T +YG+ +G WV E  
Sbjct: 65  IFNGVTHILSCIPPDKNGNDPVLKCLKNRLKSL-SLEWVGYLSTTGVYGHTKGDWVSEID 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P+   + +R N EKEW+       + + + RL GIYGP R+ F  I+ K    + KK
Sbjct: 124 EPNPLQKRSYKRLNCEKEWI----DSGLPVQIFRLPGIYGPGRSTFEAIKNKKIRVIFKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+   +I+L+ +        I N++DD+P     VI     L+ +T P  
Sbjct: 180 NQVFSRIHVADITNAIIYLLQNKNALKFYQIINIADDKPCSQIEVIQYCYDLLGLTMPKP 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEI 286
             F+ A   +SP  + F+ +N+++SN  + ++LG++L+Y NY+  LK  ++ I
Sbjct: 240 ILFEDAKEELSPIAQSFWMENRKVSNKLLCETLGYKLIYKNYKKGLKNCYQNI 292


>gi|157412367|ref|YP_001483233.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9215]
 gi|157386942|gb|ABV49647.1| Nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9215]
          Length = 292

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 155/293 (52%), Gaps = 23/293 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            +I G G++G F A    ++G     ++RS             P+ F     ++++  K 
Sbjct: 14  FLILGCGFSGSFFAKTIRQLGCTALTSSRSEKK---------DPYSFVFNSDSDVVPHKK 64

Query: 63  YF--TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            F   THI+ CI P   G+  ++   K+  K +  ++W+GYLS+T +YG+ +G WV E  
Sbjct: 65  IFDGVTHILSCIPPDKNGNDPVLKCLKNRLKSL-SLEWVGYLSTTGVYGHTKGDWVSEID 123

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P+   + +R N EKEW+       + + + RL GIYGP R+ F  I+ K    + KK
Sbjct: 124 EPNPLQKRSHKRLNCEKEWI----DSGLPVQIFRLPGIYGPGRSTFEAIKNKKIRVISKK 179

Query: 181 NQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           NQVF+RI V D+   +I+L+ +        I N++DD+P     VI     L+ +T P  
Sbjct: 180 NQVFSRIHVADITNAIIYLLQNKNSLKFYQIINIADDKPCSQIEVIQYCYDLLGLTMPKP 239

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEI 286
             F+ A   +SP  + F+ +N+++SN  + ++LG++L+Y NY+  LK  ++ I
Sbjct: 240 ILFEDAKEELSPIAQSFWMENRKVSNKLLCQTLGYKLIYKNYKKGLKNCYQNI 292


>gi|72383193|ref|YP_292548.1| NAD dependent epimerase/dehydratase [Prochlorococcus marinus str.
           NATL2A]
 gi|72003043|gb|AAZ58845.1| NAD dependent epimerase/dehydratase [Prochlorococcus marinus str.
           NATL2A]
          Length = 298

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 159/294 (54%), Gaps = 24/294 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYT-CGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           L+IFG G++G+ IA     +GV   C   R  S       KG       DQ+++N   E 
Sbjct: 18  LIIFGGGFSGQRIASVGRHLGVKVLCSRRREGS-------KGADFIFNTDQELSN---EI 67

Query: 62  LYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           L   THI+ CI P   G DP ++ +          +KW+GYLS+T +YG+ +G WV+E++
Sbjct: 68  LEGATHILSCIPPLLSGEDPVLLKLKTQLLN-SKKIKWVGYLSTTGVYGDSKGNWVNENT 126

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R + EK+WL       + + +LRL GIYGP R+ F  +    +  + K 
Sbjct: 127 PPNPQQDRSIRRLSCEKQWL----DTKLPIQILRLPGIYGPGRSVFESLLNGTTKMIDKP 182

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
            QVF+RI V+D+A  V+FL+  +  G    I N++D+ PA   +VI  AA + K + P  
Sbjct: 183 GQVFSRIHVDDIAGSVLFLINLYFQGKTPSIVNVADNLPANNLDVINFAAKIAKKSLPSR 242

Query: 237 QCFDTAN--ISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIE 287
             F+ A   +SP    F+ +N+++ N  + K LG+ L+YP+++  LK  + +++
Sbjct: 243 VPFEIAQKTMSPMAISFWQENRKVDNKLLCKKLGYSLIYPDFKSGLKNCFLQLK 296


>gi|83944924|ref|ZP_00957290.1| hypothetical protein OA2633_09854 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851706|gb|EAP89561.1| hypothetical protein OA2633_09854 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 282

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 149/288 (51%), Gaps = 17/288 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLRE 60
           + +FG G+T + IA    + G +   TTRS   +  +   G  P +   ++   + +L++
Sbjct: 6   ITLFGFGFTARAIARRLSEDGWHVRATTRSTGQVEAIAALGYEPVIADPSNAADHPVLQD 65

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSK-DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
               +  +V C  P  +GDP   ++S  D        +W+GYLS+T +YG+R+G W  E+
Sbjct: 66  AARASDALVFCAPPGQDGDPFAPALSALDL-----SAQWLGYLSTTGVYGDRQGGWAFEY 120

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
               P    + +R  AE  WL    +L       RL+GIYGP R+ F ++ + + +    
Sbjct: 121 EATTPGQDRSIRRAEAEAHWLERGARL------FRLAGIYGPGRSAFDRL-EADKIVFDV 173

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
              VF+RI V+D+AR V   +    + G FNLSDD P    +V+  AA +  +  P  + 
Sbjct: 174 PGHVFSRIHVDDIARAVSLAIARPEVSGAFNLSDDWPDTQPHVMTGAAQIAGLPGPRIEP 233

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKE 285
           FD    SP    FYA+ +R+SNA+ K +LG++  YP++R  L+ +W +
Sbjct: 234 FDPDKASPMQASFYAECRRVSNARAKAALGWRPNYPSWREGLQAIWDQ 281


>gi|88809329|ref|ZP_01124837.1| hypothetical protein WH7805_09264 [Synechococcus sp. WH 7805]
 gi|88786548|gb|EAR17707.1| hypothetical protein WH7805_09264 [Synechococcus sp. WH 7805]
          Length = 308

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 20/294 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L I GAG++G  +A  A  + +    T R  S     +H       F         R +L
Sbjct: 18  LCILGAGFSGSRLASLASALQIPVISTRREPSP--DSEH-----LAFDTATGQAPDRRQL 70

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  I P  +G+  ++    D  +  P ++W+GYLS+T +YGN +G WV E    
Sbjct: 71  EGITHLLNTIPPDRDGNDPVLKTLGDQIQQWP-LRWVGYLSTTGVYGNTDGAWVCEDDPP 129

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P    + +R   E+EW A      + L +LRL GIYGP R+    ++      + K  Q
Sbjct: 130 EPTQDRSRRRLACEQEWQAS----GLPLQILRLPGIYGPGRSALAAVKAGTLQPVDKPGQ 185

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
           +F RI V+DVA   + LM     G    I N+ DDEPA   +V   AASL+    P  + 
Sbjct: 186 MFCRIHVDDVAAACLHLMHRSAQGQHPEIVNVCDDEPAASVSVHRYAASLLNCELPQPKP 245

Query: 239 FD--TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIENL 289
           F    A++S   R F+ADN+R+SN +++  LG++L+YP YR  L Q   EIE L
Sbjct: 246 FTEAEASMSAMARSFWADNRRVSNQRLRQDLGYELIYPTYRSGLAQCL-EIETL 298


>gi|148238372|ref|YP_001223759.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 7803]
 gi|147846911|emb|CAK22462.1| Nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 7803]
          Length = 308

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 144/286 (50%), Gaps = 19/286 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L I GAG++G  +A  A  +G+    T R  +        G     F           +L
Sbjct: 18  LCILGAGFSGGRLAALAAALGIPVISTRREPA-------PGSGHLTFDSASGQGPDPHQL 70

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++  I P  +G+  +++   D  K  P ++W+GYLS+T +YGN +G WV E+   
Sbjct: 71  EGVTHLLNTIPPDRDGNDPVLTTLGDQIKRWP-LRWVGYLSTTGVYGNTDGAWVCENDPP 129

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P    + +R   E+EW A      + L +LRL GIYGP R+P   ++      + K  Q
Sbjct: 130 QPSQERSRRRLACEQEWQAS----GLPLQILRLPGIYGPGRSPLAAVKAGTLQPVDKPGQ 185

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
           +F RI V+DVA   + LM     G    I N+ DDEPA   +V   AASL+    P  + 
Sbjct: 186 MFCRIHVDDVAAAALHLMHCSAQGQHPEIVNVCDDEPAASVSVHRYAASLLNCELPQPKA 245

Query: 239 F--DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
           F    A +S   R F+ADN+R+SN +++  LG++L++P YR  L Q
Sbjct: 246 FAEAEAGMSAMARSFWADNRRVSNRRLREDLGYELIHPTYRSGLAQ 291


>gi|148555664|ref|YP_001263246.1| NAD-dependent epimerase/dehydratase [Sphingomonas wittichii RW1]
 gi|148500854|gb|ABQ69108.1| NAD-dependent epimerase/dehydratase [Sphingomonas wittichii RW1]
          Length = 260

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 143/283 (50%), Gaps = 29/283 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL++FG GYT   I +A  +         R+                 AD+     +   
Sbjct: 3   HLLVFGPGYTASHIVNAVQEREFAVETIDRAT---------------IADEA---RVAAA 44

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           +   THI+  + P  + DP +        +     +WIGYLSS+ +YG+  G WVDE + 
Sbjct: 45  IDRATHILSSVPPDGDADPVLARHGPAIARS--GARWIGYLSSSGVYGDTGGAWVDEAAP 102

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V   +   T R  A+  W A    L+ ++ V RL GIYGP R+P  ++R   + R+    
Sbjct: 103 V--GAGRRTARAAADLAWQA----LHPQVRVFRLPGIYGPGRSPLDRVRGGQAHRVDLPG 156

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA-SLMKITPPLEQCFD 240
           QVF+R+ V+D+   V+  +     G+FNL+DD PA  QN ++EAA  L+ + PP     D
Sbjct: 157 QVFSRVHVDDIVGGVLASIDRGPAGVFNLADDRPA-SQNAVIEAACDLLGMAPPPLLPLD 215

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            A +SP  R FYA+N+R++N K K  LG+   +P+YR  L+ L
Sbjct: 216 RAGLSPAARAFYAENRRVANGKAKRLLGWTPRHPDYRAGLRAL 258


>gi|148261473|ref|YP_001235600.1| NAD-dependent epimerase/dehydratase [Acidiphilium cryptum JF-5]
 gi|146403154|gb|ABQ31681.1| NAD-dependent epimerase/dehydratase [Acidiphilium cryptum JF-5]
          Length = 286

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 142/285 (49%), Gaps = 15/285 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G GYTG+ +A AA   G     T R  +         + PF  A   + +      
Sbjct: 5   LLIAGLGYTGRAVATAARDAGFAVLATARDPAGRSAPGGVALIPFAEAAAALPD------ 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P   GDP +   +         ++WIGY S+T +YG+R+G  VDE +  
Sbjct: 59  --ATHLLVTAAPGEAGDPLLALCADAIAAAP-ALRWIGYFSTTGVYGDRQGGSVDETTPP 115

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S    +R  AE+ W A+    +  + V+RL+GIYGP R+ F  +R   + R+ +  Q
Sbjct: 116 APGSPRTLRRVEAEQNWAAMAND-HRAVDVIRLAGIYGPGRSAFDDLRAGTARRIDRPGQ 174

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG--IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            F+RI V+D+A   +  +    GG  I N +DDEPAP  +VI  AASL+ I PP    FD
Sbjct: 175 KFSRIHVDDIAGGTLASIATATGGVRILNFADDEPAPSADVIAHAASLLGIAPPPLIPFD 234

Query: 241 TA--NISPFTRFFYADNKRI-SNAKIKSLGFQLLYPNYRISLKQL 282
            A   +SP    F+++N+ + S     +L     +P+YR  L+ +
Sbjct: 235 EARRGMSPMALSFWSENRIVRSEGTRAALRRPWRFPSYREGLEAI 279


>gi|158426301|ref|YP_001527593.1| putative NAD-dependent epimerase [Azorhizobium caulinodans ORS 571]
 gi|158333190|dbj|BAF90675.1| putative NAD-dependent epimerase [Azorhizobium caulinodans ORS 571]
          Length = 294

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 151/288 (52%), Gaps = 3/288 (1%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+  G GY  +    +   V     GT R+      +   G    +F    ++  L   +
Sbjct: 4   LLAVGLGYCARHFIASHPAVFDRVIGTARTAEGAAAVTATGAEGLVFDGSAVHPELAAAI 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
                ++    P   GDP +++ ++   +  P+++ + YL++  +YG+ +G WVDE +  
Sbjct: 64  AAADVLMLSAPPGEAGDP-LLAAARAQIEAAPNLRQVLYLTTLGVYGDHQGGWVDEDTPP 122

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
              S    +R  AE + LA+     I +AVLRL+GIYGP+RN F++++   + R+ K NQ
Sbjct: 123 KAGSARLERRLAAEADLLALGTAKGIPVAVLRLAGIYGPERNAFLQLKAGEARRIEKPNQ 182

Query: 183 VFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA 242
           VFNRI V D++  +  ++    GG+ N++DD PAPP + I  AA LM I PP    F+ A
Sbjct: 183 VFNRIHVADISVAMAKVIETGFGGLLNVTDDRPAPPGDPIAFAAGLMGIAPPPAIPFEVA 242

Query: 243 --NISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIEN 288
             ++S     F+A +KR+ N ++K+LG  L YP Y   L  L+ E++ 
Sbjct: 243 ARSMSRMALSFWAASKRVRNDRLKALGVALAYPTYEEGLTALYGELKG 290


>gi|103485967|ref|YP_615528.1| NAD-dependent epimerase/dehydratase [Sphingopyxis alaskensis
           RB2256]
 gi|98976044|gb|ABF52195.1| NAD-dependent epimerase/dehydratase [Sphingopyxis alaskensis
           RB2256]
          Length = 262

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 139/283 (49%), Gaps = 25/283 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++IFG GY    +A+     G    GTTR                 F D+     +   
Sbjct: 3   RMLIFGMGYAAGHLAERLRARGWEVTGTTRDGR---------ADSIAFGDE---TAVLAA 50

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L   THI+  + P+ E DP +++   +     P   W GYLSST +YG+  G WVDE + 
Sbjct: 51  LRTATHILSSVPPAGEADP-VLARYGEAIALAP-ATWTGYLSSTGVYGDAGGAWVDESA- 107

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P+      R  A+  W A    L   + V RL GIYGP R+   +I +  + R+   +
Sbjct: 108 --PVRGRRAGRNAADAAWSA----LRGDMCVFRLPGIYGPGRSILDRIAEGRAHRIALPD 161

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP-PLEQCFD 240
           QVF+RI V+D+A  +I        G++NL+DDEP   QN ++E    M   P P  Q  D
Sbjct: 162 QVFSRIHVDDIAGGIIASF-RGPAGVYNLADDEPC-HQNRLVEWGCAMLGAPLPPMQSLD 219

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            A +SP  R FYA+N+R++N K K  LG++  YP++R  L  L
Sbjct: 220 EAGLSPAARAFYAENRRVANGKAKRLLGWRPRYPSFREGLASL 262


>gi|33864573|ref|NP_896132.1| hypothetical protein SYNW0037 [Synechococcus sp. WH 8102]
 gi|33632096|emb|CAE06552.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 301

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 154/295 (52%), Gaps = 29/295 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVS----NLLTLKHKGISPFLFADQKINNLL 58
           +++ G GY+G  +      +G     + RS+S    +L+     G+ P            
Sbjct: 18  VLVLGGGYSGGHLTRLLRALGTTVRCSRRSLSSPEADLVFDSTAGLIPT----------- 66

Query: 59  REKLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
              L   TH++  I P++EG DP +  +     +    + W+GYLS+T +YG+++G+WV 
Sbjct: 67  SRDLDGITHVLSTIPPTTEGHDPVLTHLGSQLKER--SLTWVGYLSTTGVYGDQQGRWVS 124

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E    +P    + +R   E+ WL       + + +LRL GIYGP R+    +R   + R+
Sbjct: 125 EDDPANPGQPRSQRRHACEQAWL----DSGLPVQILRLPGIYGPGRSVLDSLRTGTARRI 180

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITP 233
           +K +QVF RI V+D+A   + LM     G    I N+SDD PA PQ+++   A+L+    
Sbjct: 181 LKADQVFCRIHVDDIAGACLHLMHQAAAGPGPAIVNVSDDRPAAPQDLLQYGAALLNCKL 240

Query: 234 PLEQCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKE 285
           P E+ F+ A  ++S   R F+++N+R+ N  + + LG+ LL+P+++  L+   ++
Sbjct: 241 PDEEPFELASHSMSAMARSFWSENRRVRNTLLCQQLGYALLHPDFKAGLQDCLRQ 295


>gi|317968388|ref|ZP_07969778.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. CB0205]
          Length = 292

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 148/296 (50%), Gaps = 28/296 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           +++ G GYTG+  ADAA   G     T+RS+       H        A +     L E L
Sbjct: 12  VLVLGGGYTGQRFADAARARGAQVWLTSRSIKEGSQWLH------FNAGEGAVPQLPEGL 65

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +H++  + P+  G+    ++  +  +  P ++W+GYLS+T +YG+ +G+W DE S  
Sbjct: 66  ---SHVLITLPPNKNGEDDAYNLLGESLRHQP-LQWVGYLSTTGVYGDTQGRWADEQSPT 121

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P    +  R   E+ WLA      + L   RL  IYGP R PF +++Q  +  + K  Q
Sbjct: 122 EPGLRRSQSRLQCEQRWLASA----LPLQSFRLPAIYGPGRCPFQQLQQGQARLIHKPKQ 177

Query: 183 VFNRIRVEDVARCVIFLMTHHLG-------GIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           VF RI V+D    ++ ++ H  G        + N+SDD P P    +  AA L+    P 
Sbjct: 178 VFCRIHVDD----IVGVLLHCCGLPPEARPAVLNVSDDLPCPSSETLGYAAHLLGCKLPA 233

Query: 236 EQCFDTAN--ISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIEN 288
            + F  A   +S     F+ADN+R+SNA++ + LG+QL YP+YR      W+E +N
Sbjct: 234 VRNFRDAQAEMSAMALSFWADNRRVSNARLCQDLGYQLRYPSYREGFAASWEEEQN 289


>gi|58584804|ref|YP_198377.1| nucleoside-diphosphate-sugar epimerase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419120|gb|AAW71135.1| Nucleoside-diphosphate-sugar epimerase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 273

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 147/288 (51%), Gaps = 33/288 (11%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRS--VSNLLTLKHKGISPFLFADQKINNLL 58
           MHL  FG GY  +F++   L +     GT+R+  V N     +  ++   F D       
Sbjct: 1   MHLFCFGYGYVARFLSKKLLSLSWKVSGTSRNQDVHNTNFFNYDKVNKDTFQD------- 53

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
                  TH++  I P  +GD  +    + +  +  + KW+GYLS+ S+YG+  G WV E
Sbjct: 54  ------VTHVLVSIPP--DGDDAL----ERYGHYFQNTKWLGYLSAASVYGDHAGNWVKE 101

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNPFIKIRQKNSLR 176
            S   PI      R  AEK+W      LN KL V   RL+GIYGP RN  + ++   +  
Sbjct: 102 ESETKPIESRGKSRLRAEKKW------LNSKLPVHIFRLTGIYGPGRNVLVDLQLNKARN 155

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + K+   F+RI VED++  +   M +   G I+N +DD PA    V+  AA L+ ++ P 
Sbjct: 156 VQKEGHFFSRIHVEDISNILFSSMQNIKPGEIYNCADDLPATQSEVVAYAAELLNVSVP- 214

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
            +  + +++    + FY  +K++SN K+K  LG  L+YPNY++ L+ L
Sbjct: 215 -EPVEISSLPDHAQSFYLGSKKVSNIKVKRDLGISLVYPNYKVGLENL 261


>gi|87201281|ref|YP_498538.1| NAD-dependent epimerase/dehydratase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136962|gb|ABD27704.1| NAD-dependent epimerase/dehydratase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 282

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 145/284 (51%), Gaps = 30/284 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVG--VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           ++IFG GYT + +A A    G  V+  G+   ++              FAD+        
Sbjct: 4   MLIFGMGYTAQVLARALRATGWEVHGTGSAGDIA--------------FADRAAVEA--- 46

Query: 61  KLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
            L   +H++  + P+ EG DP + S           V+WIGYLSST +YG+  G WVDE 
Sbjct: 47  ALAGASHVLSSVPPAREGGDPVLDSYGPAIAAS--GVEWIGYLSSTGVYGDAGGAWVDES 104

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           + V   +   + R  A+  W A++ ++     V RL GIYGP R+   ++    + R+  
Sbjct: 105 APVG--TGRRSARTAADLAWQALSPEVR----VFRLPGIYGPGRSALDRVAAGRAHRIDL 158

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
             QVF+R+ VED+A  VI       G ++NL+DD P     VI EAA L+ + PP     
Sbjct: 159 PEQVFSRVHVEDIASGVIASFDGPPG-VYNLADDLPCGQNAVIEEAARLLGVPPPPMLTL 217

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           + AN+SP    FYA+N+R++N + +  LG++  +P YR  L+ L
Sbjct: 218 EQANLSPMALAFYAENRRVANGRARRLLGWKPAFPTYREGLRDL 261


>gi|220910248|ref|YP_002485559.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7425]
 gi|219866859|gb|ACL47198.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7425]
          Length = 287

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 149/291 (51%), Gaps = 18/291 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK--GISPFLFADQKINNLL 58
           M ++I G GYTG  +A       +   GTTRS    L ++      S  + A   +N + 
Sbjct: 1   MKVLILGCGYTGSRLARFLQSQAIPVQGTTRSGMCPLEVEIPCFAFSSDVAAQTSLNPIA 60

Query: 59  REKLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQW 115
            E     TH++  I P+ +G DP + S+     +      ++W GYLS+T +YG+  G W
Sbjct: 61  LEG---ATHVLTTIPPNEQGNDPIVQSLLPQLEQLARQGTLQWFGYLSTTGVYGDTGGAW 117

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLA--VLRLSGIYGPKRNPFIKIRQKN 173
           VDE S + P +  +  R   E      T  LN  L   + RL GIYGP R+ F +IR   
Sbjct: 118 VDETSPLQPQNQRSQHRVKTE------TTLLNSALPTHIFRLPGIYGPGRSVFERIRSGT 171

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           + R+ +   VF+RI V+D+ + +   M     G I+N+SDDEP  P ++I  A  L+ + 
Sbjct: 172 AQRIDRPGHVFSRIHVDDIVQTLWRSMLQPACGEIYNVSDDEPCEPADLITLACELLSVQ 231

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           PP    +    +SP    F+++ +R+ N KIK+ LG +LLYP YR  L+ +
Sbjct: 232 PPEWIPYHQVKLSPMAASFWSECRRVENYKIKNQLGVKLLYPTYREGLQAI 282


>gi|326404956|ref|YP_004285038.1| NAD-dependent epimerase/dehydratase family protein [Acidiphilium
           multivorum AIU301]
 gi|325051818|dbj|BAJ82156.1| NAD-dependent epimerase/dehydratase family protein [Acidiphilium
           multivorum AIU301]
          Length = 286

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 142/285 (49%), Gaps = 15/285 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G GYTG+ +A AA   G     T R  +     +   + PF  A   + +      
Sbjct: 5   LLIAGLGYTGRAVATAARDAGFAVLATARDPAGRSAPEGVALVPFAEAAAALPD------ 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++    P   GDP +   +         ++WIGY S+T +YG+R+G  VDE +  
Sbjct: 59  --ATHLLVTAAPGEAGDPLLALCADAIAAAP-ALRWIGYFSTTGVYGDRQGGSVDETTPP 115

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P S    +R  AE+ W A+    +  + ++RL+GIYGP R+    +R   + R+ +  Q
Sbjct: 116 APGSPRTLRRVEAEQNWAAMAND-HRAVDIIRLAGIYGPGRSAIDDLRAGTARRIDRPGQ 174

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG--IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            F+RI V+D+A   +  +    GG  I N +DDEPAP  +VI  AASL+ I PP    FD
Sbjct: 175 KFSRIHVDDIAGGTLASIATATGGVRILNFADDEPAPSADVIAHAASLLGIAPPPLIPFD 234

Query: 241 TA--NISPFTRFFYADNKRI-SNAKIKSLGFQLLYPNYRISLKQL 282
            A   +SP    F+++N+ + S     +L     +P+YR  L+ +
Sbjct: 235 EARRGMSPMALSFWSENRIVRSEGTRAALRRPWRFPSYREGLEAI 279


>gi|163797904|ref|ZP_02191847.1| NAD-dependent epimerase/dehydratase [alpha proteobacterium BAL199]
 gi|159176779|gb|EDP61349.1| NAD-dependent epimerase/dehydratase [alpha proteobacterium BAL199]
          Length = 305

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 141/289 (48%), Gaps = 8/289 (2%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KGISPFLFADQKINNLLRE 60
           H++ FG GYT   +A      G    GT R       L   +G+   +F       +  E
Sbjct: 13  HVLFFGLGYTALRLARRLKAAGWRVSGTVRDAGKAADLAAAEGVEIHVF--DGAGPIAGE 70

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
                TH+V  I P   G P ++    +  +  P ++W+GYLS+ ++YG+R+G W  E  
Sbjct: 71  SFTGVTHLVDSIPPGEAGAPPLVQHRAEL-RACPTLQWVGYLSTPAVYGDRQGGWAREDD 129

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIY--GPKRNPFIKIRQKNSLRLV 178
              P S    +R  AE+ W+A      + + V R++GIY  GP RNP   +    +  + 
Sbjct: 130 APSPGSVRGERRAAAERAWIAAFDGTAVAVQVFRIAGIYGPGPGRNPVEALAAGTARIID 189

Query: 179 KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           K  QVFNRI V+D+   ++  M     GGI+N++DDE     + I  AA L+ + PP   
Sbjct: 190 KPGQVFNRIHVDDIGSVLLAGMARPRHGGIYNVADDEACASADPIRFAAELLGVAPPEPI 249

Query: 238 CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKE 285
            FD+A +S   R FYA+ KR+   +IK  LG  L YP YR  L  L  E
Sbjct: 250 AFDSAELSLMARSFYAECKRLDTTRIKEELGVVLTYPTYREGLAALMAE 298


>gi|194688608|gb|ACF78388.1| unknown [Zea mays]
 gi|195622064|gb|ACG32862.1| nucleoside-diphosphate-sugar epimerase [Zea mays]
          Length = 329

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 155/296 (52%), Gaps = 18/296 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLR 59
           ++ +FGAG+ G+++++  L  G    GT  +V+    L+  G++  +F   +  + N+  
Sbjct: 22  NMFVFGAGFVGRYVSERLLAQGWQVSGTCTTVTTKRELEMLGMNASVFDGTEDSLENI-- 79

Query: 60  EKLYFTTHIVQCIKP-SSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQWV 116
             L   TH++  I P    GDP +I++ +D  + + H  ++W+ YLSSTS+YG+  G  V
Sbjct: 80  HSLRQATHLLISIPPIPGVGDPLLINLDEDLRRILGHGNLEWLCYLSSTSVYGDCGGVLV 139

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL- 175
           DE   V+P S  A  R+NAEK WL +     +   V RL GIYGP R+    + +  SL 
Sbjct: 140 DEDHTVNPKSESAKLRYNAEKGWLNLIDDPKLSAFVFRLGGIYGPGRSALDTLAKSKSLS 199

Query: 176 ---RLVKKNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIMEAASLMKI 231
              +L +  Q   RI V D+ + V+  M+      IFN+ DD+PAP   V   A SL++ 
Sbjct: 200 RKQKLRESKQYTARIHVADIYQAVLASMSIRCARKIFNVVDDDPAPRAEVFAFATSLIQR 259

Query: 232 TPPLEQCFDTANISP----FTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
             P +   +T +  P    +        KR+SNA++K  LG  LL+P YR  L+ +
Sbjct: 260 RYP-DMITETIDAKPAGLDYQEMIVPAEKRVSNARMKQELGVNLLHPTYRSGLQSI 314


>gi|159902571|ref|YP_001549915.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9211]
 gi|159887747|gb|ABX07961.1| Nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9211]
          Length = 302

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 157/287 (54%), Gaps = 23/287 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK- 61
           L+IFG G++G+ IA AA ++G     + RS        +K  + F++ D    ++  E  
Sbjct: 18  LLIFGGGFSGQHIAAAARRLGAKVLCSRRSF-------NKTGADFIY-DSASESIPEESV 69

Query: 62  LYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
           L   TH++ CI P   G DP + ++S    K MP +KW GYLS+T +YG+ +G WV+E+ 
Sbjct: 70  LKDVTHLISCIPPLDTGEDPVLKNLSAAIKK-MP-LKWAGYLSTTGVYGDCKGAWVNEND 127

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
             +P    + +R   EK W    +   + + ++RL GIYGP R+    I+ K S  + K 
Sbjct: 128 CANPKQARSIRRLACEKAW----QSSGLPVQIIRLPGIYGPGRSTLEAIKNKKSKVIHKP 183

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
            QVF+RI ++D+A  ++ L+     G    I NL+D+ PA    V+  AA L+    P  
Sbjct: 184 GQVFSRIHIDDIAGGILHLINLISQGINPEIINLADNFPASNIEVMQYAAYLLNQELPPI 243

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLK 280
           + F+ A   +SP    F+ +N+++SN  + K LG+ L++P+Y+  LK
Sbjct: 244 ESFEIAAETMSPMALSFWQENRKVSNKVLCKELGYSLIHPDYKSGLK 290


>gi|329848414|ref|ZP_08263442.1| NAD dependent epimerase/dehydratase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328843477|gb|EGF93046.1| NAD dependent epimerase/dehydratase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 269

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 138/286 (48%), Gaps = 22/286 (7%)

Query: 1   MHLMIFGAGYTGKFIADAALKV--GVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL 58
           M+L++FG G+ G+  A A      G     T R       L+ +G+     AD       
Sbjct: 1   MNLLVFGYGFIGEAFAKALTFAVPGARITATARDPEKRARLQSQGVIAIDPADS------ 54

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
           R        ++    P  +G P   ++       +   +WIGYLS+T +YG+R+G WV E
Sbjct: 55  RSAFEAADAVLITPAPGDDGCPAFAALQP-----VRSGQWIGYLSTTGVYGDRDGGWVWE 109

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            S + P S    +R  AE +WL+   +      V RL G+YGP RN   ++R   + R+ 
Sbjct: 110 DSELCPTSAEGRRRVLAESQWLSAGAQ------VFRLPGLYGPGRNVVERLRDGTARRIH 163

Query: 179 KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           K   VF+R+  +D A  ++  +     GG +NL DDEPAP   V+  AA L  +  P   
Sbjct: 164 KPGHVFSRLHHDDCASALVASLNRPRPGGAYNLCDDEPAPADQVLAYAAQLTGLPLPDPT 223

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            +D     P  + FY DNKR+SNA+ K+ LG+   YP YR  L+ L
Sbjct: 224 AWDDPRY-PAMQRFYRDNKRVSNARAKAELGWFPRYPTYREGLRAL 268


>gi|85375551|ref|YP_459613.1| hypothetical protein ELI_13620 [Erythrobacter litoralis HTCC2594]
 gi|84788634|gb|ABC64816.1| hypothetical protein ELI_13620 [Erythrobacter litoralis HTCC2594]
          Length = 264

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 141/285 (49%), Gaps = 28/285 (9%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + IFG GYT K IA AAL+   +   +T S   +              D    + +R+ 
Sbjct: 3   QMFIFGLGYTAKRIA-AALESEGWAVVSTGSDGTM--------------DFDGRDAVRDA 47

Query: 62  LYFTTHIVQCIKPS--SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           L  ++H++  + P   SE DP   S    +   + H  W+GYLSST +YG+ +G WVDE+
Sbjct: 48  LARSSHVLTSVPPDRESETDPVFES----YGDALSH-GWLGYLSSTGVYGDAQGAWVDEN 102

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +    I+     R NA  E  A    +     V RL GIYGP R+   ++    + R+  
Sbjct: 103 TPT--IAETGQGRRNARAE--ADAAWMGKGARVFRLPGIYGPGRSALDRVNAGRARRIDM 158

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             QVF+R+ V+D+   V+  +  +   G +NL DD P     V   A  L+ I PP  + 
Sbjct: 159 PGQVFSRVHVDDIVSGVVAALDRNAPAGAYNLGDDLPESGNAVTEHACQLLGIDPPPLET 218

Query: 239 FDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            + AN+S   R FYA+N+R++N K K  LG++  YP Y+  L+ L
Sbjct: 219 LEEANLSEMARGFYAENRRVANGKAKRVLGWEPRYPTYKEGLRSL 263


>gi|315498633|ref|YP_004087437.1| nad-dependent epimerase/dehydratase [Asticcacaulis excentricus CB
           48]
 gi|315416645|gb|ADU13286.1| NAD-dependent epimerase/dehydratase [Asticcacaulis excentricus CB
           48]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 141/284 (49%), Gaps = 10/284 (3%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYF 64
           +FG G+ G+  A      G     T R+      L  +GI     A   ++  L +    
Sbjct: 1   MFGYGFIGEAFAGLCRARGYCISATARTAEKRAFLSGQGID----AVDPLSLHLSDTAAA 56

Query: 65  TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP 124
              I+    P   G P   ++     +  P  KW+GYLS+T +YG+R G W  E+  + P
Sbjct: 57  ADLILITPAPDDAGCPAFAALGTAL-RDAPR-KWLGYLSTTGVYGDRGGGWAFENQALTP 114

Query: 125 ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF 184
           +S    +R  AE +W +++ + ++  AV RL G+YG  R+   ++R   + R+ K  QVF
Sbjct: 115 LSTEGRRRVQAESQWQSLSDQHDV--AVFRLPGLYGVGRSVIERLRDGTARRIHKPGQVF 172

Query: 185 NRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTAN 243
           +R+   D A  ++        G ++NL DDEPAP   V++ AA       P +  FD  +
Sbjct: 173 SRLYDTDCADALLRSAERRRAGAVYNLCDDEPAPADAVLVWAAQAFGFAVPPKIPFDAPD 232

Query: 244 ISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEI 286
           +SP  R FY +NKR+SNA  K+ LG++  +P YR  L  +W+ I
Sbjct: 233 LSPGMRRFYTENKRVSNALAKAELGWRPQFPTYREGLHDVWRLI 276


>gi|296284876|ref|ZP_06862874.1| hypothetical protein CbatJ_14706 [Citromicrobium bathyomarinum
           JL354]
          Length = 261

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 138/284 (48%), Gaps = 32/284 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L IFG GY+ K IA  A  +G     T            +G   F  AD     L R   
Sbjct: 4   LFIFGLGYSAKRIAQRAQSLGWEVVATG----------SEGKLSFDDADAVHAELSR--- 50

Query: 63  YFTTHIVQCIKPS--SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
                ++  + P   SE DP +    + +   + H  WIGYLSST +YG+R+G WVDE S
Sbjct: 51  --ADAVLSSVPPDRESESDPVL----ERYGAALGHA-WIGYLSSTGVYGDRQGAWVDESS 103

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                      R   +  W+    +      V RL GIYGP R+ F +I +  + R+   
Sbjct: 104 PTG--DGRRNARMACDASWMERGAR------VFRLPGIYGPGRSIFDRIAEGKAKRIDLP 155

Query: 181 NQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCF 239
            QVF+R+ VED+A  V   L +    G +NL DD PA    V+ EA +L+ + PP     
Sbjct: 156 GQVFSRVHVEDIASGVATALASDAPPGAYNLGDDLPASQNAVVEEACALLGVEPPPLVTL 215

Query: 240 DTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           + A++SP  R FYA+N+R++N K K  LG++  YP YR  L+ L
Sbjct: 216 EEADLSPMARGFYAENRRVANLKAKRVLGWKPQYPTYREGLRAL 259


>gi|254431970|ref|ZP_05045673.1| NAD dependent epimerase/dehydratase [Cyanobium sp. PCC 7001]
 gi|197626423|gb|EDY38982.1| NAD dependent epimerase/dehydratase [Cyanobium sp. PCC 7001]
          Length = 353

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 148/284 (52%), Gaps = 21/284 (7%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE- 60
            L++ GAGYTG+ +A AA + G     T+R   +  T       P+L  D +   ++ E 
Sbjct: 66  RLLVVGAGYTGRRLAAAAARQGFEVVQTSRRPPSGAT-----PGPWLRFDTQ-GGVIPEP 119

Query: 61  -KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
             L   TH+   + P  +G   ++ + +     +P V W GYLS+T +YG+  G WVDE 
Sbjct: 120 ADLQRITHLFVSVPPDGQGGDPVLRLLESRLGALPLV-WAGYLSTTGVYGDTAGAWVDES 178

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +        +  R  AE+ WLA      + L + RL  IYGP R PF  +R   S  + K
Sbjct: 179 APTPARPGRSQARLEAEQAWLAS----GLPLQIFRLPAIYGPGRTPFEALRSGTSRLIHK 234

Query: 180 KNQVFNRIRVEDVARCVIF---LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT-PPL 235
             QVF+R+ V+D+   V+    L       + N++DDEP+     +  AA L+    PPL
Sbjct: 235 PGQVFSRVHVDDIVGAVLHCLALPAERRPTLLNVADDEPSSSSETLAYAAHLLGCPLPPL 294

Query: 236 EQCFDT--ANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYR 276
           E+ F +  A++SP  R F+ +N+R+SN ++ + LG++L YP+YR
Sbjct: 295 ER-FSSIEASLSPMARSFWQENRRVSNRRLCRELGYRLRYPSYR 337


>gi|254292441|ref|YP_003058464.1| NAD-dependent epimerase/dehydratase [Hirschia baltica ATCC 49814]
 gi|254040972|gb|ACT57767.1| NAD-dependent epimerase/dehydratase [Hirschia baltica ATCC 49814]
          Length = 281

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 141/282 (50%), Gaps = 15/282 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           LM FG GYT K++A           GT R        ++K +    + D +      + +
Sbjct: 6   LMCFGYGYTAKYLAKNVSVSKWKIIGTNRDPETNFDPENKNVRLLTWPDPQFRPPQADAV 65

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
             +      + P+ +  P    + +          WIG+LSST +YG+  G W  E + +
Sbjct: 66  LIS------VPPNDKTCPVFAQLDQ-LKNCFGSKTWIGFLSSTGVYGDLGGGWAFEETPI 118

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P+S  A  R  AE++W       +I   + RL GIYGP R+ F +IR   S R++K+ Q
Sbjct: 119 KPLSTEAKNRAIAERQWQ------DIGAHIFRLPGIYGPGRSTFDRIRSGKSRRIIKQGQ 172

Query: 183 VFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           +F+R  VED+A  +   +   + G I+N++DD P  PQ +I   A L+ + PP    F+ 
Sbjct: 173 IFSRAHVEDIADLLARSIAKPNPGRIYNVADDVPCSPQELIEHGAKLLGVDPPPAVAFED 232

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           A +    + FY++ KRISNA+ KS LG++  YP+YR  L  +
Sbjct: 233 AGLPLKAQRFYSECKRISNARAKSELGWRPKYPSYREGLPAI 274


>gi|73667320|ref|YP_303336.1| hypothetical protein Ecaj_0706 [Ehrlichia canis str. Jake]
 gi|72394461|gb|AAZ68738.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 273

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 151/287 (52%), Gaps = 25/287 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GYT KF+A   L +     GT  S + +   K+  +  + F        L E
Sbjct: 1   MHLFCFGYGYTAKFLAQKLLPLKWKISGT--SFNKISQDKNVNLLNYNFP-------LPE 51

Query: 61  KLYF-TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
            ++   TH++  I P  EGD  +    + +YK++  +KW+GYLS+T++YG+  G WVDE 
Sbjct: 52  SIFSDVTHVLISIPP--EGDNVL----QKYYKYLKEIKWLGYLSATNVYGDHNGNWVDET 105

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           S  +P +     R   EK W       N+   + RLSGIYGP RN    + Q N+++ + 
Sbjct: 106 SATNPSTVSGINRLKQEKIWY----NSNLPSHIFRLSGIYGPNRNVLCNLIQ-NNVKYII 160

Query: 180 KNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
            + +F+RI VED+A  +   + + + G I+N +DD P    N+I   + L+ I  P    
Sbjct: 161 SDTIFSRIHVEDIANILFTSINNPNPGSIYNCADDLPTSYSNIIKYGSQLLNIKTPEPVL 220

Query: 239 FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
            +  ++S   + FY++ K +SN KIK +L   LLYP+Y   L+ L K
Sbjct: 221 LE--DLSDNMKKFYSERKLVSNFKIKNALNISLLYPSYIQGLQNLIK 265


>gi|78183616|ref|YP_376050.1| hypothetical protein Syncc9902_0032 [Synechococcus sp. CC9902]
 gi|78167910|gb|ABB25007.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 307

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 148/297 (49%), Gaps = 29/297 (9%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSV----SNLLTLKHKGISPFLFADQKINNL 57
            L++ G GY+G+ +A  A ++G     T R      ++L+   + G  P + A Q I   
Sbjct: 17  RLLVLGGGYSGRCVAKLARQLGTPVLCTRRVAGQPDADLIFDSNNGQLPDVSALQGI--- 73

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
                   TH++  I P  +G   +IS      K +  ++W GYLS+T +YGNR G+WV 
Sbjct: 74  --------THLLSTIPPQRQGGDPVISALLPLLKTL-SLEWAGYLSTTGVYGNRNGEWVQ 124

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E+    P    + +R   E+ WL       + + +LRL GIYGP R+    +RQ  +  +
Sbjct: 125 ENDPPAPGLDRSRRRLECEQAWL----NSGLPVQILRLPGIYGPGRSVLDSLRQGKARLI 180

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHHLG------GIFNLSDDEPAPPQNVIMEAASLMKI 231
            K  QVF RI VED+A     L+ H          I N+ D+EP  P +++    SL+  
Sbjct: 181 NKPGQVFCRIHVEDIAGACWHLIDHSSSNPNDRPSIVNVVDNEPTAPADLVRHGVSLLGC 240

Query: 232 TPPLEQCFDT--ANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKE 285
             P E+ +D   + +SP  R F+++N+R+SN  +   L + LLYP +R  L+   ++
Sbjct: 241 ELPQEENYDAICSEMSPMGRSFWSENRRVSNKLLCGDLNYSLLYPTFREGLQDCLEQ 297


>gi|149185356|ref|ZP_01863673.1| hypothetical protein ED21_19922 [Erythrobacter sp. SD-21]
 gi|148831467|gb|EDL49901.1| hypothetical protein ED21_19922 [Erythrobacter sp. SD-21]
          Length = 263

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 139/286 (48%), Gaps = 34/286 (11%)

Query: 2   HLMIFGAGYT-GKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            L IFG GYT G+F  +  ++   +    T S  N+  +    +               E
Sbjct: 3   RLFIFGLGYTAGRFAQE--MRGRGWQVDATGSAGNIDWMDAVSVV--------------E 46

Query: 61  KLYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            L   TH++  + P  +   DP +     DFY  +   +W+GYLSST +YG+ +G WVDE
Sbjct: 47  HLERATHVLSSVPPDRDDGVDPVL-----DFYDDIFDGQWLGYLSSTGVYGDADGAWVDE 101

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            S         + R   +  WL    +      V RL GIYGP R+ F ++    + R+ 
Sbjct: 102 SSPTD--GGRRSARAECDACWLEAGAR------VFRLPGIYGPSRSAFERVESGKAHRID 153

Query: 179 KKNQVFNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
              QVF+R+ V+D VA  V  + +    G +NL+DD P     VI EA  LM ++PP  Q
Sbjct: 154 LPGQVFSRVHVDDIVAGVVAAIESGAPQGAYNLADDLPTSQNAVIEEACRLMGVSPPPLQ 213

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
             + A++SP  R FYA+N+R++N K K  L ++  YP YR  L  +
Sbjct: 214 TIEEADLSPMARGFYAENRRVANGKAKRVLDWEPRYPTYREGLAAI 259


>gi|242052507|ref|XP_002455399.1| hypothetical protein SORBIDRAFT_03g010160 [Sorghum bicolor]
 gi|241927374|gb|EES00519.1| hypothetical protein SORBIDRAFT_03g010160 [Sorghum bicolor]
          Length = 329

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 155/299 (51%), Gaps = 25/299 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLR 59
           H+ +FGAG+ G+++++  L  G    GT  SV+    L+  G++  +F   +  + N+  
Sbjct: 23  HMFVFGAGFVGRYVSERLLAQGWQVSGTCTSVNKKRELEMLGMNASVFDATESSLENI-- 80

Query: 60  EKLYFTTHIVQCIKP-SSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQWV 116
             L   TH++  I P    GDP ++++ +D  + + H  ++W+ YLSSTS+YG+  G  V
Sbjct: 81  HNLRQATHLLISIPPIPGIGDP-LLNLGEDLRRTLSHGNLEWLCYLSSTSVYGDCGGVLV 139

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--------FIK 168
           DE   V+P S  A  R+NAEK WL +   LN+   + RL GIYGP R+         F+ 
Sbjct: 140 DEDHTVNPKSESAKLRYNAEKGWLNLIDDLNLSAFIFRLGGIYGPGRSALDTLAKGKFLS 199

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIMEAAS 227
            RQK    L +  Q   RI V D+ + V+  M       IFN+ DD+PAP   V   A S
Sbjct: 200 QRQK----LRESKQYTARIHVADIYQAVLASMCIRCARKIFNVVDDDPAPRAEVFAFARS 255

Query: 228 LMKITPP--LEQCFDTANIS-PFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           L++   P  + +  D  +    +        KR+SNA++K  LG  LL+P YR  L+ +
Sbjct: 256 LIQRRYPDLITEIIDANSTGLDYQEIIIPAEKRVSNARMKQELGINLLHPTYRSGLQSI 314


>gi|91762428|ref|ZP_01264393.1| nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718230|gb|EAS84880.1| nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 291

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 151/281 (53%), Gaps = 11/281 (3%)

Query: 1   MHLMIFGAGYTGK-FIADAAL-KVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL 58
           +++  FG G   K FI   ++ +  +    T+RS S+  T K    + +LF     +  L
Sbjct: 4   INIFCFGFGQVAKNFIKKLSVEQYNINLSATSRSESSKKTFKGINYNSYLFNRDNFDQNL 63

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWV 116
             KL    HI+  I P ++ D  I    K+F KF+    VKWI YLS+TSIYG+ +G+WV
Sbjct: 64  VVKLKEADHILVSIPPENQEDLVI----KNFSKFIESSKVKWITYLSATSIYGDHKGEWV 119

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           +E+S  +PIS     R  AE  W ++ K   I + + RLSGIY  ++N  I+++      
Sbjct: 120 NENSKTNPISNNGIARLKAENAWFSLEKNKKIPIQIFRLSGIYSNEKNILIRLKSGGVKL 179

Query: 177 LVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + KKN  F+RI V+D++  +   L     G I+NLSDD+P+  + V +  A ++ I   +
Sbjct: 180 INKKNHFFSRIHVDDISNILFKSLSKFKSGEIYNLSDDKPSTSEEVTLFGAKILNI-ENI 238

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
           E+       S   + FY ++K++SN K+KS   + L +P+Y
Sbjct: 239 EKIEVDQIKSEMLKNFYNESKKVSNKKMKSYFDYNLKFPSY 279


>gi|88658407|ref|YP_507118.1| hypothetical protein ECH_0297 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599864|gb|ABD45333.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 272

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 153/293 (52%), Gaps = 26/293 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GYT +F+A   L +     GT  +      + H         D   N  L E
Sbjct: 1   MHLFCFGYGYTARFLAQKLLPLKWKISGTLFN-----KVAHTDNKDVHLLD--YNFPLPE 53

Query: 61  KLYF-TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
            ++   TH++  I P  +GD    ++ + +Y F+  +KW+GYLS+T++YG+  G WVDE 
Sbjct: 54  SVFSDVTHVLISIPP--DGD----NILQKYYNFLKEIKWLGYLSATNVYGDHNGNWVDET 107

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           S  +P +     R   EK W       N+   + RLSGIYGP RN    + Q N ++   
Sbjct: 108 SSTNPSTPNGINRLKQEKMW----HNSNLPSHIFRLSGIYGPTRNVLRNLIQGN-VKYTI 162

Query: 180 KNQVFNRIRVEDVARCVIFLMTH--HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
            + +F+RI V+D+A  ++F   H  + G I+N +DD P+P  NV+   A+L+ I  P  +
Sbjct: 163 SDTIFSRIHVDDIAN-ILFTSIHNPNPGSIYNCTDDLPSPYSNVVKYGAALLNINTP--E 219

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIENL 289
             D  ++S   + FY++ K +SN KIK+ L   L YP+Y   L+ L K IE L
Sbjct: 220 PMDFEDLSDNMKRFYSERKLVSNLKIKNELNISLQYPSYIQGLQSLIK-IETL 271


>gi|22299924|ref|NP_683171.1| hypothetical protein tlr2381 [Thermosynechococcus elongatus BP-1]
 gi|22296109|dbj|BAC09933.1| tlr2381 [Thermosynechococcus elongatus BP-1]
          Length = 288

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 147/292 (50%), Gaps = 12/292 (4%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN-NLLR 59
           M ++I G GYTG ++A +    G+    T R       L      PF +  Q     L  
Sbjct: 1   MRVLILGCGYTGTWLARSLHAQGIDVVMTNRRGEPPPELSTLPCFPFKWEQQGEQLPLAP 60

Query: 60  EKLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
             L   TH++  I P  +G D   +++     K   H  W GYLS+T +YG+R+G WVDE
Sbjct: 61  AALEGVTHVLNGIPPDRQGEDAVALALLPQLEKLNLH--WFGYLSTTGVYGDRQGGWVDE 118

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPK--RNPFIKIRQKNSLR 176
            + V+P +  +  R   E+ +L      N+   + RL GIYGP   RNP  +I + +   
Sbjct: 119 TTPVNPQNLRSQHRVRIEQVFL----NANLPTHIFRLPGIYGPGEGRNPIARILKGDVQL 174

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + K    F RI V D+ + +   +       I+NLSDD+P+    V++EA  L+    P 
Sbjct: 175 IDKPGHYFCRIHVADIVQTLERSLAQPTPQEIYNLSDDQPSESLPVLLEAYRLLGRPAPP 234

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEI 286
               + AN+SP  + F+ +++R+ N KIK +LG QL YP+YR  L+ + +E+
Sbjct: 235 AIPLEAANLSPMAQSFWRESRRVRNDKIKQALGVQLRYPSYREGLRAIAREL 286


>gi|124021749|ref|YP_001016056.1| nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9303]
 gi|123962035|gb|ABM76791.1| Nucleoside-diphosphate-sugar epimerase [Prochlorococcus marinus
           str. MIT 9303]
          Length = 306

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 149/288 (51%), Gaps = 19/288 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G G++G+ +   A  +G     + R +++         +  L    K+       L
Sbjct: 18  LLVLGGGFSGQHVVALARALGSTAICSRRDINSPGADMAFDSATKLLPTTKV-------L 70

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              TH++ CI P+++G   +++   D  K +P ++W+GYLS+T +YG+R+G+WV E    
Sbjct: 71  EGVTHLLSCIPPAADGKDPVLTCLGDQLKALP-LQWVGYLSTTGVYGDRQGRWVTEIDHP 129

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P    + +R   E+ W A      + L +LRL GIYGP R+    +    S  + K NQ
Sbjct: 130 QPQQARSKRRLACEEAWQAS----GLPLQILRLPGIYGPGRSVLKSVNTGQSRMIHKPNQ 185

Query: 183 VFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLM-KITPPLEQ 237
           VF+RI V+D+A  ++ L+     G    + N++DD P    +V+  AA L+ K  P +E 
Sbjct: 186 VFSRIHVDDIAGAILHLIQCAADGQRPIVINVTDDMPTAYTDVLGFAAQLLGKSLPEIEP 245

Query: 238 -CFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
                A ++P    F+ +N+R+SN  + + LG+ L++PNY   L+  +
Sbjct: 246 FAVAAAQMNPMALSFWQENRRVSNQLLCRELGYSLMHPNYHSGLRDCY 293


>gi|68171538|ref|ZP_00544917.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999043|gb|EAM85715.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 272

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 153/293 (52%), Gaps = 26/293 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MHL  FG GYT +F+A   L +     GT  +      + H         D   N  L E
Sbjct: 1   MHLFCFGYGYTARFLAQKLLPLKWKISGTLFN-----KVAHTDNKDVHLLD--YNFPLPE 53

Query: 61  KLYF-TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
            ++   TH++  I P  +GD    ++ + +Y F+  +KW+GYLS+T++YG+  G WVDE 
Sbjct: 54  SVFSDVTHVLISIPP--DGD----NILQKYYNFLKEIKWLGYLSATNVYGDHNGNWVDET 107

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           S  +P +     R   EK W       N+   + RLSGIYGP RN    + Q N ++   
Sbjct: 108 SSTNPSTPNGINRLKQEKMW----HNSNLPSHIFRLSGIYGPTRNVLRNLIQGN-VKYTI 162

Query: 180 KNQVFNRIRVEDVARCVIFLMTH--HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
            + +F+RI V+D+A  ++F   H  + G I+N +DD P+P  NV+   A+L+ I  P  +
Sbjct: 163 SDTIFSRIHVDDIAN-ILFTSIHNPNPGSIYNCTDDLPSPYSNVVKYGAALLNINTP--E 219

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIENL 289
             D  ++S   + FY++ K +SN +IK+ L   L YP+Y   L+ L K IE L
Sbjct: 220 PMDFEDLSDNMKRFYSERKLVSNLQIKNELNISLQYPSYIQGLQSLIK-IETL 271


>gi|113953487|ref|YP_729274.1| NAD dependent epimerase/dehydratase [Synechococcus sp. CC9311]
 gi|113880838|gb|ABI45796.1| NAD dependent epimerase/dehydratase [Synechococcus sp. CC9311]
          Length = 309

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 148/293 (50%), Gaps = 27/293 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTR---SVSNLLTLKH-KGISPFLFADQKINNLL 58
           L I GAG++G  +A  +  +G     T+R   S S+ L     KGI P            
Sbjct: 18  LCILGAGFSGGHLAKLSKALGTRVICTSRRPESGSDHLPFDSAKGIVPG----------- 66

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            E L   TH++  I P+ EG   ++S   +  + +P ++W+GY S+T +YGN  G WV+E
Sbjct: 67  HEVLASVTHLISTIPPTKEGADPVLSCLGEQLQQLP-LQWVGYFSTTGVYGNSNGNWVNE 125

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            +   P    + +R + E+ W    +K  + + +LRL GIYGP R+P   +R      + 
Sbjct: 126 TNEPQPTQLRSQKRLDCEQLW----RKSGLPVQILRLPGIYGPGRSPLAAVRSGEVTPVD 181

Query: 179 KKNQVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLM--KIT 232
           +  Q+F RI V+D+A     LM     G    + N+SD+ PA    +   AA L+  K+ 
Sbjct: 182 QPGQMFCRIHVDDLAGACWHLMHRAAAGQRPTVVNISDNRPASRLELQRFAAELLGCKLP 241

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK 284
            P+      A +SP    F+ADN+++SNA ++  LG+  L+P+Y   LK  ++
Sbjct: 242 APIPFSEAQATMSPMALSFWADNRKVSNALLRDELGYTFLHPDYSSGLKDCFE 294


>gi|33862307|ref|NP_893867.1| hypothetical protein PMT0034 [Prochlorococcus marinus str. MIT
           9313]
 gi|33640420|emb|CAE20209.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 306

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 151/289 (52%), Gaps = 21/289 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSV-SNLLTLKHKGISPFLFADQKINNLLREK 61
           L++ G G++G+ +   A  +G     + R + S    +     +  L A + +  +    
Sbjct: 18  LLVLGGGFSGQHVVALARALGSTAICSRRDINSPDADIAFDSATKLLPATKVLEGV---- 73

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               TH++ CI P+++G   +++   D  + +P ++W+GYLS+T +YG+R+G+WV E   
Sbjct: 74  ----THLLSCIPPAADGKDPVLTCLGDQLRALP-LQWVGYLSTTGVYGDRQGRWVTEIDH 128

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    + +R   E+ W A      + L +LRL GIYGP R+    +    S  + K N
Sbjct: 129 PQPQQARSKRRLACEEAWQAS----GLPLQILRLPGIYGPGRSVLKNVNTGQSRMIHKPN 184

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGG----IFNLSDDEPAPPQNVIMEAASLM-KITPPLE 236
           QVF+RI V+D+A  ++ L+     G    + N++DD P    +V+  AA L+ K  P +E
Sbjct: 185 QVFSRIHVDDIAGAILHLIQCAADGQRPIVINVTDDLPTAYTDVLGFAAQLLGKSLPEIE 244

Query: 237 Q-CFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLW 283
                 A ++P    F+ +N+R+SN  + + LG+ L++PNY+  L+  +
Sbjct: 245 PFAVAAAQMNPMALSFWQENRRVSNQLLCRELGYSLMHPNYQSGLRDCY 293


>gi|57239425|ref|YP_180561.1| hypothetical protein Erum6980 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579397|ref|YP_197609.1| hypothetical protein ERWE_CDS_07330 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161504|emb|CAH58430.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418023|emb|CAI27227.1| Hypothetical protein ERWE_CDS_07330 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 280

 Score =  142 bits (358), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 149/291 (51%), Gaps = 36/291 (12%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL--- 57
           MHL  FG GYT  F+A   L +     GT+          HK  +     D+ +N L   
Sbjct: 11  MHLFCFGYGYTASFLAQKLLPLKWKVSGTSF---------HKKKT----QDKNVNILDYN 57

Query: 58  --LREKLYF-TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
             L E ++   TH++  I P  EGD    ++ + ++  + ++ W+GYLS+T++YGN  G 
Sbjct: 58  FPLPESIFSDVTHVLISIPP--EGD----NILEKYHLLLKNIHWLGYLSATNVYGNHNGN 111

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WV+E S  +P +     R N EK WL      N+   + RLSGIYGP RN    + Q N+
Sbjct: 112 WVNETSITNPSTSSGIHRLNKEKLWL----NSNLPTHIFRLSGIYGPHRNVLRNLIQ-NN 166

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTH--HLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           +R +  + +F+RI V+D+A  ++F   H  +   I+N SDD P    NVI   A L+ I 
Sbjct: 167 VRYIISDIMFSRIHVDDIAN-ILFTSIHQPNPNSIYNCSDDLPDSYLNVIKYGAQLLNID 225

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           PP    F+  ++    + FY +NK +SN KIK  L   L YP Y   L+ L
Sbjct: 226 PPKPVTFE--DLPDSMKRFYTENKLVSNLKIKHELDVSLKYPTYIQGLQSL 274


>gi|58617452|ref|YP_196651.1| hypothetical protein ERGA_CDS_07250 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417064|emb|CAI28177.1| Hypothetical protein ERGA_CDS_07250 [Ehrlichia ruminantium str.
           Gardel]
          Length = 290

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 149/291 (51%), Gaps = 36/291 (12%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL--- 57
           MHL  FG GYT  F+A   L +     GT+          HK  +     D+ +N L   
Sbjct: 21  MHLFCFGYGYTASFLAQKLLPLKWKISGTSF---------HKKKT----QDKNVNILDYN 67

Query: 58  --LREKLYF-TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
             L E ++   TH++  I P  EGD    ++ + ++  + ++ W+GYLS+T++YG+  G 
Sbjct: 68  FPLPESIFSDVTHVLISIPP--EGD----NILEKYHLLLKNIHWLGYLSATNVYGDHNGN 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WV+E S  +P +     R N EK WL      N+   + RLSGIYGP RN    + Q N+
Sbjct: 122 WVNETSITNPSTSSGIHRLNKEKLWL----NSNLPTHIFRLSGIYGPHRNVLRNLIQ-NN 176

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTH--HLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           +R +  + +F+RI V+D+A  ++F   H  +   I+N SDD P    NVI   A L+ I 
Sbjct: 177 VRYIISDIMFSRIHVDDIAN-ILFTSIHQPNPNSIYNCSDDLPDSYSNVIKYGAQLLNID 235

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           PP    F+  ++    + FY +NK +SN KIK  L   L YP Y   L+ L
Sbjct: 236 PPKPVTFE--DLPDSMKRFYTENKLVSNLKIKHELDVSLKYPTYIQGLQSL 284


>gi|325181955|emb|CCA16409.1| NADdependent epimerase/dehydratase putative [Albugo laibachii Nc14]
          Length = 570

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 148/303 (48%), Gaps = 24/303 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVS--------NLLTLKHKGISPFLFA---- 50
           L IFG GYT    A    K G +  GT RSV+        N    + +G S  +F     
Sbjct: 5   LFIFGIGYTATRTAVQFAKEGFHIAGTVRSVASARRLHAINPQVFRLEGCSRNIFIFDDN 64

Query: 51  -DQKINNLLR--EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
            D   N+ +     L   TH++  +  + + DP +    ++  K    + W+GYLS+  +
Sbjct: 65  WDPDANDQISVGTALEDVTHLLVSVPTAMDQDPVLSVFREEIVKETQRLLWVGYLSTIGV 124

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           YG   G  VDE + V         R   EK WLA    ++I     R+ GIYGP R P +
Sbjct: 125 YGETNGIAVDECAPVQSSIPRCQARIRVEKMWLATLLPVHI----FRIGGIYGPGRGPLM 180

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAA 226
           ++R  +   +    +VFNRI V+D+ + ++   T    G I+N+ DDEPAP   V+  A 
Sbjct: 181 RVRSGSFTLIHLPGKVFNRIHVDDIVQVLLASATATKPGSIYNVCDDEPAPGDLVLAYAC 240

Query: 227 SLMKITPPLEQCFDTA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRIS-LKQL 282
            L+ ++ P  Q ++ A  N+S   + FYA++K ++N KI K LG  L YP +R   L QL
Sbjct: 241 DLLGVSIPEPQSWEQAERNMSEMAKSFYAESKNVNNCKIHKELGIVLKYPTFREGMLAQL 300

Query: 283 WKE 285
            +E
Sbjct: 301 LEE 303


>gi|294084978|ref|YP_003551738.1| hypothetical protein SAR116_1411 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664553|gb|ADE39654.1| hypothetical protein SAR116_1411 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 290

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 139/282 (49%), Gaps = 10/282 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + IFG GY G  +     + G +  GTTR  + L      G   F F+  +     +  L
Sbjct: 8   IFIFGLGYVGVRLGHMLAEQGWHVKGTTRDPAKLSRQAAAGWGIFPFSTDRPLVDPKAAL 67

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
                ++  I      DP + +       F     W GY+S+TS+Y ++   +  E +  
Sbjct: 68  KDVDAVLTTITAIGGTDPVLDAHGDLLVDFN---GWSGYVSATSVYPDQPDDFCYEDTPP 124

Query: 123 HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQ 182
            P +     R  AE+ W  +   LN +  + R++GIYGP R+PF  +R   +  + ++ Q
Sbjct: 125 APATERGKARVIAEQRWQDM---LNSE--IFRVAGIYGPGRSPFDGLRNGTARIITREGQ 179

Query: 183 VFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           VFNRI ++D+ R +I  +     G I NL+D++PAP  +V+  AA L+ + PP  Q  + 
Sbjct: 180 VFNRIHLDDICRIIIAAIKQPRPGRIINLADNKPAPQGDVVRYAAKLINLAPPEPQTLEQ 239

Query: 242 ANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           AN+SP  R FY   +++ +  IK  LG  LLYP+Y   L+ +
Sbjct: 240 ANLSPMARSFYVSRRKVGSRVIKPELGIDLLYPDYESGLRAI 281


>gi|298293982|ref|YP_003695921.1| NAD-dependent epimerase/dehydratase [Starkeya novella DSM 506]
 gi|296930493|gb|ADH91302.1| NAD-dependent epimerase/dehydratase [Starkeya novella DSM 506]
          Length = 296

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 145/290 (50%), Gaps = 16/290 (5%)

Query: 3   LMIFGAGYTG-KFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           L+  G GY G +F+A   L  G++     R  ++      +G+    F D   +  L + 
Sbjct: 4   LLCLGLGYCGQRFVA---LHGGLFA---RRLATSRYGTAREGVETLRF-DGTASPELLDA 56

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHS 120
                 ++    P  EGDP + S+++       P +    YLS+  +YG+  G W+DE +
Sbjct: 57  ARTADVVLATAAPGEEGDPFLRSLAEALAGGRGPLI----YLSTIGVYGDTGGAWIDEDA 112

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
               +S  A +R  AE +W A+ ++    +A+LRL GIYGP RN  I +   ++  + + 
Sbjct: 113 PPSAVSARARRRVAAEAQWRALGERAGRPVAILRLGGIYGPGRNALIDVADGSARCIERA 172

Query: 181 NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
            Q+FNRI V+D+A  +         GI N+ DDEPAP    +  AA L+ +  P  + F+
Sbjct: 173 GQMFNRIHVDDIAGAIRAAAEQGFDGILNVVDDEPAPACAPVRFAAGLLGVEGPAPEPFE 232

Query: 241 --TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKEIE 287
             +A +S     F+ADN+R+ NA++ + LG  L YP YR  L  L  + E
Sbjct: 233 VASATMSAMALSFWADNRRVRNARLHALLGGNLAYPTYRDGLTALLGQGE 282


>gi|301107075|ref|XP_002902620.1| NAD-dependent epimerase/dehydratase, putative [Phytophthora
           infestans T30-4]
 gi|262098494|gb|EEY56546.1| NAD-dependent epimerase/dehydratase, putative [Phytophthora
           infestans T30-4]
          Length = 619

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 149/309 (48%), Gaps = 30/309 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-----------KGISP--FLF 49
           L +FG GY+    A A   +G    GT RSV     L             + + P  FLF
Sbjct: 6   LFVFGLGYSASRAARAFHSLGYSISGTVRSVEAATQLSQSDPEVFRFEGSETLPPNVFLF 65

Query: 50  ADQKINNL----LREKLYFTTHIVQCI---KPSSEGDPCIISMSKDFYKFM-PHVKWIGY 101
              K ++     L + L   TH++  +   +   + DP +  +     +     ++W+GY
Sbjct: 66  DGDKWSDSNALSLEDALKGVTHVLVSVPTGRVDGQEDPVLSVVGDRLIRATKDSIQWVGY 125

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
           LS+  +YG   G  VDE + V  +   +  R  AE+ WL       +   + R++GIYGP
Sbjct: 126 LSTIGVYGETNGVVVDESAPVGSMVKRSQMRIKAERLWL----DSELPTHIFRIAGIYGP 181

Query: 162 KRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQN 220
            R    K+R   + R+    + FNRI V+D+ + ++      + GGI+N+ DDEPAP   
Sbjct: 182 GRGTITKVRSGTASRIHIPGRKFNRIHVDDIVQILLASAARPNPGGIYNMCDDEPAPADE 241

Query: 221 VIMEAASLMKITPPLEQCFDTA--NISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRI 277
           V   A  L+ +  PL Q ++ A  N+S   + FYA++K  +N +IK  LG QLLYP YR 
Sbjct: 242 VTAYACELLGVPVPLSQSWEEAEKNMSAMAKSFYAESKICANHRIKEELGVQLLYPTYRK 301

Query: 278 S-LKQLWKE 285
             L Q+ +E
Sbjct: 302 GILAQVLEE 310


>gi|87301584|ref|ZP_01084424.1| hypothetical protein WH5701_02879 [Synechococcus sp. WH 5701]
 gi|87283801|gb|EAQ75755.1| hypothetical protein WH5701_02879 [Synechococcus sp. WH 5701]
          Length = 320

 Score =  139 bits (349), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 141/281 (50%), Gaps = 15/281 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           +++ G GY+G+  A A    G+    + R   +   +  +GIS   FA +    +    L
Sbjct: 18  MLVLGGGYSGQRFASAVAATGMPVLISHRPDGH--PVLGEGISSVAFASELRPGIEPAAL 75

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              TH++  + P  +G DP + S+       +P ++W+GYLS++ +YG+R G WV E   
Sbjct: 76  ENVTHVLVTVPPGRDGKDPVLESLGP-ILAGLP-LQWLGYLSTSGVYGDRGGAWVQESDS 133

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    +  R   E+ W A      + L V RL  IYGP R PF  +R  +S  + K  
Sbjct: 134 PTPGLARSRARLACEQAWEAS----GLPLQVFRLPAIYGPGRCPFNGLRAGSSRLIHKPA 189

Query: 182 QVFNRIRVEDVARCVIF---LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
           QVF+RI V+D+   ++    L +     + N++DD P P    +  AA L+    P  + 
Sbjct: 190 QVFSRIHVDDITGALLHNLALPSAQRPALLNVADDRPCPSSETLGYAAHLLNCKLPEVES 249

Query: 239 FD--TANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
           +     ++SP  R F+++N+R SN ++   LG++L YP+YR
Sbjct: 250 YGRIQESLSPMARSFWSENRRTSNRRLSVELGYRLRYPSYR 290


>gi|329891056|ref|ZP_08269399.1| NAD-dependent epimerase/dehydratase [Brevundimonas diminuta ATCC
           11568]
 gi|328846357|gb|EGF95921.1| NAD-dependent epimerase/dehydratase [Brevundimonas diminuta ATCC
           11568]
          Length = 510

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 121/220 (55%), Gaps = 6/220 (2%)

Query: 74  PSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF 133
           P + G P + +++       P   WIGY+SST++YG+R G W  E   ++  +    +R 
Sbjct: 292 PDAHGCPALRALTPLSADAWPD--WIGYVSSTAVYGDRAGGWAFEGDPLNAATLEGARRA 349

Query: 134 NAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVA 193
             E++WL   + + + L + RL G YGP R+   ++R   +  + K  QVFNRI V+DV 
Sbjct: 350 RVERDWLDGAQGMGLTLQIFRLPGFYGPGRSVIDRLRAGTARLVRKPGQVFNRIHVDDVV 409

Query: 194 RCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFY 252
             +   M     GG++NL+DDEP     V   AA  +K+  P E  +    +S   R FY
Sbjct: 410 SGLFASMDRPRPGGVYNLTDDEPTSADVVTAWAAERLKLPRPPEVDWTAPEVSEAMRRFY 469

Query: 253 ADNKRISNAKIKS-LGFQLLYPNYRISLKQLWK--EIENL 289
            D+KRISNA+ K+ LG++  YP+YR  L+ + +  E+E+L
Sbjct: 470 LDSKRISNARAKAELGWRPRYPSYREGLEAIIRGDELEDL 509


>gi|307294779|ref|ZP_07574621.1| NAD-dependent epimerase/dehydratase [Sphingobium chlorophenolicum
           L-1]
 gi|306879253|gb|EFN10471.1| NAD-dependent epimerase/dehydratase [Sphingobium chlorophenolicum
           L-1]
          Length = 265

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 134/280 (47%), Gaps = 23/280 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           H++I G GYT   +A      G +  G  R+                F D+   N +R  
Sbjct: 3   HMLILGQGYTASRLASRLRAEGWHITGVRRTAD---------AEAIAFDDE---NAVRAA 50

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L   +HI+  + P  + DP +++         P + W GYLSST +YG+  G WVDE + 
Sbjct: 51  LAQASHILSSVPPEGDADP-VLARYGSAIAAAPAI-WTGYLSSTGVYGDAAGAWVDEATP 108

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           +         R  A+  W     +L   +   RL GIYGP R+   ++RQ  + R+   +
Sbjct: 109 LR--QGRRAVRAQADANW----GELRADMRRFRLPGIYGPGRSVLDRLRQGRAHRIDLPD 162

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP-PLEQCFD 240
           QVF+R  V+D+   +   +     GI+NLSDD P   QN ++EAA  M   P P     +
Sbjct: 163 QVFSRAHVDDIVAGIAASLHQGPPGIYNLSDDLPC-AQNRLIEAACAMLGMPLPPLLTLE 221

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISL 279
            A ++P  + FYA+N+R++N + K  LG+   YP YR  L
Sbjct: 222 EAKLTPMAQSFYAENRRVANGRAKRLLGWLPRYPTYREGL 261


>gi|71083141|ref|YP_265860.1| nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062254|gb|AAZ21257.1| nucleoside-diphosphate-sugar epimerases [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 291

 Score =  138 bits (348), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 149/281 (53%), Gaps = 11/281 (3%)

Query: 1   MHLMIFGAGYTGK-FIADAAL-KVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL 58
           +++  FG G   K FI   ++ +  +    T+RS S+  +      + +LF  +  +  L
Sbjct: 4   INIFCFGFGQVAKNFIKKLSVEQYNINLSATSRSESSKKSFNGINYNSYLFNSENFDQSL 63

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWV 116
             KL    HI+  I P ++ D  I    K+F KF+     KWI YLS+TSIYG+ +G+WV
Sbjct: 64  VVKLKEADHILVSIPPENQEDLVI----KNFSKFIESSKTKWITYLSATSIYGDHKGEWV 119

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           +E+S  +PIS     R  AE  W ++ K   + + + RLSGIY  ++N  ++++      
Sbjct: 120 NENSKTNPISNNGIARLKAENAWFSLEKNKKVPIQIFRLSGIYSNEKNILMRLKSGGVKV 179

Query: 177 LVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + KKN  F+RI V+D++  +   L     G I+NLSDD+P+  + V +  A ++ I   +
Sbjct: 180 INKKNHFFSRIHVDDISNILFKSLSKFKSGEIYNLSDDKPSTSEEVTLFGAKILNI-ENI 238

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
           E+           + FY ++K++SN K+KS   + L +P+Y
Sbjct: 239 EKIEVDQIKGEMLKNFYNESKKVSNKKMKSYFNYNLKFPSY 279


>gi|148241134|ref|YP_001226291.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. RCC307]
 gi|147849444|emb|CAK26938.1| Nucleoside-diphosphate-sugar epimerase [Synechococcus sp. RCC307]
          Length = 303

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 147/290 (50%), Gaps = 21/290 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G GYTG+  A+   ++G     T R           G  PF  +   + +    +L
Sbjct: 22  LLVVGGGYTGQRFAERLRQLGADVVVTHRRAP-----AAAGELPFDSSTGLLPSA--SEL 74

Query: 63  YFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              +H++    P  +G DPC+ S+ K     +P ++W GYLS+T +YGN+ G+WVDE + 
Sbjct: 75  QGISHLLVTAPPDRQGQDPCLSSL-KPLLDGLP-LQWTGYLSTTGVYGNQRGEWVDESTP 132

Query: 122 VHPISCVATQ-RFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                   +Q R   E+ WL         + V RL GIYGP+RN  + +++ ++  + K 
Sbjct: 133 PAADLLPRSQARLQCEQAWL----NSGWPVQVFRLPGIYGPRRNNLLALQRGDARHVHKP 188

Query: 181 NQVFNRIRVEDVARCVIF---LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
            QVF R+ V+D+   ++    L       I N+ D+ PAP   ++  +A L+    P  Q
Sbjct: 189 GQVFCRVHVDDIVGALLHCLRLPATQRPSILNVCDNRPAPSSELLGYSAHLLGCPLPELQ 248

Query: 238 CFDT--ANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWK 284
            F+    N+SP    F+ DN+R+SN K+ ++LG+ L YP+YR  L+   K
Sbjct: 249 WFEAVEGNMSPMALSFWRDNRRVSNRKLTQALGYALTYPSYREGLQACLK 298


>gi|330813579|ref|YP_004357818.1| nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486674|gb|AEA81079.1| nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 263

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 143/261 (54%), Gaps = 11/261 (4%)

Query: 27  CGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMS 86
            GT+RS    +    K I  +LF     +  +  KL   TH++    P  E +  II   
Sbjct: 12  SGTSRST---IKFSDKTIESYLFDSSNFDPEIENKLKNVTHVLISTPP--EVEKIIIKNF 66

Query: 87  KDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKL 146
               K   +++W+GYLSSTS+YG+ +G WV+E S   P S +  +R  AE+  L      
Sbjct: 67  LTTLKNNQNLQWVGYLSSTSVYGDHKGNWVEETSNTQPTSEMGLKRIEAEQLLL----NS 122

Query: 147 NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG- 205
           N+ + + RL+GIY  +R+ F ++++K    + KK+Q+F+RI VED+A+ +    +     
Sbjct: 123 NLPVRIFRLAGIYSLERSVFSRLKKKKVKIVNKKDQIFSRIHVEDIAQVLFSSFSKSKDK 182

Query: 206 GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS 265
            IFN+SDD P   + V+  AA+L++I  P E  F+    S   + FY D K++ N+KIKS
Sbjct: 183 DIFNVSDDAPCSYKEVVQYAAALLQIEMPKEINFEDLENSKM-KDFYRDRKKVQNSKIKS 241

Query: 266 LGFQLLYPNYRISLKQLWKEI 286
           +G +L YP ++  L  ++ +I
Sbjct: 242 MGVKLKYPTFKEGLTAIFNQI 262


>gi|296532364|ref|ZP_06895096.1| NAD dependent epimerase/dehydratase [Roseomonas cervicalis ATCC
           49957]
 gi|296267297|gb|EFH13190.1| NAD dependent epimerase/dehydratase [Roseomonas cervicalis ATCC
           49957]
          Length = 238

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 118/223 (52%), Gaps = 5/223 (2%)

Query: 65  TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP 124
            TH++    P + G+  +++         P ++W+GYLS+T +YG+R G WV+E +   P
Sbjct: 7   ATHLLVTAGPDAAGEDPVLAAHGAALAAAPKLRWVGYLSTTGVYGDRAGGWVEEDTPPAP 66

Query: 125 ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF 184
               + +R   E+ W  +     + L ++R +GIYGP R+   ++R     R+ +    F
Sbjct: 67  GQERSRRRLAVEEAWRRLAAARGLSLDLMRCAGIYGPGRSALDELRAGRGRRVDRPGHFF 126

Query: 185 NRIRVEDVARCVI--FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA 242
           +RI VED+AR V+           + +L+DD PA    V+ EAA L+   PP    F  A
Sbjct: 127 SRIHVEDIARAVLAAAGRPAPGARVLHLADDLPAANAEVMAEAARLLGQAPPPLIPFAEA 186

Query: 243 N--ISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
              +SP  R F+A+N+RI++A+ ++ LG    +P YR  L+ +
Sbjct: 187 EAAMSPMARGFWAENRRIASARTQAGLGLLWRHPTYREGLRAV 229


>gi|168044144|ref|XP_001774542.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674097|gb|EDQ60610.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 348

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/303 (29%), Positives = 143/303 (47%), Gaps = 17/303 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR--- 59
           + IFG GYT   +A++  K G    GT RS      L+ +G     F        L+   
Sbjct: 39  VFIFGMGYTSLALANSLKKQGWDVVGTCRSEEKREALELRGFQTHRFNPDNDGEWLQGEA 98

Query: 60  -EKLYFTTHIVQCIKPSSE--GDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQW 115
              L+ +THIV  I P  +   DP + S+  +  +     ++WIGYLSSTS+YG+ +G W
Sbjct: 99  IRDLHASTHIVNSIPPVGDFDCDPVLASVKVELQQAARERLQWIGYLSSTSVYGDWQGNW 158

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           V E +   P+   A  R+ AEK W+   ++  + + V RL GIYGP R+    IRQ    
Sbjct: 159 VGEETDPRPVERKAVARWEAEKSWMQFGEETGVCVHVFRLGGIYGPGRSALDTIRQSEQN 218

Query: 176 RLVKKNQVF-------NRIRVEDVARCVIFLMT--HHLGGIFNLSDDEPAPPQNVIMEAA 226
           + +   Q         +R+ V D+ + ++  M        I+N+ DD+P+P   V+  A 
Sbjct: 219 KKLSTRQQLRGHKRFTSRVHVADICQVIVKTMASRDRARKIYNVVDDDPSPRAKVMAYAR 278

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQLWKE 285
            L+  T            + F    +   KR+SN ++K  L  +LLYP++R  L+ +   
Sbjct: 279 GLLLGTSVEHDMEFPEESAGFVSSGHVSEKRVSNQRVKDELQVKLLYPSFRSGLEAIANG 338

Query: 286 IEN 288
           + N
Sbjct: 339 LNN 341


>gi|94496626|ref|ZP_01303202.1| NAD-dependent epimerase/dehydratase [Sphingomonas sp. SKA58]
 gi|94423986|gb|EAT09011.1| NAD-dependent epimerase/dehydratase [Sphingomonas sp. SKA58]
          Length = 263

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 136/280 (48%), Gaps = 22/280 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G GY+   +AD     G    G  R+          GI    F D   +N +   +
Sbjct: 1   MLILGMGYSASRLADRLRGDGWRITGVRRAAD-----VQAGI--LAFDD---DNAVLCAI 50

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFV 122
              +HI+  + P  + DP ++          P + W GYLSST +YG+  G WVDE +  
Sbjct: 51  ATASHILSSVPPVGDLDP-VLHRYGSAITTAPAI-WTGYLSSTGVYGDTNGAWVDESA-- 106

Query: 123 HPIS-CVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
            PI     T R  A+++W A    L   +   RL GIYGP R+   ++R   + R+   N
Sbjct: 107 -PIGRGRRTARVQADRDWGA----LRADMRRFRLPGIYGPGRSALDRVRAGRAHRIDLPN 161

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT 241
           Q+F+RI V+D+A+ +I       G ++NL+DD P     VI  A  L  +  P  Q  D 
Sbjct: 162 QIFSRIHVDDIAKGIIASFGGPPG-VYNLADDLPCSQNRVIELACDLTTLPWPPLQSLDA 220

Query: 242 ANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
           A +SP  R FYA+N+R++N + K  LG+   YP Y   L+
Sbjct: 221 AKLSPMARGFYAENRRVANGRAKRLLGWTPDYPTYVEGLR 260


>gi|222618145|gb|EEE54277.1| hypothetical protein OsJ_01183 [Oryza sativa Japonica Group]
          Length = 333

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 145/291 (49%), Gaps = 13/291 (4%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLR 59
           H+++ G G+ G++++   L  G    GT  S +    L+  G+   +F      + NL  
Sbjct: 29  HMLVLGTGFVGRYVSQRLLAQGWRVSGTCTSPAKKTELEMLGMDASIFDATSSSLTNL-- 86

Query: 60  EKLYFTTHIVQCIKP-SSEGDPCIISMSKDFYKFM-PHVKWIGYLSSTSIYGNREGQWVD 117
             L   TH++  I P    GDP + S S         +++W+ YLSSTS+YG+  G WVD
Sbjct: 87  RSLQDATHLLISIPPIPGIGDPLLSSHSNLQTTLSNSNLQWLCYLSSTSVYGDCGGAWVD 146

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E   V+P +     R+ AEK WL +   L++   V RL GIYGP R+    I +  SL  
Sbjct: 147 EDHTVNPKTESVKLRYAAEKGWLNVIDDLDLSAFVFRLGGIYGPGRSAVDTIAKSKSLSR 206

Query: 178 VKKN----QVFNRIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
            +K+    Q   RI V D+ + ++  M+      I+N+ DD+PAP   V   A SL++  
Sbjct: 207 RQKSRESKQYTARIHVADICQAILASMSIRSARRIYNVVDDDPAPRSEVFAFARSLVERK 266

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
            P     D+  +        A  KR+SNA++K  LG +LL+P Y+  L+ +
Sbjct: 267 HP-GLIMDSVVLPATQDRIVAAEKRVSNARLKEELGVKLLHPTYKSGLQSI 316


>gi|85709698|ref|ZP_01040763.1| hypothetical protein NAP1_12473 [Erythrobacter sp. NAP1]
 gi|85688408|gb|EAQ28412.1| hypothetical protein NAP1_12473 [Erythrobacter sp. NAP1]
          Length = 260

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 137/285 (48%), Gaps = 32/285 (11%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL IFG GYT K I     + G ++   T S  ++              D      +   
Sbjct: 3   HLFIFGLGYTAKRIKSKLEEQG-WSVSATGSDGDI--------------DFDDRGAVMNT 47

Query: 62  LYFTTHIVQCIKPS--SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           +  ++H++  + P   +  DP + +  K+        + + YLSST +YG+++G WVDE 
Sbjct: 48  IAKSSHVLSSVPPDRKAGADPVLEAYGKEL-----RGRALYYLSSTGVYGDQQGAWVDE- 101

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
                 S   T R NA  +  A   ++  +  V RL GIYGP R+   ++R+  + R+  
Sbjct: 102 -----ASPTGTGRRNARSDADAAWMEMGAR--VFRLPGIYGPGRSALDRVREGKARRIDL 154

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
             QVF+R+ VED+A  V   +T     G +NL DD PA    V   A  L+ + PP  Q 
Sbjct: 155 PGQVFSRVHVEDIASGVTASLTQDAPPGAYNLGDDLPASGNAVTEYACRLLGVEPPPMQT 214

Query: 239 FDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            + AN+S     FY++N+R++N K K  LG++L YP Y   L  L
Sbjct: 215 LEEANLSEMALGFYSENRRVANGKAKRVLGWELKYPTYVEGLSAL 259


>gi|302807570|ref|XP_002985479.1| hypothetical protein SELMODRAFT_234809 [Selaginella moellendorffii]
 gi|300146685|gb|EFJ13353.1| hypothetical protein SELMODRAFT_234809 [Selaginella moellendorffii]
          Length = 287

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 137/286 (47%), Gaps = 16/286 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KGISPFLFADQ-KINNLLRE 60
           + +FG GYTG  +       G    GT RS     TL+   G+  ++F     ++N   E
Sbjct: 1   MFVFGLGYTGVELGKQLRTRGWTVSGTCRSAEKRRTLEECYGVDAYIFGPGVSLDNGGLE 60

Query: 61  KLYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            LY  TH+V C+ P  +   D  +    +D       ++WIGY+SST +YG+  G WVDE
Sbjct: 61  ALYQATHLVSCVPPDPDTLTDTVLKMHLEDIEARCRALRWIGYISSTGVYGDHRGGWVDE 120

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            +   P+   +  R  AE  WL + +  N  + + R  GIYGP R+    ++    LR+ 
Sbjct: 121 STQAKPVDRKSKARVAAENSWLEL-QHSNASVQIFRAGGIYGPGRSVLDTLQGARQLRVS 179

Query: 179 K---KNQVFNRIRVEDVARCVIFLM-THHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
           +     +  +R+ V DV + ++  M + H G I+N+ DD+PAP   V      L+ +   
Sbjct: 180 EARHSRRFTSRVHVSDVCQVLMASMESPHSGRIYNVVDDDPAPRSEVAAFGMELLGMELK 239

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISL 279
            E   +    S       A  KR+ N +IK  LG +L++P+YR  L
Sbjct: 240 EESPGNGDGGSA------AAEKRVMNKRIKEELGVELMFPSYREGL 279


>gi|116071775|ref|ZP_01469043.1| hypothetical protein BL107_06484 [Synechococcus sp. BL107]
 gi|116065398|gb|EAU71156.1| hypothetical protein BL107_06484 [Synechococcus sp. BL107]
          Length = 267

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 122/233 (52%), Gaps = 14/233 (6%)

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           L   TH++  I P  +G   +IS      K +  ++W GYLS+T +YGNR G WV E+  
Sbjct: 30  LQGITHLLSTIPPQQQGGDPVISTLLPLLKTL-PLEWAGYLSTTGVYGNRNGGWVQENDP 88

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P    + +R   E+ WL       + + +LRL GIYGP R+    +RQ  +  + K  
Sbjct: 89  PDPGLDRSRRRLQCEQAWL----NSGLPVQILRLPGIYGPGRSVLDSLRQGKARLINKPG 144

Query: 182 QVFNRIRVEDVARCVIFLMTH------HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           QVF RI VED+A     L+ H          I N+ DDEP  P +++   ASL+    P 
Sbjct: 145 QVFCRIHVEDIAGACWHLIDHSNSTPNDRPSIVNVVDDEPTAPADLVRHGASLLGCALPK 204

Query: 236 EQCFD--TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKE 285
           E+ +D   + +SP  R F+++N+R+SN  + + L + LLYP +R  L+   ++
Sbjct: 205 EEHYDEICSEMSPMGRSFWSENRRVSNHLLCRDLNYSLLYPTFREGLQDCLEQ 257


>gi|294013377|ref|YP_003546837.1| putative NAD-dependent epimerase/dehydratase [Sphingobium japonicum
           UT26S]
 gi|292676707|dbj|BAI98225.1| putative NAD-dependent epimerase/dehydratase [Sphingobium japonicum
           UT26S]
          Length = 265

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 137/281 (48%), Gaps = 23/281 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           H++I G GYT   +A A L+   +     R  ++  TL         F D+   + +R  
Sbjct: 3   HMLILGQGYTASRLA-ARLRAEGWHVTGIRRAADAETLA--------FDDE---SAVRAA 50

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
           +   +HI+  + P  + DP +               W GYLSST +YG+  G WVDE + 
Sbjct: 51  IAQASHILSSVPPEGDADPVLARYGSAIAAAP--AIWAGYLSSTGVYGDAAGAWVDEATP 108

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           +         R  A+ +W     +L   +   RL GIYGP R+   ++RQ  + R+   +
Sbjct: 109 LR--QGRRAVRAQADADW----GELRPDMRRFRLPGIYGPGRSVLDRVRQGRAHRIDLPD 162

Query: 182 QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP-PLEQCFD 240
           QVF+R  V+D+   +   + +   GI+NLSDD P   QN ++EAA  M   P P     +
Sbjct: 163 QVFSRAHVDDIVAGIAASLHNGPPGIYNLSDDLPC-AQNRLVEAACAMLGMPLPPLLALE 221

Query: 241 TANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
            A +SP  + FYA+N+R++N + K  LG+   YP YR  L+
Sbjct: 222 EAALSPMAQSFYAENRRVANGRAKRLLGWSPRYPTYREGLR 262


>gi|302810803|ref|XP_002987092.1| hypothetical protein SELMODRAFT_46084 [Selaginella moellendorffii]
 gi|300145257|gb|EFJ11935.1| hypothetical protein SELMODRAFT_46084 [Selaginella moellendorffii]
          Length = 288

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 134/286 (46%), Gaps = 16/286 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH-KGISPFLFADQ-KINNLLRE 60
           + +FG GYTG  +       G    GT RS     TL+   G+  ++F     ++N   E
Sbjct: 6   MFVFGLGYTGVELGKQLRTKGWLVSGTCRSAEKRRTLEECYGVDAYIFGPGVSLDNGGLE 65

Query: 61  KLYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            LY  TH+V C+ P  +   D  +    +D       ++WIGY+SST +YG+  G WVDE
Sbjct: 66  ALYQATHLVSCVPPDPDTLTDMVLKMHLEDIEARCRALRWIGYISSTGVYGDHRGGWVDE 125

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSL 175
            +   P+   +  R  AE  WL + +  N  + + R  GIYGP R   +     RQ+   
Sbjct: 126 STQAKPVDRKSKARVAAENSWLEL-QHSNASVQIFRAGGIYGPGRSVLDTLQGARQRRVS 184

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLM-THHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
                 +  +RI V DV + ++  M + H G I+N+ DD+PAP   V      L+ +   
Sbjct: 185 EARHSRRFTSRIHVSDVCQVLMASMESPHSGRIYNVVDDDPAPRSEVAAFGMELLGMELK 244

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISL 279
            E   +    S       A  KR+ N +IK  LG +L++P+YR  L
Sbjct: 245 EESPGNGDGGSA------AAEKRVMNKRIKEELGVELMFPSYREGL 284


>gi|255538746|ref|XP_002510438.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gi|223551139|gb|EEF52625.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
          Length = 343

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 144/296 (48%), Gaps = 11/296 (3%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G+F A      G    GT+ S      L+ +G    LF   +       +
Sbjct: 48  RMFILGMGFIGQFFAQNLKNEGWVVTGTSTSTIKKEQLQERGFDICLFDANEPQFSTLNR 107

Query: 62  LYFTTHIVQCIKPS--SEGDPCIISMSKDFYKFMP-HVKWIGYLSSTSIYGNREGQWVDE 118
           L   TH++  I PS    GDP +          M  +++W+GYLSSTS+YG+  G WVDE
Sbjct: 108 LKHYTHLLVSI-PSVVGIGDPVLQHRELLRSSLMDGNLQWLGYLSSTSVYGDCGGAWVDE 166

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
           +   +P S VA  R  AE+ WL +   L +   V RL GIYGP R+    I ++  +   
Sbjct: 167 NYPPNPTSEVAKSRLAAEEGWLNLGITLELSTQVFRLGGIYGPGRSAVDTITKQEPISKS 226

Query: 179 KK----NQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           +K     Q  +R+ VED+ + +   +     G I+N+ DD+PAP + V   A  L+    
Sbjct: 227 QKMRISKQYTSRVHVEDICQALKASIYKPSFGRIYNIVDDDPAPREEVFAYAEDLVGRKW 286

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIEN 288
           P      T++    + +     KR+SN ++K  LG +LLYP+YR  L  +  ++EN
Sbjct: 287 PGWVKESTSSEKALS-YNKRGEKRVSNGRLKRELGVRLLYPSYRSGLLSIIDQMEN 341


>gi|40062685|gb|AAR37598.1| conserved hypothetical protein [uncultured marine bacterium 314]
          Length = 293

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 148/288 (51%), Gaps = 10/288 (3%)

Query: 1   MHLMIFGAGYTGKFIADAAL----KVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINN 56
           + L  FG G   ++   + +    +    T  T+++  N         S F   +    +
Sbjct: 5   LKLFCFGFGQVAQYFVKSLVFQKCEFDFVTTTTSKTSFNKKIFGKNYKSLFFEGNDYDPD 64

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
           +L E L  + +++  I P S+ D  + + + +F        WI YLSSTS+YG++ G+WV
Sbjct: 65  ILNE-LSNSNNVLVSIPPVSDEDLVLKNFTDEFKN--NKFNWITYLSSTSVYGDKNGEWV 121

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE+S   P S     R  +EK W+ + K+  + + + RL+GIY  + N   K++   +  
Sbjct: 122 DENSETLPTSSKGKARLRSEKLWMNLYKQYQMPIRIFRLAGIYSLEHNVINKLKNNTARI 181

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           + KKNQ F+RI  +D+A+ ++  +     G ++N+ DD P   + V + AA+L+K+  P 
Sbjct: 182 IDKKNQFFSRIHTDDIAQALVKSIERPSSGEVYNICDDYPCSNEEVTVYAANLLKVPIPQ 241

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           +   DT   +  ++ FY D+KR+ N K+K +L  +L YP Y+  L  +
Sbjct: 242 KIKLDTIE-NEMSKSFYKDSKRVKNTKMKENLKVKLKYPTYKEGLSNI 288


>gi|297183716|gb|ADI19841.1| nucleoside-diphosphate-sugar epimerases [uncultured alpha
           proteobacterium EB000_37G09]
          Length = 229

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 115/225 (51%), Gaps = 10/225 (4%)

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
           L   L   + +V  I   S  DP +    +    F     W GY+S+TSIY ++   WVD
Sbjct: 4   LAHHLAGASALVSTITAISGRDPVLARHKQAIEGF---AGWTGYVSATSIYPDQAEGWVD 60

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E +   P +     R+ AE+EW  +T        + R++GIYGP R+PF  +R   S  +
Sbjct: 61  ETTIPEPATARGIARWKAEQEWDEVTGA-----EIFRVAGIYGPNRSPFAALRDGRSRII 115

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
            K    FNRI  +D++R +I  M       I NL D+EPA   +VI  AA L+ +TPP+ 
Sbjct: 116 DKPGHFFNRIHQDDISRIIIAAMEKPRRRRIINLCDNEPAAQADVICYAAELIGVTPPVP 175

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLK 280
             F+ A+++P  R FY   +R+ +   +  LG  L YP+YR  L+
Sbjct: 176 VPFEEADLTPMARTFYISRRRVRSVVREPELGIDLRYPDYRSGLR 220


>gi|114777294|ref|ZP_01452305.1| hypothetical protein SPV1_09513 [Mariprofundus ferrooxydans PV-1]
 gi|114552439|gb|EAU54922.1| hypothetical protein SPV1_09513 [Mariprofundus ferrooxydans PV-1]
          Length = 292

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 140/290 (48%), Gaps = 18/290 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G GY G+ +A A L +G+   GTTR       L  +G+   + A       L E L
Sbjct: 8   ILILGCGYVGERVAAACLSLGMRVIGTTRDERREAALSAQGMEAVVAASPLA---LPEAL 64

Query: 63  YFTTHIVQCIKPSSEGDPCIISMS----KDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
             +  +V    P    +  + +       +    +  V+W GYLS+T +YG+  G WVDE
Sbjct: 65  LASMDLVLDSIPLERDESGMRAGQPLWLPELAGRLTGVRWAGYLSTTGVYGDAGGAWVDE 124

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
                P S    +R  AE+ WL+      +   V RL+GIYGP+RN   +++     + V
Sbjct: 125 SFVCRPGSARGLERLRAEQAWLSS----GLPAEVFRLAGIYGPERNILGRLK-AGGYKAV 179

Query: 179 KKNQVF--NRIRVEDVARCVIFLM-THHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP- 234
           + N     +RI V+D+   VI  M +   G I NL+DD P P  + + E A ++    P 
Sbjct: 180 RWNPAHYSSRIHVDDIVAAVISAMRSPGDGRIVNLADDMPLPHADYVCEVARMIGTPLPE 239

Query: 235 -LEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
            L +    A +SP    F+ DNKRISN  + + L  +L YP++R  ++ L
Sbjct: 240 ILTEAEGEAQLSPAMLDFFRDNKRISNRLLHRELLTELKYPDFRSGMQSL 289


>gi|224062087|ref|XP_002300748.1| predicted protein [Populus trichocarpa]
 gi|222842474|gb|EEE80021.1| predicted protein [Populus trichocarpa]
          Length = 362

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 152/301 (50%), Gaps = 19/301 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-ADQ-KINNLLRE 60
           + I G G+  +F A +  K G    GT  S +    L+ KG    L  A+Q +++ L   
Sbjct: 60  MFILGMGFVCQFFAQSLQKEGWVVTGTCTSKTKKKHLEEKGFHVHLLDANQPELSTLNAL 119

Query: 61  KLYFTTHIVQCIKP-SSEGDPCIISMSKDFYK---FMPHVKWIGYLSSTSIYGNREGQWV 116
           K Y  TH++  I P    GDP +    ++  +      +++W+ YLSSTS+YG+ +G WV
Sbjct: 120 KCY--THLLVSIPPVGCAGDPML--QHEELLRSTLLDGNLQWLCYLSSTSVYGHCDGAWV 175

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI----RQK 172
           DE     P S +A  R +AE+ WL + + L     V RL GIYGP R+    I     Q 
Sbjct: 176 DEDYPTSPTSELAKLRLDAEEGWLNLGQSLGFSTQVFRLGGIYGPGRSAVDTIIKQEPQS 235

Query: 173 NSLRLVKKNQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
              ++ K  Q  +R+ VED+ + +   + T    GI+N+ DD+PAP + V   A  L+K 
Sbjct: 236 EGQKMRKSRQYTSRVHVEDICQALKASIYTPSSRGIYNIVDDDPAPREEVFTYAEDLIKK 295

Query: 232 TPPLEQCF---DTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWKEIE 287
             P    +     +  SP  +     +KR+SN ++K  LG +LL+P+YR  L  +  ++E
Sbjct: 296 KWPGHTKWSSNSASAASPTKKDNSRGDKRVSNMRMKRELGVRLLHPSYRSGLLSIIDQME 355

Query: 288 N 288
           N
Sbjct: 356 N 356


>gi|269959119|ref|YP_003328908.1| hypothetical protein ACIS_01128 [Anaplasma centrale str. Israel]
 gi|269848950|gb|ACZ49594.1| hypothetical protein ACIS_01128 [Anaplasma centrale str. Israel]
          Length = 278

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 139/290 (47%), Gaps = 31/290 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL  FG GYT  F+A   +K+     GT  +       K   +S F + D ++ + LR+ 
Sbjct: 3   HLFCFGYGYTAGFLAQQLMKMQWKISGTYHTADR----KEGFVSLFRYGDPELEHALRD- 57

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               +H++  I PS  GD  +      +   +   KW+GYLS+TS+YGN EG+WVDE S 
Sbjct: 58  ---ASHVLVSIPPS--GDDVL----ARYATALRSAKWVGYLSATSVYGNHEGEWVDETSL 108

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P       R   E  WL+      + + + RLS IYGP R+  I+     ++      
Sbjct: 109 TRPAEHSGIARLRHENMWLSS----GLPVHIFRLSAIYGPGRS-VIEGLLGGTISPNHAQ 163

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLM----KITPPLE 236
           +  +R+ VED+A  ++  M +     I+N +DD P     VI   ASL+    K+ P L 
Sbjct: 164 RFSSRMHVEDIAGTILASMLNPKPASIYNCADDLPCRYAEVIAYGASLLGSEAKMGPELS 223

Query: 237 Q-CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
             C + A+       F A  +R+SN KIK  LG  L YP Y+  L+ + +
Sbjct: 224 SVCSNAAHA-----HFPAPERRVSNDKIKRELGISLQYPTYKTGLQAILR 268


>gi|255002810|ref|ZP_05277774.1| hypothetical protein AmarPR_00565 [Anaplasma marginale str. Puerto
           Rico]
          Length = 278

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 141/290 (48%), Gaps = 31/290 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL  FG GYT  F+A   L++     GT  +       K   +S F + D ++ ++LR+ 
Sbjct: 3   HLFCFGYGYTASFLAKQLLELRWKISGTYHTADR----KEGFVSLFRYGDPELEHILRD- 57

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               +H++  I PS  GD  +      +   +   KW+GYLS+TS+YG+ EG+WVDE S 
Sbjct: 58  ---ASHVLVSIPPS--GDDVL----ARYATALRSAKWVGYLSATSVYGDHEGEWVDETSL 108

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P       R   E  WL+     ++ + + RLS IYGP R+  I+     ++      
Sbjct: 109 TRPAEHSGIARLRHENMWLSS----DLPVHIFRLSAIYGPGRS-VIEGLLGGTISPNHAQ 163

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLM----KITPPLE 236
           +  +R+ VED+A  ++  M +     I+N +DD P     VI   ASL+    K+ P L 
Sbjct: 164 RFSSRMHVEDIAGTILASMLNPKPASIYNCADDLPCRYAEVIAYGASLLGSEAKMGPELS 223

Query: 237 Q-CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
             C + A+       F A  +R+SN KIK  LG  L YP Y+  L+ + +
Sbjct: 224 SVCSNAAHA-----HFPAPERRVSNDKIKRELGISLQYPTYKTGLQAILR 268


>gi|222474837|ref|YP_002563252.1| hypothetical protein AMF_108 [Anaplasma marginale str. Florida]
 gi|222418973|gb|ACM48996.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 281

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 141/290 (48%), Gaps = 31/290 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL  FG GYT  F+A   L++     GT  +       K   +S F + D ++ ++LR+ 
Sbjct: 6   HLFCFGYGYTASFLAKQLLELRWKISGTYHTADR----KEGFVSLFRYGDPELEHILRD- 60

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               +H++  I PS  GD  +      +   +   KW+GYLS+TS+YG+ EG+WVDE S 
Sbjct: 61  ---ASHVLVSIPPS--GDDVL----ARYATALRSAKWVGYLSATSVYGDHEGEWVDETSL 111

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P       R   E  WL+     ++ + + RLS IYGP R+  I+     ++      
Sbjct: 112 TRPAEHSGIARLRHENMWLSS----DLPVHIFRLSAIYGPGRS-VIEGLLGGTISPNHAQ 166

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLM----KITPPLE 236
           +  +R+ VED+A  ++  M +     I+N +DD P     VI   ASL+    K+ P L 
Sbjct: 167 RFSSRMHVEDIAGTILASMLNPKPASIYNCADDLPCRYAEVIAYGASLLGSEAKMGPELS 226

Query: 237 Q-CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
             C + A+       F A  +R+SN KIK  LG  L YP Y+  L+ + +
Sbjct: 227 SVCSNAAHA-----HFPAPERRVSNDKIKRELGISLQYPTYKTGLQAILR 271


>gi|56416468|ref|YP_153542.1| hypothetical protein AM148 [Anaplasma marginale str. St. Maries]
 gi|56387700|gb|AAV86287.1| hypothetical protein AM148 [Anaplasma marginale str. St. Maries]
          Length = 281

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 137/290 (47%), Gaps = 31/290 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           HL  FG GYT  F+A   L++     GT  +       K   +S F + D  + + LR+ 
Sbjct: 6   HLFCFGYGYTASFLAKQLLELQWKISGTYHTADR----KEGFVSLFRYGDPALEHALRD- 60

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               +H++  I PS  GD  +      +   +   KW+GYLS+TS+YGN EG+WVDE S 
Sbjct: 61  ---ASHVLVSIPPS--GDDVL----ARYTTALRSAKWVGYLSATSVYGNHEGEWVDETSL 111

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P       R   E  WL       + + V RLS IYGP R+  I+     ++      
Sbjct: 112 TRPAEHSGIARLRHENMWLGS----GLPVHVFRLSAIYGPGRS-VIEGLLWGTISPNHAQ 166

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLM----KITPPLE 236
           +  +R+ VED+A  ++  M +     I+N +DD P     VI   ASL+    K+ P L 
Sbjct: 167 RFSSRMHVEDIAGTILASMLNPKPASIYNCADDLPCRYAEVIAYGASLLGSEAKMGPELS 226

Query: 237 Q-CFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
             C + A+       F A  +R+SN KIK  LG  L YP Y+  L+ + +
Sbjct: 227 SVCSNAAHA-----HFPAPERRVSNDKIKRELGISLQYPTYKTGLQAILR 271


>gi|238013882|gb|ACR37976.1| unknown [Zea mays]
          Length = 269

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 123/234 (52%), Gaps = 14/234 (5%)

Query: 62  LYFTTHIVQCIKP-SSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQWVDE 118
           L   TH++  I P    GDP +I++ +D  + + H  ++W+ YLSSTS+YG+  G  VDE
Sbjct: 22  LRQATHLLISIPPIPGVGDPLLINLDEDLRRILGHGNLEWLCYLSSTSVYGDCGGVLVDE 81

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL--- 175
              V+P S  A  R+NAEK WL +     +   V RL GIYGP R+    + +  SL   
Sbjct: 82  DHTVNPKSESAKLRYNAEKGWLNLIDDPKLSAFVFRLGGIYGPGRSALDTLAKSKSLSRK 141

Query: 176 -RLVKKNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIMEAASLMKITP 233
            +L +  Q   RI V D+ + V+  M+      IFN+ DD+PAP   V   A SL++   
Sbjct: 142 QKLRESKQYTARIHVADIYQAVLASMSIRCARKIFNVVDDDPAPRAEVFAFATSLIQRRY 201

Query: 234 PLEQCFDTANISP----FTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           P +   +T +  P    +        KR+SNA++K  LG  LL+P YR  L+ +
Sbjct: 202 P-DMITETIDAKPAGLDYQEMIVPAEKRVSNARMKQELGVNLLHPTYRSGLQSI 254


>gi|318043002|ref|ZP_07974958.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. CB0101]
          Length = 304

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 111/217 (51%), Gaps = 11/217 (5%)

Query: 66  THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI 125
           +H++  + P + G    +    +  +  P ++W+GYLS+T +YG+ +G WVDEHS   P 
Sbjct: 75  SHVLITLPPDTNGTDAALEHLLEPLRHQP-LRWLGYLSTTGVYGDSQGAWVDEHSPTQPT 133

Query: 126 SCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFN 185
              +  R   E+ WL       + +   RL  IYGP R PF ++R   +  + K  QVF 
Sbjct: 134 LPRSQARLQCEQRWLGS----GLPVQSFRLPAIYGPGRCPFEQLRSGQARLVHKPGQVFC 189

Query: 186 RIRVEDVARCVIFLMTHHLG---GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD-- 240
           RI V+D+   ++       G    + N+ DD P P    +  AA L+    P  + F+  
Sbjct: 190 RIHVDDIVGALLHATDQPEGRQPSLINVCDDAPCPSSETLGYAAHLLGCKLPEVRKFEAI 249

Query: 241 TANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYR 276
              +SP    F+ADN+R+SN  + + LG++L YP+YR
Sbjct: 250 APQMSPMAMSFWADNRRVSNRLLCRELGYRLRYPSYR 286


>gi|297850360|ref|XP_002893061.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297338903|gb|EFH69320.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 353

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 152/306 (49%), Gaps = 27/306 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-ADQKINNLLRE 60
            + I G G+ G F A    +      GT RS       + +GI+   F AD    +LL +
Sbjct: 54  RMFILGMGFVGGFFAQQLKEANWVVSGTCRSDPKKKEWEKRGINLHPFSADSPEWSLLLD 113

Query: 61  KLYFTTHIVQCIKPSSE-GDPCIISMSKDFYKFMP-HVKWIGYLSSTSIYGNREGQWVDE 118
            +   TH++  I P ++ GDP + ++     K    +++W+ YLSSTS+YG+  G WVDE
Sbjct: 114 SVKDYTHLLISIPPLADIGDPMLRNVELLRGKLSSGNLRWLCYLSSTSVYGDCGGAWVDE 173

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
           +   +P +  A  R  AE+ WL++ + L +   +LRL GIYGP R+    + ++  L   
Sbjct: 174 NHPPNPKTQSAKVRLAAEEGWLSLGRDLGVSTQILRLGGIYGPGRSAIDTLLKQERLSEG 233

Query: 179 KKNQV----FNRIRVEDVARCVIFLMTHH---LGGIFNLSDDEPAPPQNVIMEAASLMKI 231
           +K +      +R+ VED+  C +   +      G I+N+ DD+PAP + V   A  L+  
Sbjct: 234 QKRRASRKFTSRVHVEDI--CQVLQASTEKPSSGEIYNVVDDDPAPREEVFEYALELIAK 291

Query: 232 TPPLEQCFDTANISPFTRFFYAD--------NKRISNAKIKS-LGFQLLYPNYRISLKQL 282
             P     +  N  PF  F Y           KR+ N  +K+ LG +L+YP+Y+  L+ +
Sbjct: 292 RWP-----EIINTKPFP-FLYESREESSLRGEKRVRNEHMKNKLGVKLIYPSYKSGLQSI 345

Query: 283 WKEIEN 288
            + ++N
Sbjct: 346 VENMDN 351


>gi|225458177|ref|XP_002281172.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142549|emb|CBI19752.3| unnamed protein product [Vitis vinifera]
          Length = 351

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 93/297 (31%), Positives = 139/297 (46%), Gaps = 17/297 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G+F A      G    GT  S      L+ +G + +LF   +    +   
Sbjct: 58  RMFILGMGFVGQFFAQDLKNHGWVVSGTCTSAFKKKKLEERGFNIYLFDANEPELGVLNA 117

Query: 62  LYFTTHIVQCIKPS-SEGDPCIISMSKDFYK---FMPHVKWIGYLSSTSIYGNREGQWVD 117
           L ++TH++  I P    GDP  I     F K       ++W+ YLSSTS+YGN  G+ VD
Sbjct: 118 LKYSTHLLVSIPPVVGIGDP--ILQHDKFLKSRIMDGDLQWLCYLSSTSVYGNCGGELVD 175

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL-- 175
           E     P S  A  R  AEK W ++  +L +   + RL GIYGP R+    I ++  L  
Sbjct: 176 EDYPASPASESAKLRLAAEKGWSSLGSELGLSTQIFRLGGIYGPGRSAVDTIIKQGPLTE 235

Query: 176 --RLVKKNQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
             R     Q  +R+ V D+ + +   +    +G I+N+ DD+PAP   V   A  L++  
Sbjct: 236 GQRKRISRQYTSRVHVADICQALKATIQIPSVGKIYNIVDDDPAPRAQVFAFARDLIEKK 295

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIEN 288
            P     +    S F        KR+SNA++ K LG  LL+P YR  L+ +   +EN
Sbjct: 296 WP-----NHIKESVFPGSARQAEKRVSNARMKKELGVTLLHPTYRSGLQSIIDNMEN 347


>gi|125525272|gb|EAY73386.1| hypothetical protein OsI_01268 [Oryza sativa Indica Group]
          Length = 363

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 148/321 (46%), Gaps = 43/321 (13%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF------------ 49
           H+++ G G+ G++++   L  G    GT  S +    L+  G+   +F            
Sbjct: 29  HMLVLGTGFVGRYVSQRLLAQGWRVSGTCTSPAKKTELEMLGMDASVFDATSSRCCFFFF 88

Query: 50  -----------ADQK---------INNLLREKLYFTTHIVQCIKP-SSEGDPCIISMSKD 88
                      +D+          + NL    L   TH++  I P    GDP + S S  
Sbjct: 89  FLLFLFFVPSESDKSPVLVLVPFSLTNL--RSLQDATHLLISIPPIPGIGDPLLSSHSNL 146

Query: 89  FYKFM-PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN 147
                  +++W+ YLSSTS+YG+  G WVDE   V+P +     R+ AEK WL +   L+
Sbjct: 147 QTTLSNSNLQWLCYLSSTSVYGDCGGAWVDEDHTVNPKTESVKLRYAAEKGWLNVIDDLD 206

Query: 148 IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN----QVFNRIRVEDVARCVIFLMT-H 202
           +   V RL GIYGP R+    I +  SL   +K+    Q   RI V D+ + ++  M+  
Sbjct: 207 LSAFVFRLGGIYGPGRSAVDTIAKSKSLSRRQKSRESKQYTARIHVADICQAILASMSIR 266

Query: 203 HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAK 262
               I+N+ DD+PAP   V   A SL++   P     D+  +        A  KR+SNA+
Sbjct: 267 SARRIYNVVDDDPAPRSEVFAFARSLVERKHP-GLIMDSVVLPATQDRIVAAEKRVSNAR 325

Query: 263 IK-SLGFQLLYPNYRISLKQL 282
           +K  LG +LL+P Y+  L+ +
Sbjct: 326 LKEELGVKLLHPTYKSGLQSI 346


>gi|18394775|ref|NP_564095.1| binding / catalytic/ coenzyme binding [Arabidopsis thaliana]
 gi|109946403|gb|ABG48380.1| At1g19690 [Arabidopsis thaliana]
 gi|332191762|gb|AEE29883.1| nucleoside-diphosphate-sugar epimerase domain-containing protein
           [Arabidopsis thaliana]
          Length = 352

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 151/306 (49%), Gaps = 28/306 (9%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G F A    +      GT RS S     + +GI+   F+       L + 
Sbjct: 54  QMFILGMGFVGGFFAQQLKESDWVVSGTCRSDSKKKEWEKRGINLHPFSADSPEWSLLDS 113

Query: 62  LYFTTHIVQCIKPSSE-GDPCI--ISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
           +   TH++  I P ++ GDP +  + + +D      +++W+ YLSSTS+YG+  G WV+E
Sbjct: 114 VKDYTHLLISIPPLADIGDPMLRNVELVRDKLS-SGNLRWLCYLSSTSVYGDCGGAWVNE 172

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
           +   +P +  A  R  AE+ WL++ + L +   +LRL GIYGP R+    + ++  L   
Sbjct: 173 NHLPNPKTQSAKVRLAAEQGWLSLGRDLGVSTQILRLGGIYGPGRSAIDTLLKQERLSEG 232

Query: 179 KKNQV----FNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
           +K +      +R+ VED+ + +         G I+N+ DD+PA  + V   A  L++   
Sbjct: 233 QKRRASRKFTSRVHVEDICQVLKAATEKPASGEIYNIVDDDPAAREEVFEYALELIEKRW 292

Query: 234 PLEQCFDTANIS--PFTRFFYAD--------NKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           P        NI+  PF  F Y           KR+ N ++K  LG +LLYP+Y+  L+ +
Sbjct: 293 P-------GNITTKPFP-FLYESREESSLRGEKRVCNERMKDKLGVKLLYPSYKSGLQSI 344

Query: 283 WKEIEN 288
            + ++N
Sbjct: 345 VENMDN 350


>gi|147797330|emb|CAN76003.1| hypothetical protein VITISV_043063 [Vitis vinifera]
          Length = 351

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 139/297 (46%), Gaps = 17/297 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G+F A      G    GT  S      L+ +G + +LF   +    +   
Sbjct: 58  RMFILGMGFVGQFFAQDLKNHGWVVSGTCTSAFKKKKLEERGFNIYLFDANEPELGVLNA 117

Query: 62  LYFTTHIVQCIKPS-SEGDPCIISMSKDFYK---FMPHVKWIGYLSSTSIYGNREGQWVD 117
           L ++TH++  I P    GDP  I     F K       ++W+ YLSSTS+YGN  G+ VD
Sbjct: 118 LKYSTHLLVSIPPVVGIGDP--ILQHDKFLKSRIMDGDLQWLCYLSSTSVYGNCGGELVD 175

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E     P S  A  R  AEK W ++  +L +   + RL GIYGP R+    I ++  L  
Sbjct: 176 EDYPASPASESAKLRLAAEKGWSSLGSELGLSTQIFRLGGIYGPGRSAVDTIIKQGPLTE 235

Query: 178 VKKN----QVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
            ++     Q  +R+ V D+ + +   +    +G I+N+ DD+PAP   V   A  L++  
Sbjct: 236 GQRKRISRQYTSRVHVADICQALKATIQIPSVGKIYNIVDDDPAPRAQVFAFARDLIEKK 295

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQLWKEIEN 288
            P     +    S F        KR+SNA++ K LG  LL+P YR  L+ +   + N
Sbjct: 296 WP-----NHIKESVFPGSARQAEKRVSNARMKKELGVTLLHPTYRSGLQSIIDNMXN 347


>gi|21536800|gb|AAM61132.1| unknown [Arabidopsis thaliana]
          Length = 352

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 150/306 (49%), Gaps = 28/306 (9%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G F A    +      GT RS S     + +GI+   F+       L + 
Sbjct: 54  QMFILGMGFVGGFFAQQLKESDWVVSGTCRSDSKKKEWEKRGINLHPFSADSPEWSLLDS 113

Query: 62  LYFTTHIVQCIKPSSE-GDPCI--ISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
           +   TH++  I P ++ GDP +  + + +D      +++W+ YLSSTS+YG+  G WV+E
Sbjct: 114 VKDYTHLLISIPPLADIGDPMLRNVELVRDKLS-SGNLRWLCYLSSTSVYGDCGGAWVNE 172

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
           +   +P +  A  R  AE+ WL++ + L +   +LRL GIYGP R+    + ++  L   
Sbjct: 173 NHLPNPKTQSAKVRLAAEQGWLSLGRDLGVSTQILRLGGIYGPGRSAIDTLLKQERLSEG 232

Query: 179 KKNQV----FNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITP 233
           +K +      +R+ VED+ + +         G I+N+ DD+PA  + V   A  L++   
Sbjct: 233 QKRRASRKFTSRVHVEDICQVLKAATEKPASGEIYNIVDDDPAAREEVFEYALELIEKRW 292

Query: 234 PLEQCFDTANIS--PFTRFFYAD--------NKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           P        NI+  PF  F Y           KR+ N ++K  LG +LLYP Y+  L+ +
Sbjct: 293 P-------GNITTKPFP-FLYESREESSLRGEKRVCNERMKDKLGVKLLYPWYKSGLQSI 344

Query: 283 WKEIEN 288
            + ++N
Sbjct: 345 VENMDN 350


>gi|307108163|gb|EFN56404.1| hypothetical protein CHLNCDRAFT_57641 [Chlorella variabilis]
          Length = 369

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 105/226 (46%), Gaps = 22/226 (9%)

Query: 20  LKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL---LREKLYFTTHIVQCIKPSS 76
           LK G    GT R+      L+ +GI+ F F       L     E L   TH++  + P +
Sbjct: 17  LKRGWQVAGTCRNPDKRQQLEQRGITTFHFDPGDFETLGGKALESLRHATHVLSTVPPDA 76

Query: 77  ---EGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRF 133
              E DP I++ S+   +     KW+GY+SSTS+YG+ EG+WVDE S +   S     R 
Sbjct: 77  NEDEEDPVILAHSQQLSEHADGYKWVGYISSTSVYGDYEGEWVDERSELRAASGKGWSRI 136

Query: 134 NAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-------NR 186
            AE EWLA+     + + + R  GIYGP+R+    ++++         Q +        R
Sbjct: 137 VAEHEWLALHDSFGLPVHLFRCGGIYGPRRSAVETVQRQWGAAGDGPQQQWRPSASQERR 196

Query: 187 IRVEDVARCVIFLMTHHL---------GGIFNLSDDEPAPPQNVIM 223
            R    ARC ++ +   L         G  +N++DD+PA    V+ 
Sbjct: 197 GRHRYTARCHVYDICQVLEASTRHPRPGAAYNIADDDPADRATVMQ 242


>gi|303283962|ref|XP_003061272.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457623|gb|EEH54922.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 437

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 85/339 (25%), Positives = 140/339 (41%), Gaps = 59/339 (17%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE- 60
           H+ IFG GY    +A+   + G    GT R  +   +L+  GI+  ++       L  + 
Sbjct: 91  HMFIFGLGYVSLGVANTLRRGGWTVSGTCRDEARARSLRDAGINAHVWRPDDGIGLDTDG 150

Query: 61  --KLYFTTHIVQCIKPSSEGD--------PCIISM----------------SKDFYKFMP 94
              L  +TH++  + P ++ D         C+ ++                         
Sbjct: 151 WRALCASTHVLDSVPPVADFDRDPVLSDKACVDALVAKSRARGGGDGGDGGDVVAADDAS 210

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
            ++W+GYLSST +YG+  G WVDE + V P S     R  AE+ W  +  +  +   V R
Sbjct: 211 PLRWVGYLSSTGVYGDFAGAWVDETTAVRPSSAKGKARDEAERAWRDLRVESGVPAFVFR 270

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKK----------NQVFNRIRVEDVARCVIFLMTHHL 204
           L GIYGP R+    +  K++  +              +  +R+ V D+   V+F   + +
Sbjct: 271 LGGIYGPGRSVLDAVAAKHAAGVAPATAASKAERGTRKFISRVHVADIVN-VLFASVNKV 329

Query: 205 GG-------------IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD-------TANI 244
                          ++N+ DDEPAP  +    A SL+ I    E   D        A  
Sbjct: 330 AERGGYGGETEEEDTVYNVVDDEPAPRGDAAAYARSLLGIEEFEENDADATEDEVAAAAG 389

Query: 245 SPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQL 282
           + +      + KR+ NA+ K SLG +LL+P YR  L  +
Sbjct: 390 TAYPSRRSGEEKRVRNARAKTSLGVELLFPTYREGLAAI 428


>gi|219129843|ref|XP_002185089.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403584|gb|EEC43536.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 344

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 113/235 (48%), Gaps = 27/235 (11%)

Query: 54  INNLLREKLYFTTHIVQCIKPSSE--GDPCIISMSKDFYKFMPHVK---WIGYLSSTSIY 108
           +NN  +  L   THI+Q + P ++   DP ++++  D  +    V    W+GYLSST +Y
Sbjct: 112 LNNAGQASLASATHIIQTVAPIADHNQDP-LLALHGDLLRQRKGVNPLCWVGYLSSTGVY 170

Query: 109 GNREGQWV--DEHSFVHPISCVATQRFNAEKEWLAITKK--LNIKLAVLRLSGIYGPKRN 164
           G+  G WV  DE S +  +   +  R  AE +W  + K     I++   R  GIYGP R 
Sbjct: 171 GDHHGAWVTEDESSELRCVDAKSLARIEAEWQWRQLEKASGQGIRVDCFRCGGIYGPGRG 230

Query: 165 PFIKI-----RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH----HLGGIFNLSDDEP 215
           P            +S  L +  +  NRI V+D+A  ++  M+     H G ++NL DD P
Sbjct: 231 PLFSTVNDLRLSSDSSLLDQTPKYVNRILVDDIAGAMLAAMSSDRPLHNGRVYNLVDDNP 290

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANIS------PFTRFFYADNKRISNAKIK 264
           AP ++VI+EA  L  +    +   + A  +      P TR     NKR  N ++K
Sbjct: 291 APRRDVILEARKLRGLVDGSDANDNGAAATFTGRSRPPTR--STGNKRCCNQRLK 343


>gi|102139891|gb|ABF70040.1| hypothetical protein, 5' partial [Musa acuminata]
          Length = 218

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 96/185 (51%), Gaps = 8/185 (4%)

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
             +YG+  G WVDE     P +  A  R  AEK WL +  +L + + V RL GIYGP R+
Sbjct: 24  AGVYGDCGGAWVDEDYPPDPETESAKSRLAAEKGWLDLGHELGVTVNVFRLGGIYGPGRS 83

Query: 165 PFIKIRQKNSLRLVKK---NQVFN-RIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAPPQ 219
               I +  SL   +K   +++F  R+ V DV + +   M     G I+N+ DD+PAP Q
Sbjct: 84  ALDTIIKGQSLSEAQKKRESRLFTARVHVADVYQAIKASMEILSSGRIYNVVDDDPAPRQ 143

Query: 220 NVIMEAASLMKITPPLEQC-FDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRI 277
            V   A SL++       C  D  ++ P       + KR+SNA++K  LG  LLYP YR+
Sbjct: 144 EVFAFAQSLLEERWAGTVCKLDNNDMKPHKSLARCE-KRVSNARLKEELGVSLLYPMYRL 202

Query: 278 SLKQL 282
            L+ +
Sbjct: 203 GLRNI 207


>gi|58699411|ref|ZP_00374167.1| NAD dependent epimerase/dehydratase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534071|gb|EAL58314.1| NAD dependent epimerase/dehydratase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 176

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 92/174 (52%), Gaps = 29/174 (16%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRS--VSNLLTLKHKGISPFLFADQKINNLL 58
           MHL  FG GY  KF++   L +G    GT+RS  + +++   ++ +S          +LL
Sbjct: 1   MHLFCFGYGYVAKFLSKKLLNLGWKVSGTSRSKNIQDVILFNYEKVS---------QDLL 51

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
           +      TH++  I P  +GD  +    + +   + +VKW+GYLS+TS+YG+  G WVDE
Sbjct: 52  KS----ATHVLISIPP--DGDDVV----ERYGDCLQNVKWLGYLSATSVYGDHSGNWVDE 101

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNPFIKIR 170
            S   PI     +R  +EK+W      LN KL V   RL+GIYGP RN    ++
Sbjct: 102 ESETRPIEIRGEKRLKSEKKW------LNSKLPVHIFRLAGIYGPGRNVLFDLQ 149


>gi|300113028|ref|YP_003759603.1| NAD-dependent epimerase/dehydratase [Nitrosococcus watsonii C-113]
 gi|299538965|gb|ADJ27282.1| NAD-dependent epimerase/dehydratase [Nitrosococcus watsonii C-113]
          Length = 292

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 99/187 (52%), Gaps = 8/187 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S++ +YG+  G WVDE   VHP +  + +R +AE++ +   ++ ++ L +LR+ GI
Sbjct: 100 IVYISTSGVYGDCGGAWVDESRPVHPGNNRSRRRTDAERQLMGFARRHSLPLIILRVPGI 159

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAP 217
           YG  R P  ++RQ N +   ++    NRI  +D+A   +    +   GGI+N+SDDEP  
Sbjct: 160 YGSGRLPLERLRQGNPVVCPEQAPWSNRIHADDLAIIAVRAGQSDTPGGIYNVSDDEPTS 219

Query: 218 PQNVIMEAASLMKITPPLEQCFDTAN----ISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
             + +   A    +  P   C   A      SP    +  +++R++N K+K+ LG +L Y
Sbjct: 220 MTDYLYRLADAAGL--PRPPCVSLAKAQRIFSPKLLEYLNESRRLNNQKMKTVLGVKLRY 277

Query: 273 PNYRISL 279
           P     L
Sbjct: 278 PTLDTGL 284


>gi|288940055|ref|YP_003442295.1| NAD-dependent epimerase/dehydratase [Allochromatium vinosum DSM
           180]
 gi|288895427|gb|ADC61263.1| NAD-dependent epimerase/dehydratase [Allochromatium vinosum DSM
           180]
          Length = 298

 Score = 95.5 bits (236), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 136/294 (46%), Gaps = 17/294 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           H++I G GY G+ +A   ++ G    G  RS S L  L   GI P +  D    + +   
Sbjct: 3   HIVIVGCGYVGERLARQYIERGDSVLGLVRSRSGLERLAAAGI-PAVRHDLTGADPMPGS 61

Query: 62  LYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           L   T +     P ++G  D     +   F +   H + + Y+S+T +YG+  G WVDE 
Sbjct: 62  L-AGTRLFHLAPPPAQGQEDLHTRRLVASFDQAG-HPRRLVYISTTGVYGDCAGAWVDED 119

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
               P    + +R +AE+     +++   +L VLR++GIYGP R P  ++  K  L LV+
Sbjct: 120 WPTQPTLDRSRRRLDAEECLRRWSREHGGELIVLRVAGIYGPDRLPLERL--KRGLPLVR 177

Query: 180 KNQV--FNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNV---IMEAASLMKITP 233
             +    NRI V+D V  CV  +     G IFN+SD +P+   +    I EAA L    P
Sbjct: 178 PEEAPYSNRIHVDDLVTVCVAAMERGRHGAIFNVSDGQPSTMTDYFIRIAEAAGLPH--P 235

Query: 234 PLEQCFD-TANISP-FTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
           PL    + +A++S     +     +  S    + LG +L YP     L Q   E
Sbjct: 236 PLITMAEASAHLSEGMMGYMSESRRLSSRRLREDLGVELRYPTLSEGLAQALGE 289


>gi|218459854|ref|ZP_03499945.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli Kim 5]
          Length = 113

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 67/113 (59%), Gaps = 1/113 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A     V   GTTRS   +  L+  GI  FLF  + +++ L  
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGQDVRVSGTTRSADKMEGLRDGGIDAFLFDGETMDDDLCR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREG 113
            L   TH+VQ I P  + DP +  + +D  +F+P ++WIGYLS+  +YG+ +G
Sbjct: 61  ALESVTHLVQSIAP-GKADPLLRLLGEDSARFLPRLEWIGYLSTVGVYGDHKG 112


>gi|298706358|emb|CBJ29367.1| NAD-dependent epimerase/dehydratase [Ectocarpus siliculosus]
          Length = 366

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 106/235 (45%), Gaps = 44/235 (18%)

Query: 62  LYFTTHIVQCIKPS--SEGDPCIISMSKD--FYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
           L   T ++  + P+  S  DP +++   +  + +   +++W+GYLSST +YG+R G WV 
Sbjct: 10  LASATCVLSTVPPALQSGADPVLVAHEAELQWARSKGNLRWVGYLSSTGVYGDRGGGWVT 69

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI-RQKNSLR 176
           E     P +     R  AE+ WL + ++  + + V RL+GIYGP R+    + R    +R
Sbjct: 70  EEDEPWPAAPRTKARLKAERSWLRLHERDGLPVHVFRLAGIYGPGRSALDAVARHNGDIR 129

Query: 177 LVKKNQ--VFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
           L   +   + +R  V D+             G+   S + PAP                 
Sbjct: 130 LAGSDDGTMVSRTHVSDIV------------GVVEASIELPAP----------------- 160

Query: 235 LEQCFDTANISPFTRFFY---ADNKRISNAKIKSL----GFQLLYPNYRISLKQL 282
                + A+  P TR+       NKR+ N ++++L    G  L +P+YR  LK +
Sbjct: 161 -GMVLNVADDLPSTRYEARRGGGNKRVDNERMRALLAASGRSLTFPDYRSGLKAV 214


>gi|262198780|ref|YP_003269989.1| NAD-dependent epimerase/dehydratase [Haliangium ochraceum DSM
           14365]
 gi|262082127|gb|ACY18096.1| NAD-dependent epimerase/dehydratase [Haliangium ochraceum DSM
           14365]
          Length = 327

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 7/189 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+SST +Y   +G WVDE + V P S     R +AE+  L       +    LR  GIYG
Sbjct: 119 YISSTGVYPAGDGAWVDEDTPVAPGSSRGEARLHAERALLEGAAAAGVSAVALRAPGIYG 178

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAP 217
           P R    ++  +   R++     F +RI V+D+   +I           ++N  DDEP  
Sbjct: 179 PGRGVPTRL-VRGDYRIIGAGDTFVSRIHVDDLGSVIIAAACAQTLPRAVYNAGDDEPET 237

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
            +      A ++ + PP      T+ +SP+     + N+R+ N +IK  LG +L YP +R
Sbjct: 238 SRRYGDAVAEILGLPPP--PSVPTSEVSPWVATMLSANRRVDNGRIKRELGVRLRYPTWR 295

Query: 277 ISLKQLWKE 285
             L Q+  E
Sbjct: 296 EGLAQIMDE 304


>gi|77166228|ref|YP_344753.1| NAD-dependent epimerase/dehydratase [Nitrosococcus oceani ATCC
           19707]
 gi|76884542|gb|ABA59223.1| NAD-dependent epimerase/dehydratase [Nitrosococcus oceani ATCC
           19707]
          Length = 292

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 96/187 (51%), Gaps = 8/187 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S++ +YG+  G WVDE   VHP +  + +R +AE++     ++  + L +LR+ GI
Sbjct: 100 IVYISTSGVYGDCGGAWVDESRPVHPGNDRSRRRVDAEQQLRLFARRYALPLIILRVPGI 159

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAP 217
           YG  R P  ++R+ N +    +    NRI  +D+A   +      +  GI+N+SDDEP  
Sbjct: 160 YGSGRLPLERLRRGNPVVCPDQAPWSNRIHADDLATIAVRAGQSSIPAGIYNVSDDEPTS 219

Query: 218 PQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
             + +   A    +  P   C   A    N SP    +  +++R++N K+K+ LG +L Y
Sbjct: 220 MTDYLYRLADAAGL--PRPPCVSLAEARRNFSPKLLEYLNESRRLNNQKMKTVLGVKLRY 277

Query: 273 PNYRISL 279
           P     L
Sbjct: 278 PTLETGL 284


>gi|254435599|ref|ZP_05049106.1| NAD dependent epimerase/dehydratase family [Nitrosococcus oceani
           AFC27]
 gi|207088710|gb|EDZ65982.1| NAD dependent epimerase/dehydratase family [Nitrosococcus oceani
           AFC27]
          Length = 285

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 96/187 (51%), Gaps = 8/187 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S++ +YG+  G WVDE   VHP +  + +R +AE++     ++  + L +LR+ GI
Sbjct: 93  IVYISTSGVYGDCGGAWVDESRPVHPGNDRSRRRVDAEQQLRLFARRYALPLIILRVPGI 152

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAP 217
           YG  R P  ++R+ N +    +    NRI  +D+A   +      +  GI+N+SDDEP  
Sbjct: 153 YGSGRLPLERLRRGNPVVCPDQAPWSNRIHADDLATIAVRAGQSSIPAGIYNVSDDEPTS 212

Query: 218 PQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
             + +   A    +  P   C   A    N SP    +  +++R++N K+K+ LG +L Y
Sbjct: 213 MTDYLYRLADAAGL--PRPPCVSLAEARRNFSPKLLEYLNESRRLNNQKMKTVLGVKLRY 270

Query: 273 PNYRISL 279
           P     L
Sbjct: 271 PTLETGL 277


>gi|332709756|ref|ZP_08429715.1| NAD dependent epimerase/dehydratase family protein [Lyngbya
           majuscula 3L]
 gi|332351583|gb|EGJ31164.1| NAD dependent epimerase/dehydratase family protein [Lyngbya
           majuscula 3L]
          Length = 274

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 94/186 (50%), Gaps = 14/186 (7%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAIT-KKLNIK 149
           K  P V+ + Y  S ++YG+R+G WVDE S + P S        AE E + ++    N+K
Sbjct: 96  KNAPTVRQLIYTGSYAVYGDRQGGWVDETSPIAPAS--PNYEILAETEQVLLSASNPNLK 153

Query: 150 LAVLRLSGIYGPKRNPFIKI--RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI 207
           + +LRL GIYGPKR   +KI  R   + R     +V N I ++D+   + F+ +H L GI
Sbjct: 154 VCILRLGGIYGPKRE-LVKIFGRFAGTTREGSGQEVTNWIHLDDIVGGIEFVRSHQLQGI 212

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           +NL DD+    Q  ++E        PP+          P+       N R+SN KI   G
Sbjct: 213 YNLVDDQILTYQE-LLEKVFKQHNLPPVSWDSSVTKARPY-------NARVSNKKIIDAG 264

Query: 268 FQLLYP 273
           +Q ++P
Sbjct: 265 YQFIHP 270


>gi|220933216|ref|YP_002512115.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219994526|gb|ACL71128.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 289

 Score = 92.4 bits (228), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 120/288 (41%), Gaps = 9/288 (3%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           MI G G  G   A   +  G       RS      L  +GI P   AD  I         
Sbjct: 1   MIIGCGDVGLRAARQLMARGREVLAVVRSAERAERLAAEGI-PVHRADLDIPEQAAGIPL 59

Query: 64  FTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
               ++   +P   G  DP +           P    I Y+S+T +YG++ G  V E + 
Sbjct: 60  AGRPVIYLAQPPEPGISDPRMGGFLAACAAQPP--ARIVYVSTTGVYGDQRGAEVTEDTP 117

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
             P +  A +R +AE +  A        + +LR+ GIYGP R P  +IR +  +   ++ 
Sbjct: 118 TRPQTDRARRRMDAENQLRAFMAAHGTPVVILRVPGIYGPGRLPLERIRNRTPVICPEEA 177

Query: 182 QVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
              NRI  ED+A  C+  L     G +FN+ D + A   + I   A L  +  P      
Sbjct: 178 PPGNRIHAEDLASLCIAALERGEPGDVFNVGDGQHASMTDFIYTVADLAGLERPPCVPLS 237

Query: 241 TAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLKQLWKE 285
            A+  ISP    F  +++ I   K +++LG QL YPN    ++   ++
Sbjct: 238 EADKHISPAMMSFIRESRIIKAEKGLQALGVQLRYPNIESGIRDALRQ 285


>gi|148263818|ref|YP_001230524.1| NAD-dependent epimerase/dehydratase [Geobacter uraniireducens Rf4]
 gi|146397318|gb|ABQ25951.1| NAD-dependent epimerase/dehydratase [Geobacter uraniireducens Rf4]
          Length = 291

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 16/288 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G G  GK +A   +  G       RS      L   GI P +    ++++L    L
Sbjct: 4   VLIVGCGDMGKRVAGLVMAEGADVSALVRSAEKGQKLAELGIQPVVGDLDELSSL--ATL 61

Query: 63  YFTTHIVQCIKPSSEG---DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
                +V    P   G   DP + S      +     + + Y+S++ +YG+     V E 
Sbjct: 62  PTRDALVFYFAPPPGGGNMDPRMRSFCASI-EAGNEPRRVVYMSTSGVYGDCGDALVTEE 120

Query: 120 SFVHPISCVATQRFNAE---KEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           +  +P +  A +R++AE    EW    ++  +++ +LR++GIYGP R P  ++   + L 
Sbjct: 121 TPPNPQTARAKRRYDAETVLSEW---GRERGVEVVILRVTGIYGPGRLPITQLANGHPLL 177

Query: 177 LVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
             + +   NRI  ED+AR CV        G IFN+SD             A ++    P 
Sbjct: 178 DERLSPPTNRIHAEDLARVCVAAAEKGDDGDIFNVSDGRVGTMSQYFNAVADILGYPRPR 237

Query: 236 EQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLK 280
           +   + A+  ++P    + ++ +R+ N K +K LG +LLYP     LK
Sbjct: 238 QISLEEAHRVMTPLMLSYISETRRMGNGKMLKKLGIKLLYPTLEEGLK 285


>gi|75909103|ref|YP_323399.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anabaena variabilis
           ATCC 29413]
 gi|75702828|gb|ABA22504.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anabaena variabilis
           ATCC 29413]
          Length = 274

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 131/285 (45%), Gaps = 27/285 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALK----VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINN 56
           M++ I G GY G  IA    +        T  T+  V+ L  + HK +        K+ N
Sbjct: 1   MNIAIIGCGYVGCAIAQHWQQNPHLFITATTTTSERVTALQKVAHKVVLTQGDDLDKLTN 60

Query: 57  LLREKLYFTTHIVQCIKPSSEGD---PCIISMSKDFYKFM---PHVKWIGYLSSTSIYGN 110
           +L+ +      +V     +  GD      ++ +K     +    HVK + Y SS S+YGN
Sbjct: 61  ILQNQ-----DVVLLSVGAKGGDLYEAAYLNTAKTLVSALQQNSHVKQLIYTSSYSVYGN 115

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI- 169
           + G+WVDE +   P+S    +     ++ L     +N+++ +LRL GIYG  R   +KI 
Sbjct: 116 KNGEWVDEETPTMPVSRNG-EILQETEDILLSASSVNLRVCILRLGGIYGAGR-ELVKIF 173

Query: 170 -RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASL 228
            R   + R    +   N I ++D+   + F+  + L GI+NL DD   P + ++    S 
Sbjct: 174 SRVPGTTRPGDGSDTTNWIHLDDIVGAIEFVRNNSLQGIYNLVDDAHLPSRELLDTLLSK 233

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
             +T  +      +N  P+       N ++SN KIK  G+QL++P
Sbjct: 234 YNLTQVIWDEILKSN-RPY-------NAKVSNRKIKEAGYQLIHP 270


>gi|261856823|ref|YP_003264106.1| NAD-dependent epimerase/dehydratase [Halothiobacillus neapolitanus
           c2]
 gi|261837292|gb|ACX97059.1| NAD-dependent epimerase/dehydratase [Halothiobacillus neapolitanus
           c2]
          Length = 301

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 95/189 (50%), Gaps = 12/189 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T++YG++ G WVDEH+  +P      +R +AE  +       ++ L VLRL+G+Y 
Sbjct: 111 YASTTAVYGDQGGAWVDEHTPPNPAHDRGRRRLDAETRFGQWCAAHSVPLTVLRLTGLYA 170

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-----HLGGIFNLSDDEP 215
             R P  +IR    +   +++   NRI  +D+A     L+        + G+FN+SD+ P
Sbjct: 171 CDRLPLERIRAGAPVVCPEESPWSNRIHADDLADIYTRLIARVEQAAPVAGVFNVSDNNP 230

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANI----SPFTRFFYADNKRISNAKIK-SLGFQL 270
            P   + +  A+   +  P   C   A++    SP  R F  ++KRI    I+ +L +Q 
Sbjct: 231 RPMTELYVNTAAHFDL--PAPPCLPLADVLAQSSPMAREFLTESKRIDARAIQLALDWQP 288

Query: 271 LYPNYRISL 279
            YP+   +L
Sbjct: 289 RYPDLATTL 297


>gi|118578739|ref|YP_899989.1| NAD-dependent epimerase/dehydratase [Pelobacter propionicus DSM
           2379]
 gi|118501449|gb|ABK97931.1| NAD-dependent epimerase/dehydratase [Pelobacter propionicus DSM
           2379]
          Length = 291

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 42/292 (14%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL-LREKLY 63
           I G+GY G+ IA  A + G      TRS      L+ +G   F      +N++ L   + 
Sbjct: 6   ITGSGYIGERIARLAREAGSQVTCMTRSAERRDYLQTQG---FDAIAAPLNDITLIPPMD 62

Query: 64  FTTHIVQCIKPSSEGDPCIISMSKDFYKFMP---HVKWIGYLSSTSIYGNREGQWVDEHS 120
               ++  + P   G       +++F + +        I Y+S+TS+Y  ++G  V E S
Sbjct: 63  LDGSVLFYLVPPPGGG-IYDQRARNFLQAVAGSSQPSRIIYMSATSVYTAKDGSMVTEES 121

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P S +  +R +AEK + A   +  I L +LR+SGIYGP R P  +I+Q   L  +++
Sbjct: 122 PALPTSSMGKRRLDAEKAFTAYCAEYGIPLIILRVSGIYGPGRLPLTQIKQGQPLLRLEE 181

Query: 181 NQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSD-----------------DEPAPPQNVI 222
           +   NRI  +D+A+ C+        G IFN+SD                  EP  PQ  +
Sbjct: 182 SGPSNRIHADDLAQICMAAAERGEAGEIFNVSDGNPCSMTEYFNIVADALGEPRQPQVTM 241

Query: 223 MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYP 273
            EA  +M               SP    + ++++ ++ +++ + LG  L YP
Sbjct: 242 EEAHRVM---------------SPLMLSYVSESRVVNPSRMFQRLGITLRYP 278


>gi|218673291|ref|ZP_03522960.1| putative nucleoside-diphosphate-sugar epimerase protein [Rhizobium
           etli GR56]
          Length = 110

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+MIFG GY+G  IA A     V   GTTRS   +  L+  GI  FLF  + ++  L  
Sbjct: 1   MHVMIFGCGYSGTAIAKAFAGQDVRVSGTTRSADKMEGLRAGGIDAFLFDGETMDEDLGR 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
            L   TH+VQ I P  + DP +  + +D  + +P ++WIGYLS+  +YG+
Sbjct: 61  ALESVTHLVQSIAP-GKADPLLRLLGEDSARLLPRLEWIGYLSTVGVYGD 109


>gi|307825774|ref|ZP_07655990.1| Ketopantoate reductase ApbA/PanE domain protein [Methylobacter
           tundripaludum SV96]
 gi|307733082|gb|EFO03943.1| Ketopantoate reductase ApbA/PanE domain protein [Methylobacter
           tundripaludum SV96]
          Length = 280

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 91/195 (46%), Gaps = 19/195 (9%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P   W+  +SSTS+YG   G+W+DE S   P +  +     AE++ L  +   NI   V
Sbjct: 94  LPKTHWL-MVSSTSVYGQSAGEWIDEDSAAEPANITSRLIRQAEQK-LMDSNPANI---V 148

Query: 153 LRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----I 207
           +R SGIYGP R   +++  +            NRI  +D    + FL+   L G      
Sbjct: 149 VRFSGIYGPGREYLLRLALQAPAIQQTPPYFTNRIHQQDCVGVLSFLLEQRLAGRALAQC 208

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           +  SDD+PAP   V+   A  +   PP  +  D              NKR SN ++K+LG
Sbjct: 209 YLASDDDPAPTWEVMTWLADRLHCPPPTVKAVDADA---------GMNKRCSNTRLKALG 259

Query: 268 FQLLYPNYRISLKQL 282
           +Q  YP+Y+    +L
Sbjct: 260 YQFDYPSYKDGYMEL 274


>gi|54298167|ref|YP_124536.1| hypothetical protein lpp2224 [Legionella pneumophila str. Paris]
 gi|53751952|emb|CAH13376.1| hypothetical protein lpp2224 [Legionella pneumophila str. Paris]
          Length = 280

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 119/267 (44%), Gaps = 22/267 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTR------SVSNLLTLKHKGISPFLFADQKI 54
           MH +I G GY G ++A   L+        +R       +S L  + H   SPF +++   
Sbjct: 1   MHHLILGYGYCGYYLAQELLRHHQQVTVVSRQLKKELELSKLQHISHDLESPFHWSEPD- 59

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
                      + I   I P S+G  C   + +   +   + K I Y  S+ +YGN +G 
Sbjct: 60  -----------SIIYYLIPPPSQGT-CDTFLQQFLNQSSLNAKKIIYFGSSGVYGNHQGA 107

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WVDE S     S    +R +AE++WLA  ++ N +L++LR++GIYGP R P    + K  
Sbjct: 108 WVDELSACIIDSPRQQRRLDAEQQWLAYCQQHNKELSLLRIAGIYGPNRIPADAAKSKIP 167

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           +    +    N I V+D++     L        ++N++D  P     +    A+ + I  
Sbjct: 168 IIKPTEAPFTNHIFVKDLSLIAYLLGQKQTTSAVYNVADGNPTHMGELQQTVANALGIES 227

Query: 234 PLEQCFDTA--NISPFTRFFYADNKRI 258
              + F+ A    SP  R F   +KR+
Sbjct: 228 ASYESFEQAWEKASPMKREFMRASKRL 254


>gi|126658083|ref|ZP_01729235.1| hypothetical protein CY0110_05692 [Cyanothece sp. CCY0110]
 gi|126620721|gb|EAZ91438.1| hypothetical protein CY0110_05692 [Cyanothece sp. CCY0110]
          Length = 288

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 132/284 (46%), Gaps = 23/284 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTT---RSVSNLLTLKHKGI----SPFLFADQKIN 55
           + + G GY GK +A    + G Y  GTT     +S+L T+ H+ I          ++ IN
Sbjct: 13  VTVMGCGYVGKAVASYWYEKGYYVTGTTTREEKISDLETITHRSIVMRGDELEAVEKVIN 72

Query: 56  NLLREKLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPH---VKWIGYLSSTSIYGNR 111
           N  +E +  +   +   +  +E      +  +K+    +     VK + YLSS S+YG++
Sbjct: 73  N--QETILVSIAPISDRQVDAEAYAQTYLPTAKNLVTALTSNSTVKQVIYLSSGSVYGDK 130

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI-R 170
           +G+WVDE+S ++  S        AEK  L + +  +I + +LRL GIYGPKR    +I R
Sbjct: 131 KGEWVDENSSLYTESDYNKVLVEAEKIVLELNRD-DINVCLLRLGGIYGPKRELDKRIGR 189

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
               +     +     I ++DV   V F+      G++NL +D     +    E   L+ 
Sbjct: 190 MAGKILPGDGSNYVAWIHLDDVVSAVEFINKKGCHGVYNLVNDVKLTSK----ELCDLIC 245

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
               LE+     +  PF+      N R+ N+KIK  G++ +Y +
Sbjct: 246 DRQQLERVSWDDSKPPFSAL----NARVDNSKIKQEGYKFIYDD 285


>gi|255079348|ref|XP_002503254.1| predicted protein [Micromonas sp. RCC299]
 gi|226518520|gb|ACO64512.1| predicted protein [Micromonas sp. RCC299]
          Length = 339

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 108/222 (48%), Gaps = 31/222 (13%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR--- 59
           +  FG GYT   + +   + G +  GT R  + + +L+  G+   L+   + ++++R   
Sbjct: 69  IFCFGLGYTSLGLINTLKRAGWHVSGTCRDEARVRSLRAAGVHAHLW---RPDDVVRMDA 125

Query: 60  ---EKLYFTTHIVQCIKPSSEGD--------PCIISMSKDFYKFMPHVKWIGYLSSTSIY 108
              + +   TH++    P+++ D         C+ ++++   +   H++W+GYLSST +Y
Sbjct: 126 DGIDAVLGATHVLNSTPPNADFDRDPVLADAACMDALTRAHDRG--HLRWLGYLSSTGVY 183

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
           G   G WVDE S   P S VA +R +AE EW    +  ++ +   RL GIYGP R+    
Sbjct: 184 GEHRGGWVDESSACAPASPVARRRRDAELEW----ETTDLPVVTFRLGGIYGPGRSILDT 239

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNL 210
           + +      + +++     R +  +RC       H+G + N+
Sbjct: 240 VARSAGGEAIGESRRARSAR-KFTSRC-------HVGDVVNV 273


>gi|307611114|emb|CBX00756.1| hypothetical protein LPW_24601 [Legionella pneumophila 130b]
          Length = 280

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 130/288 (45%), Gaps = 17/288 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH +I G GY G ++A   L         +R +   L L            Q I++ L  
Sbjct: 1   MHHLILGYGYCGYYLAQELLGHHQQVTVVSRQLKKELELSKL---------QHISHDLEY 51

Query: 61  KLYFT---THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
             +++   + I   I P S+G  C   + +   +   + K I Y  S+ +YGN +G WVD
Sbjct: 52  PFHWSEPDSIIYYLIPPPSQGT-CDTFLQQFLNQSSLNAKKIIYFGSSGVYGNHQGAWVD 110

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S     S    +R +AE++WLA  ++ N +L++LR++GIYGP R P    + K  +  
Sbjct: 111 ELSACIIDSPRQQRRLDAEQQWLAYCQQHNKELSLLRIAGIYGPNRIPVDAAKSKIPIIK 170

Query: 178 VKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
             +    N I V+D+A     L        ++N++D  P     +    A+ + I     
Sbjct: 171 PTEAPFTNHIFVKDLALIAYLLGQKQTTSAVYNVADGNPTHMGALQQTVANALGIESASY 230

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
           + F+ A    SP  R F   +KR+    +K +LG  + + +   ++KQ
Sbjct: 231 ESFEQAWEKASPMKREFMRASKRLKIDMLKAALGEDIQFTSLHDAVKQ 278


>gi|330972213|gb|EGH72279.1| hypothetical protein PSYAR_17120 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 282

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 127/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  QK        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFETQKPAQWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +     +    LRL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSATEPGNYTGTVMLEAEQ----VALNSGLPATALRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAAGLLEHLLLADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP++R     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWAPMYPDFRAGYAAL 280


>gi|282901982|ref|ZP_06309880.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193069|gb|EFA68068.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 276

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 134/287 (46%), Gaps = 29/287 (10%)

Query: 1   MHLMIFGAGYTGKFIA-----DAALKVGVYTCGTTRSVSNLLTLKH--KGISPFLFADQK 53
           M++ I G GY G  +A     + + +V V    TT S   + TL+     +   +  DQ 
Sbjct: 3   MNVAIIGCGYVGYAVAKFWRQNPSFRVTV----TTTSEHKVSTLQEVADAVEVTMGDDQI 58

Query: 54  -INNLLREKLYFTTHIVQCIKPSSEGDPCIISMSK---DFYKFMPHVKWIGYLSSTSIYG 109
            +N +L+ +      +    K SS  +   +  +K      K+ P +K + Y SS +IYG
Sbjct: 59  FLNRVLKNQDVVLLAV--GAKSSSSYEKTYLETAKTVTSLIKYHPKIKQLIYTSSYAIYG 116

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           +R G WVDE +   P + + +Q     +E L       +++ +LRL GIYGP R   IKI
Sbjct: 117 DRNGVWVDEETPPAPPN-LNSQILGKTEEILLAAATEKLRVCILRLGGIYGPGRE-LIKI 174

Query: 170 --RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAAS 227
             R   + R     ++ N + ++D+ R V F     L GI+NL DD     + +I     
Sbjct: 175 FSRTAGTTREGNGEEITNWVHLDDIVRVVEFARWQRLQGIYNLVDDSHFTSRELI---DG 231

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           ++K        +D  N S  TR +   N  +SN K+K  G+Q ++P+
Sbjct: 232 VLKTHNLPNVIWDATNKS--TRQY---NTWVSNQKLKDAGYQFIHPH 273


>gi|17227976|ref|NP_484524.1| hypothetical protein alr0480 [Nostoc sp. PCC 7120]
 gi|17129825|dbj|BAB72438.1| alr0480 [Nostoc sp. PCC 7120]
          Length = 274

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 135/285 (47%), Gaps = 27/285 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALK----VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINN 56
           M++ I G GY G  IA    +    +   T  T   V++L  + HK +        K+ +
Sbjct: 1   MNIAIIGCGYVGCAIAQHWQQNPHLLVTATTTTPERVTSLQKVAHKVVVTQGDDLDKLTD 60

Query: 57  LLREKLYFTTHIVQCIKPSSEGD---PCIISMSKDFYKFM---PHVKWIGYLSSTSIYGN 110
           +L+ +      IV     +  GD      ++ +K     +    HVK + Y SS S+YGN
Sbjct: 61  ILQNQ-----DIVLLSVGAKGGDLYEAAYLNTAKTLVSALQQNSHVKQLIYTSSYSVYGN 115

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI- 169
           + G+WVDE +   P S    +     ++ L     +N+++ +LRL GIYGP+R   +KI 
Sbjct: 116 KNGEWVDEETPTIPGSRNG-EILQETEDILLSASSVNLRVCILRLGGIYGPRRE-LMKIF 173

Query: 170 -RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASL 228
            R   + R    + V N I ++D+   + F+  + L G++NL DD   P + ++     L
Sbjct: 174 SRVPGTTRPGDGSDVTNWIHLDDIVGAIEFVRNNPLQGVYNLVDDAHLPSRKLL--DTLL 231

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
            K   P +  +D  N +   R +   N ++SN KIK  G+QL+ P
Sbjct: 232 SKYNLP-QVIWD--NTAKSNRPY---NVKVSNRKIKEAGYQLIQP 270


>gi|223936838|ref|ZP_03628747.1| NAD-dependent epimerase/dehydratase [bacterium Ellin514]
 gi|223894407|gb|EEF60859.1| NAD-dependent epimerase/dehydratase [bacterium Ellin514]
          Length = 303

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 122/286 (42%), Gaps = 16/286 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR- 59
           M ++I G GY G  +    ++ G    G  RS      +K  GI        K  +L R 
Sbjct: 1   MRVLILGCGYVGLPLGAELVRQGHEVFGLRRSAEGEAEVKAAGIQSLAGDITKREDLARI 60

Query: 60  -EKLYFTTHIVQCIKPSSEGDPCIISMSK----DFYKFMPHVKWIGYLSSTSIYGNREGQ 114
                +  ++V   K   E    +         D+    P  K++ Y SSTS+YG  +G 
Sbjct: 61  PGPFDWVVNMVSSTKGGVEEYQQVYLQGTRNLIDWLALTPPKKFV-YTSSTSVYGQTDGS 119

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V E S V P S  +      EK  +   +   +   +LR++GIYGP+R    +   KN 
Sbjct: 120 SVKETSPVEPSSETSKVLVETEKVLMEAAQLRKLPAVILRVAGIYGPERGHLFQQYLKNE 179

Query: 175 LRLVKKNQ-VFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIM-EAASLMKI 231
            R+  K + + N I  +D+   +I  + +   G ++N+ DDEP    +     A +L K 
Sbjct: 180 ARIAGKGERIINMIHRDDLVGIIIAALKNGRSGEVYNVVDDEPVTQLHFFQWLAEALGKW 239

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
            PP     + A      R     NK++ N ++K  LG+Q  YP +R
Sbjct: 240 PPPFATEEENA-----ARKRGLTNKKVQNRRLKMELGYQFKYPTFR 280


>gi|53805218|ref|YP_113059.1| hypothetical protein MCA0540 [Methylococcus capsulatus str. Bath]
 gi|53758979|gb|AAU93270.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 313

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 132/287 (45%), Gaps = 16/287 (5%)

Query: 3   LMIFGAGYTGKFIA--DAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           ++I G G  G+ +A  ++A   GVY  G  RS      L  +GI+       K ++L   
Sbjct: 5   VLIVGCGDIGRRVARLESAEGRGVY--GLARSPETAARLVRQGITAVHGDLDKPDSLAGL 62

Query: 61  KLYFTTHIVQCIKPSS-EGDPCIISMSKDFYKFMPHVKWIG---YLSSTSIYGNREGQWV 116
              +TT       P++ +GDP +      F++ +P     G   Y+S++ +YG+  G WV
Sbjct: 63  NGGWTTLYYFAPPPAAGDGDPRLAV----FFEALPVRCLPGKVVYVSTSGVYGDCGGDWV 118

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE     P +  + +R  AE+  +A +++  + + +LR+ GIYGP R P  ++     + 
Sbjct: 119 DEERPPRPQTARSRRRLAAEEALMAWSRRYGVTVVILRVPGIYGPGRLPLERLCAGVPVV 178

Query: 177 LVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
             +++   NRI  +D+A  CV         G++N+SD  P    +     A    +  P 
Sbjct: 179 RQEESPYSNRIHADDLAEVCVAAGTRAAAEGVYNVSDGHPTTLTDYFHAVADHFGLPRPP 238

Query: 236 EQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISL 279
                 A   +SP    F  ++KR+ N + ++ L  +L YP+    L
Sbjct: 239 AISLAEARRVLSPEMLSFVEESKRLDNGRMLRELRPRLHYPDLERGL 285


>gi|292490307|ref|YP_003525746.1| NAD-dependent epimerase/dehydratase [Nitrosococcus halophilus Nc4]
 gi|291578902|gb|ADE13359.1| NAD-dependent epimerase/dehydratase [Nitrosococcus halophilus Nc4]
          Length = 292

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 97/194 (50%), Gaps = 8/194 (4%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           + I Y+S++ +YG+  G WV+E   VHP +  + +R +AE++  A  ++  + L +LR+ 
Sbjct: 98  RRIVYISTSGVYGDCRGAWVNEAFPVHPGNDRSRRRVDAERQLTAFARRHTLPLVILRVP 157

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEP 215
           GIYGP R P  ++RQ N +    +    NRI  +D+A   +     +    I+N+SDD+P
Sbjct: 158 GIYGPGRLPLERLRQGNPVVCPDQAPWNNRIHADDLAAIALRAGQDNAPARIYNVSDDQP 217

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIKS-LGFQL 270
           +   + +   A    +  P   C   A      SP    +  +++R+ N ++K+ LG  L
Sbjct: 218 SSMTDYLYRLADAAGL--PRPPCVSLAEAQRTFSPKLLEYLNESRRLDNRRMKTVLGIGL 275

Query: 271 LYPNYRISLKQLWK 284
            YP     L    K
Sbjct: 276 HYPTLEEGLPATLK 289


>gi|52842483|ref|YP_096282.1| oxidoreductase (NAD-dependent epimerase/dehydratase) [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629594|gb|AAU28335.1| oxidoreductase (NAD-dependent epimerase/dehydratase) [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 280

 Score = 89.4 bits (220), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 130/288 (45%), Gaps = 17/288 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH +I G GY G ++A   L         +R +   L L            Q I++ L  
Sbjct: 1   MHHLILGYGYCGYYLAQELLGHHQQVTVVSRQLKKELELSKL---------QHISHDLEY 51

Query: 61  KLYFT---THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
             +++   + I   I P S+G  C   + +   +   + K I Y  S+ +YGN +G WVD
Sbjct: 52  PFHWSEPDSIIYYLIPPPSQGT-CDTFLQQFLNQSSLNAKKIIYFGSSGVYGNHQGAWVD 110

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S     S    +R +AE++WLA  ++ N +L++LR++GIYGP R P    + K  +  
Sbjct: 111 ELSACIIDSPRQQRRLDAEQQWLAYCQQHNKELSLLRIAGIYGPNRIPADAAKSKIPIIK 170

Query: 178 VKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
             +    N I V+D+A     L        ++N++D  P     +    A+ + I     
Sbjct: 171 PTEAPFTNHIFVKDLALIAYLLGQKQTTSAVYNVADGNPTHMGELQQTVANALGIESASY 230

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQ 281
           + F+ A    SP  R F   +KR+    +K+ LG  + + +   ++KQ
Sbjct: 231 ESFEQAWEKASPMKREFMRASKRLKIDLLKTALGEDIQFTSLYDAVKQ 278


>gi|257481749|ref|ZP_05635790.1| ActC family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331009383|gb|EGH89439.1| ActC family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 282

 Score = 89.4 bits (220), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 129/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFDTRKPALWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQAGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDEDSVTEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWTPMYPDYRAGYAAL 280


>gi|320322262|gb|EFW78358.1| ActC family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331911|gb|EFW87849.1| ActC family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330873187|gb|EGH07336.1| ActC family protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 282

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 129/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFDTRKPALWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDEDSVTEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWTPMYPDYRAGYAAL 280


>gi|71735905|ref|YP_272499.1| ActC family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556458|gb|AAZ35669.1| ActC family protein [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 282

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 129/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFDTRKPALWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSKRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDEDSITEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWTPMYPDYRAGYAAL 280


>gi|330890917|gb|EGH23578.1| ActC family protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 282

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 128/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFDTRKPALWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDEDSVTEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+P          A+L
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   + +    +  S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 ADVVAWIREYLGVSEWSEEVSVQRVGSKRCSNARARALGWTPMYPDYRAGYAAL 280


>gi|330986876|gb|EGH84979.1| ActC family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 282

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 129/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLASRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFDTRKPALWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---MVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDEDSVTEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWTPMYPDYRAGYAAL 280


>gi|302189234|ref|ZP_07265907.1| hypothetical protein Psyrps6_22933 [Pseudomonas syringae pv.
           syringae 642]
          Length = 282

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 127/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  QK        L
Sbjct: 6   LLIAGCGDIGARLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFETQKPAQWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +     +    +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSATEPSNYTGTVMLEAEQ----VALSSGLPATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAAGLLEHLLLADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+Y+     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWSPIYPDYKAGYAAL 280


>gi|222056509|ref|YP_002538871.1| NAD-dependent epimerase/dehydratase [Geobacter sp. FRC-32]
 gi|221565798|gb|ACM21770.1| NAD-dependent epimerase/dehydratase [Geobacter sp. FRC-32]
          Length = 288

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 134/290 (46%), Gaps = 18/290 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRS---VSNLLTLKHKGISPFLFADQKINNL- 57
           +++I G G  GK +A    + G      +R+   +  L TL  +GIS  L     + +L 
Sbjct: 3   NVVIIGCGDIGKRVAAIFKETGATITALSRAEAKMGQLQTLGIRGISGDLDDPASLADLP 62

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDF---YKFMPHVKWIGYLSSTSIYGNREGQ 114
           L++ L +       + P   G     S  ++F    K     + I Y+S++ +YG+    
Sbjct: 63  LKDALVYY------LAPPPGGG-YQDSRMRNFCATIKAENGPRRIIYMSTSGVYGDCGDA 115

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V E +  +P +  A +RF+AE       K+  +++ +LR++GIYGP R P  ++     
Sbjct: 116 VVTEETPPNPQTARAKRRFDAETVLQGWGKEQKVEVIILRVTGIYGPGRLPVTQLASGQP 175

Query: 175 LRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           L     +   NR+   D+AR CV        G IFN+SD +          AA L+    
Sbjct: 176 LLYEHLSPPTNRVHAADLARICVAAADKGEDGDIFNISDGQTGTMTQYFNAAADLLGFPR 235

Query: 234 PLEQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLK 280
           P +   + A+  +SP    + ++ +R+ N K ++ LG +LLYP+    LK
Sbjct: 236 PRQVSHEEAHQVMSPLMLSYISETRRMDNGKMLRKLGVKLLYPSLEDGLK 285


>gi|213970701|ref|ZP_03398826.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301382588|ref|ZP_07231006.1| hypothetical protein PsyrptM_08152 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063045|ref|ZP_07254586.1| hypothetical protein PsyrptK_23914 [Pseudomonas syringae pv. tomato
           K40]
 gi|302133607|ref|ZP_07259597.1| hypothetical protein PsyrptN_19554 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924535|gb|EEB58105.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 282

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 126/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A      G    G  R+VS L      G+   LF  Q+        L
Sbjct: 6   LLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSEL-PAGVIGVEGDLFEAQRPAQWPTAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
               ++V C  PS   +       +   ++   ++       K + ++SS+ +YG ++G+
Sbjct: 65  ---DYVVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQDGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE+S   P     T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDENSATEPGGYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R V      NRI  +D A  +  L+   L G+   S     DD+P          A+L
Sbjct: 178 SVR-VDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   L +       S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 GDVVAWLREYLGVTEWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|148359814|ref|YP_001251021.1| NAD-dependent epimerase/dehydratase [Legionella pneumophila str.
           Corby]
 gi|296107861|ref|YP_003619562.1| oxidoreductase (NAD-dependent epimerase/dehydratase) [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281587|gb|ABQ55675.1| oxidoreductase (NAD-dependent epimerase/dehydratase) [Legionella
           pneumophila str. Corby]
 gi|295649763|gb|ADG25610.1| oxidoreductase (NAD-dependent epimerase/dehydratase) [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 280

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 121/271 (44%), Gaps = 16/271 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH +I G GY G ++A   L         +R +   L L            Q I++ L  
Sbjct: 1   MHHLILGYGYCGYYLAQELLGHHQQVTVVSRQLKKELELS---------KIQHISHDLEY 51

Query: 61  KLYFT---THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
             ++    + I   I PSS+G  C   + +   +   + K I Y  S+ +YGN +G WVD
Sbjct: 52  PFHWNEPDSIIYYLIPPSSQGT-CDTFLQRFLNQSSLNAKKIIYFGSSGVYGNHQGAWVD 110

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S     S    +R +AE++WLA  ++ + +L++LR++GIYGP R P    + K  +  
Sbjct: 111 ELSACIIDSPRQQRRLDAEQQWLAYCQQHSRELSLLRIAGIYGPNRIPVDAAKSKIPIIK 170

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
             +    N I V+D+A     L        ++N++D  P     +    A+ + I     
Sbjct: 171 PTEAPFTNHIFVKDLALIAYLLGQKQTPSAVYNVADGNPTHMGELQQTVANALGIESASY 230

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKIKS 265
           + F+ A    SP  R F   +KR+    +K+
Sbjct: 231 ESFEQAWEKASPMKREFMRASKRLKIDMLKA 261


>gi|189423449|ref|YP_001950626.1| NAD-dependent epimerase/dehydratase [Geobacter lovleyi SZ]
 gi|189419708|gb|ACD94106.1| NAD-dependent epimerase/dehydratase [Geobacter lovleyi SZ]
          Length = 287

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 125/285 (43%), Gaps = 21/285 (7%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L I G GYTG  +A+ AL  G       R       L   G    L +  + +++ R  
Sbjct: 3   QLFIAGCGYTGSLVANLALAQGWSVAVHLRDQEKAAALTRAGAEVCLCSMDERDDIPRLP 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKW----IGYLSSTSIYGNREGQWVD 117
           L     ++  + P   G   I   +++F   +   +     I YLS+TS+YG+  G  V 
Sbjct: 63  LD-GRMLLYSVPPQGGGS--IDLRARNFCAALERDQTFPSKIVYLSATSVYGDTGGAVVT 119

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S   P S +  +R +AE+ +     K  I + +LR+S IYG  R P ++I Q   L  
Sbjct: 120 EQSPTEPASAMGKRRLDAEQLFQDFCLKHGIPVVILRVSAIYGKGRLPLMQINQGQPLLR 179

Query: 178 VKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA-SLMKITPPL 235
            +  +  NRI ++D+AR C+  L+     GI+N+SD  PA         A +L K   P 
Sbjct: 180 EELARPSNRIHIDDLARVCLSALLKGT--GIYNVSDGHPASMTAYFNACADALQKPRQPQ 237

Query: 236 EQCFDTANISPFTRFFY------ADNKRISNAKIKSLGFQLLYPN 274
               +   + P   F Y       DN+R+    ++ L   L YP+
Sbjct: 238 IDLEEARRVMPPLLFNYFMESRVVDNRRM----LEDLDISLRYPD 278


>gi|66043476|ref|YP_233317.1| hypothetical protein Psyr_0206 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254183|gb|AAY35279.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 282

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 127/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF  QK        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFETQKPAQWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +     +    +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSATEPGNYTGTVMLEAEQ----VALNSGLPATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAAGLLEHLLLADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP++R     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWAPMYPDFRAGYAAL 280


>gi|283781688|ref|YP_003372443.1| NAD-dependent epimerase/dehydratase [Pirellula staleyi DSM 6068]
 gi|283440141|gb|ADB18583.1| NAD-dependent epimerase/dehydratase [Pirellula staleyi DSM 6068]
          Length = 297

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 132/309 (42%), Gaps = 42/309 (13%)

Query: 1   MHLMIFGAGYTGKFIAD---------AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFAD 51
           M  +IFG GY G  IA+          A    +Y    TRS      L+ +G+ P     
Sbjct: 1   MAKIIFGLGYLGLRIAEQWIRRSQPQEATSERIYAV--TRSPEKGALLEQRGLCPV---- 54

Query: 52  QKINNLLREKLYFTTHIVQCI------KPSSE--GDPCIISMSKDFYKFMPHVKWIGYLS 103
             + ++  EKL     I   +      + SS+  G+    S           V+ + Y+S
Sbjct: 55  --VGDIAAEKLPLDAGISTAVIAIGYDRGSSQPIGEVYARSAQNIVDSLSDSVERVIYIS 112

Query: 104 STSIYGNREGQWVDEHSFVHPI-----SCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           ST ++G   G+WV E +   P+     +C+A        E +    +L+ ++ +LRL+GI
Sbjct: 113 STGVFGRASGEWVSEETPAEPLREGGKACLAA-------ENILRQSRLSERVTILRLAGI 165

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAP 217
           YGP R P               +   N I V+D A  V+ +    +GG +F +SD  P  
Sbjct: 166 YGPDRIPRRADLAAGRAIDAAPDGYLNLIHVDDAASIVLAVDDQKMGGELFLVSDGSPTL 225

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYR 276
            ++   E A ++   PP    F T  I        A +KRISNAK+ + L   L YP+Y+
Sbjct: 226 RRDYYAELARIVGGPPP---QFATPAIGSPAAARAASDKRISNAKLMAQLKPVLAYPSYQ 282

Query: 277 ISLKQLWKE 285
             L  + +E
Sbjct: 283 EGLAAIVRE 291


>gi|307150275|ref|YP_003885659.1| NADP oxidoreductase coenzyme F420-dependent [Cyanothece sp. PCC
           7822]
 gi|306980503|gb|ADN12384.1| NADP oxidoreductase coenzyme F420-dependent [Cyanothece sp. PCC
           7822]
          Length = 275

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 130/285 (45%), Gaps = 26/285 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + I G GY G  IA      G     TT +   +  L++ G+   LF     + L   
Sbjct: 1   MKIAIIGCGYVGSVIASIWTACGHEVTATTTTPEKIPDLENLGLRVVLFKGDNPDTL--A 58

Query: 61  KLYFTTHI----VQCIKPSSEG-DPCIISMSKDFYKFMPH---VKWIGYLSSTSIYGNRE 112
           ++   T +    V     S+EG     +  +K+    +     VK + Y +S ++ GN++
Sbjct: 59  QVTADTEVILLSVAARNRSAEGYRETYLKTAKNLVMALKENQTVKQVIYTASYAVLGNKQ 118

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ- 171
           G W+DE + V PI+         E+  L+  ++  +KL +LRL+GIYGPKR      R  
Sbjct: 119 GAWIDETTAVAPINENGEALLETEQALLSGLQE-PLKLCILRLAGIYGPKRELINIFRSW 177

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNV---IMEAASL 228
             + R        N + ++D+   +  +    L GI++L+DD P   +     + +A  L
Sbjct: 178 AGTTRPGNGEDYTNWVHLDDIVGAIKLIQEKQLEGIYHLADDTPMIRREFYRRLFDAHGL 237

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
             I       +D++    +TR +   N R+SN K+K+ G +L++P
Sbjct: 238 PLIN------WDSSQ--SYTRAY---NLRLSNKKLKAAGLELIHP 271


>gi|152982317|ref|YP_001352375.1| hypothetical protein mma_0685 [Janthinobacterium sp. Marseille]
 gi|151282394|gb|ABR90804.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 301

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 131/277 (47%), Gaps = 12/277 (4%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L+I G G  G  +    L+        T  VS    L+  G  P + +  +   L R  
Sbjct: 14  RLLILGCGDVGMRLL-PLLRDRFRIFAVTTQVSRQEELRAAGAIPIIASLDEPATLARLA 72

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              + +I+    P SEG   I   +++    +P    + Y+S++ +YG+  G+W+ E   
Sbjct: 73  -RLSPYIIHLAPPQSEG--SIDKRTRNLTAILPDHATLVYVSTSGVYGDCGGEWITETRA 129

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V+P +  A +R +AE+      ++ + +L +LR+ GIY   R P  ++ QK    L++  
Sbjct: 130 VNPRNLRARRRVDAEQVLRKWARRASGRLGILRVPGIYADDRLPLERL-QKGLPALLEAE 188

Query: 182 QVF-NRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQ---NVIMEAASLMKITPPLE 236
            V+ N I  +D+AR ++  L     G +++  DD         + + +A +L +  P L 
Sbjct: 189 DVYTNHIHADDLARIIVLALFRAQSGRVYHAVDDTDLKMGAYFDAVADALALPR-PPRLP 247

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
           +      +SP    F ++++R+SN +IK+ LG +L Y
Sbjct: 248 RAELEREVSPMMLSFMSESRRLSNQRIKAELGVRLRY 284


>gi|78222043|ref|YP_383790.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Geobacter
           metallireducens GS-15]
 gi|78193298|gb|ABB31065.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Geobacter
           metallireducens GS-15]
          Length = 299

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 121/285 (42%), Gaps = 8/285 (2%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G  GK +A  A+  GV      RS  +   L   GI           +L    
Sbjct: 12  QVFIVGCGDIGKRVARLAMDKGVAVTALVRSEESAAKLHELGIETVEGHLDDPESLAGLP 71

Query: 62  LYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
           L   T +     P   G  +P + +            + + YLS++ +YG+     V E 
Sbjct: 72  LRGAT-VFYFAPPPGGGITEPRVRAFCAAVRPGDEPAQVV-YLSTSGVYGDCGDMIVTED 129

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +  +P +  A +R++AE  + A  K+  + + VLR++GIYGP R P  ++     +    
Sbjct: 130 TPANPQTARAKRRYDAETVFRAWGKERGVPIVVLRVTGIYGPGRLPLQQLTSGQPVLFES 189

Query: 180 KNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
           +    NRI  ED+AR C+        G IFN+SD  P          A  +    P +  
Sbjct: 190 EASYTNRIHSEDLARVCMAAAEKGEDGDIFNVSDGNPGTMTEYFNACADALGFPRPRQVT 249

Query: 239 FDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLK 280
            + A   ++P    +  +++R+ NAK +  L  +LLYP  +  LK
Sbjct: 250 MEEAKKVMTPLMLSYVTESRRMDNAKMVGKLEVKLLYPTLQDGLK 294


>gi|28867310|ref|NP_789929.1| hypothetical protein PSPTO_0070 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28850544|gb|AAO53624.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 282

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A      G    G  R+VS L      G+   LF  Q+        L
Sbjct: 6   LLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSEL-PAGVIGVEGDLFEAQRPAQWPTAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDETGYRMAYVEGLRNVLSWLEQTGQQPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE+S   P     T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDENSATEPGGYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R V      NRI  +D A  +  L+   L G+   S     DD+P          A+L
Sbjct: 178 SVR-VDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   L +       S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 ADVVAWLREYLGVTEWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|330964245|gb|EGH64505.1| hypothetical protein PSYAC_06265 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 282

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A      G    G  R+VS L      G+   LF  Q+        L
Sbjct: 6   LLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSEL-PAGVIGVEGDLFEAQRPAQWPTAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
               ++V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  ---DYVVYCATPSQRDEAGYRMAYVEGLRNVLNWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE+S   P     T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDENSATEPGGYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R V      NRI  +D A  +  L+   L G+   S     DD+P          A+L
Sbjct: 178 SVR-VDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   L +       S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 ADVVAWLREYLGVTEWSEDISVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|331018569|gb|EGH98625.1| hypothetical protein PLA106_21248 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 282

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A      G    G  R+VS L      G+   LF  Q+        L
Sbjct: 6   LLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSEL-PAGVIGVEGDLFEAQRPAQWPTAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
               ++V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  ---DYVVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE+S   P     T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDENSATEPGGYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R V      NRI  +D A  +  L+   L G+   S     DD+P          A+L
Sbjct: 178 SVR-VDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   L +       S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 GDVVAWLREYLGVTEWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|330957282|gb|EGH57542.1| hypothetical protein PMA4326_01747 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 282

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 127/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   +  G    G  R+VS L      G+   LF  +K        L
Sbjct: 6   LLIAGCGDIGSRLAIRLMSDGWAVHGLRRTVSELPD-GVTGVEGDLFRAEKPEQWPTAPL 64

Query: 63  YFTTHIVQCIKPSSEGDPCI-ISMSKDFYKFMPHVKWIG-------YLSSTSIYGNREGQ 114
            +   +V C  PS   +    ++  +     +  +K  G       ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDETGYRMAYVEGLRNVLGRLKQSGQRPKRVIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE+S   P S   T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDENSTTEPGSYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAASLLAHLLQADHRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T            S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVT----------EWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|26991981|ref|NP_747406.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida KT2440]
 gi|24987112|gb|AAN70870.1|AE016731_5 epimerase/dehydratase-related protein [Pseudomonas putida KT2440]
          Length = 285

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 130/295 (44%), Gaps = 43/295 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLL 58
           + +M+ G G  G  +A   L  G    G  RSV  L      G+ P     A+  I    
Sbjct: 4   LSVMVVGCGDVGGRLAKQMLAKGWQVSGLRRSVGQL----PAGVQPVAADLAEPSIPQAW 59

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG----------YLSSTSIY 108
            +      ++V C+  S   +    +   D  + +  + W+           ++SS+S+Y
Sbjct: 60  PQGP--LDYLVYCVAASQHDEAGYQAAYVDGLRHV--LAWLAERGQRPRRLLFVSSSSVY 115

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
             + G+W++E +   P     + R   E E LA+     I  +V+RL+GIYGP R   + 
Sbjct: 116 AQKGGEWIEEGAATEPEGY--SGRVMLEAERLALAS--GIPASVVRLTGIYGPGREWLLS 171

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+ ++  ++ NRI  ED A  + FL+     G      +   DD+PAP  +V
Sbjct: 172 QVRQ--GYRVAEEPPLYGNRIHAEDAASLLAFLLQADADGKALDDCYIGVDDDPAPLADV 229

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           +    + M +T            S   R     +KR SNA+ ++LG+  +YP+Y+
Sbjct: 230 VAWLRAYMGVT----------EWSDEQRVRRTGSKRCSNARARALGWAPVYPSYK 274


>gi|289625453|ref|ZP_06458407.1| ActC family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646379|ref|ZP_06477722.1| ActC family protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298484815|ref|ZP_07002915.1| nucleoside-diphosphate-sugar epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160669|gb|EFI01690.1| nucleoside-diphosphate-sugar epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866520|gb|EGH01229.1| ActC family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 282

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 131/297 (44%), Gaps = 39/297 (13%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF      +  +  L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLF------DTCKPAL 58

Query: 63  YFTT---HIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNR 111
           + T    ++V C  PS   +       +   ++   ++       K + ++SS+ +YG +
Sbjct: 59  WPTAALDYVVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQ 118

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIR 170
            G+WVDE S   P +   T    AE+  LA+   L      +RL+GIYGP R+    ++R
Sbjct: 119 NGEWVDEDSVTEPANYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVR 174

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEPAPPQNVIMEA 225
           Q +S+R +      NRI  +D A  +  L+     G+     +   DD+PA   +V+   
Sbjct: 175 QGHSVR-IDPPVYANRIHADDAASLLEHLLQADQRGVALENCYLGVDDDPAALADVVAWI 233

Query: 226 ASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
              + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 234 REYLGVTEWSEE----------VSVQRVGSKRCSNARARALGWVPVYPDYRAGYAAL 280


>gi|54295116|ref|YP_127531.1| hypothetical protein lpl2196 [Legionella pneumophila str. Lens]
 gi|53754948|emb|CAH16436.1| hypothetical protein lpl2196 [Legionella pneumophila str. Lens]
          Length = 280

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 129/288 (44%), Gaps = 17/288 (5%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH +I G GY G ++A   L         +R +   L L            Q I++ L  
Sbjct: 1   MHHLILGYGYCGYYLAQELLGHHQQVTVVSRQLKKELELSKL---------QHISHDLEY 51

Query: 61  KLYFT---THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
             +++   + I   I P S+G  C   + +   +   + K I Y  S+ +YGN +G WVD
Sbjct: 52  PFHWSEPDSIIYYLIPPPSQGT-CDTFLQQFLNQSSLNAKKIIYFGSSGVYGNHQGAWVD 110

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S     S    +R +AE++WLA  ++ N +L++LR++GIYGP R P    + K  +  
Sbjct: 111 ELSACIIDSPRQQRRLDAEQQWLAYCQQHNKELSLLRIAGIYGPNRIPVDAAKSKIPIIK 170

Query: 178 VKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
             +    N I V+D+A     L        ++N++D  P     +    A+ + I     
Sbjct: 171 PTEAPFTNHIFVKDLALIAYLLGQKQTTSAVYNVADGNPTHMGALQQTVANALGIELASY 230

Query: 237 QCFDTA--NISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
           + F  A    SP  R F   +KR+    +K +LG  + + +   ++KQ
Sbjct: 231 ESFAQAWEKASPMKREFMRASKRLKIDMLKAALGEDIQFTSLYDAVKQ 278


>gi|167036339|ref|YP_001671570.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida GB-1]
 gi|166862827|gb|ABZ01235.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida GB-1]
          Length = 289

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 130/295 (44%), Gaps = 43/295 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLL 58
           + +M+ G G  G  +A   L  G    G  RSV  L      G+ P     A+  I    
Sbjct: 4   LSVMVVGCGDVGGRLALQMLAKGWQVSGLRRSVEQL----PAGVQPVAADLAEPSIPQAW 59

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG----------YLSSTSIY 108
            +      ++V C+  S   +    +   D  + +  + W+           ++SS+S+Y
Sbjct: 60  PQGP--LDYLVYCVAASQHDEAGYQAAYVDGLRHV--LAWLVERGQRPRRLLFVSSSSVY 115

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
             ++G+W++E +   P          AE+    + +   I  +V+RL+GIYGP R   + 
Sbjct: 116 AQKDGEWIEEGAATEPEGYSGRVMLEAEQ----LARASGIPASVVRLTGIYGPGREWLLS 171

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEPAPPQNV 221
           ++RQ    R+ ++  ++ NRI  ED A  + FL+     G+     +   DD+PAP  +V
Sbjct: 172 QVRQ--GYRVAEEPPLYGNRIHAEDAASLLAFLLQADADGMALDECYIGVDDDPAPLADV 229

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           +    + M +T            S   R     +KR SNA+ ++LG+  +YP+Y+
Sbjct: 230 VAWLRAYMGVT----------EWSDEQRVRRTGSKRCSNARARALGWAPVYPSYK 274


>gi|330876513|gb|EGH10662.1| hypothetical protein PSYMP_14409 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 282

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 124/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A      G    G  R+VS L      G+   LF  Q+        L
Sbjct: 6   LLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSELPP-GVIGVEGDLFEAQRPAQWPTAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
               ++V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  ---DYVVYCATPSQRDEAGYRMAYVEGLRNVLNWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P     T    AE+  LA+   L      +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDESSATEPGGYTGTVMLEAEQ--LALNSGL--PATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R V      NRI  +D A  +  L+   L G+   S     DD+P          A+L
Sbjct: 178 SVR-VDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDDP----------AAL 226

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +   L +       S         +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 227 ADVVAWLREYLGVTEWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|170077539|ref|YP_001734177.1| NAD dependent epimerase/dehydratase family protein [Synechococcus
           sp. PCC 7002]
 gi|169885208|gb|ACA98921.1| NAD dependent epimerase/dehydratase family protein [Synechococcus
           sp. PCC 7002]
          Length = 275

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 125/289 (43%), Gaps = 26/289 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVG---VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL 57
           M + I G GY G+ IA      G     T  T   VS L  + H+     L  DQ     
Sbjct: 1   MKIAIIGCGYVGQAIAKQWTTAGHQVTVTTTTPEKVSQLQGIAHQ--VKVLSGDQP--EA 56

Query: 58  LREKLYFTTHIVQCI--KPSSEGD--PCIISMSKDFYKFMPH---VKWIGYLSSTSIYGN 110
           L+E       I+  +  K  +E +     +  +++  + + H   VK + Y SS +I GN
Sbjct: 57  LQELCEGQDVILLAVGSKGRTEANYRQAYLKTAQNLAQALTHNDTVKQVIYTSSYAIVGN 116

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
             G WVDE +   P    A      E+   AI      ++ +LRL GIYG  R    KI 
Sbjct: 117 HHGAWVDEKTPDKPPHVFAEILLATEQTLKAIATDAR-QVCILRLGGIYGEGRE-IKKIF 174

Query: 171 QK--NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASL 228
           Q+    +R    ++  N I + D+   + F   H+L G+FNL  DEP P + ++   A  
Sbjct: 175 QRAMGQVRPGDGSEYGNWIHLADIVAAIEFAQIHNLNGLFNLVCDEPLPRRELLSRLAEK 234

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
             + P     +D +   P  R     N R+SN K+K+LGF   +P   +
Sbjct: 235 YALAPVR---WDASQ--PSDRPL---NVRVSNQKLKNLGFTFRHPTIEV 275


>gi|300312622|ref|YP_003776714.1| nucleoside-diphosphate-sugar epimerase [Herbaspirillum seropedicae
           SmR1]
 gi|300075407|gb|ADJ64806.1| nucleoside-diphosphate-sugar epimerase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 293

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 120/253 (47%), Gaps = 14/253 (5%)

Query: 39  LKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKW 98
           L+  G  P + AD    + L         IV    P SEG   I   +++    +P    
Sbjct: 44  LRAAGAVP-IVADLDAPHTLGRLARLAPTIVHLAPPQSEGR--IDRRTRNLAAILPEGAR 100

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           + Y+S+T +YG+  G   DE   V+P +  A +R +AE    A  ++ + KL++LR+ GI
Sbjct: 101 LVYISTTGVYGDCAGASFDETRRVNPQNTRAVRRVDAETVLRAWARRRHGKLSILRVPGI 160

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG---IFNLSDDEP 215
           Y   R P  ++ +     L +++   N I  +D+AR  + L    LG    +++  DD  
Sbjct: 161 YAADRLPLERLHKGLPALLAQEDVHTNHIHADDLAR--VSLAALRLGAPNRLYHAVDDTE 218

Query: 216 APPQ---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLL 271
                  + + +AA L +  P L +     ++SP    F ++++R+ N +IK  LG +L 
Sbjct: 219 LKMGDYFDAVADAAGLAR-PPRLPRAELERSVSPMMLSFMSESRRLQNRRIKEELGVRLR 277

Query: 272 YPNYRISLKQLWK 284
           YP+ + SL   WK
Sbjct: 278 YPDVQ-SLLSEWK 289


>gi|119509718|ref|ZP_01628863.1| hypothetical protein N9414_00175 [Nodularia spumigena CCY9414]
 gi|119465584|gb|EAW46476.1| hypothetical protein N9414_00175 [Nodularia spumigena CCY9414]
          Length = 274

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 132/286 (46%), Gaps = 29/286 (10%)

Query: 1   MHLMIFGAGYTGKFIAD-----AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN 55
           M++ I G GY G  +A+       L +   T    R +  L +L  K +       +++ 
Sbjct: 1   MNIAIIGCGYVGCAVAEFWQQKMTLMITATTTNPER-IPTLQSLAQKVVVTQGNDREQLK 59

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH---VKWIGYLSSTSIYGNRE 112
           ++L+ +      I    K ++  +   ++ +K   + +P    +K + Y  S S+YG++ 
Sbjct: 60  SVLQNQDIVLLSI--GAKGANVYEETYLNTAKTLVEILPDIPSIKQLIYTGSYSVYGDQN 117

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI--R 170
           G WVDE +   P S    +   A ++ L       +++ +LRL GIYGP R   +KI  R
Sbjct: 118 GAWVDEQTLAKP-SHDNGKILKATEDVLLAASSDKLRVCILRLGGIYGPNRE-LMKIFSR 175

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNV---IMEAAS 227
              + R     +  N I ++D+   + F+  HHL GI+NL DD     + +   ++E   
Sbjct: 176 VPGTTRPGNGEEAANWIHLDDIVGAIEFVRQHHLQGIYNLVDDAYLTTRQLLDSLLEKHD 235

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           L K+       +D  N     R +   N R+SN KIK  G++L++P
Sbjct: 236 LPKVK------WD--NTLKNNRSY---NTRVSNQKIKEAGYKLIHP 270


>gi|148550414|ref|YP_001270516.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida F1]
 gi|148514472|gb|ABQ81332.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida F1]
          Length = 285

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 129/295 (43%), Gaps = 43/295 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLL 58
           + +M+ G G  G  +A   L  G    G  RSV  L      G+ P     A+  I    
Sbjct: 4   LSVMVVGCGDVGGRLAKQMLAKGWQVSGLRRSVGQL----PAGVQPVAADLAEPSIPQSW 59

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG----------YLSSTSIY 108
            +      ++V C+  S   +    +   D  + +  + W+           ++SS+S+Y
Sbjct: 60  PQGP--LDYLVYCVAASQHDEAGYQAAYVDGLRHV--LAWLAERGQRPRRLLFISSSSVY 115

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
             + G+W++E +   P     + R   E E LA+     I  +V+RL+GIYGP R   + 
Sbjct: 116 AQKGGEWIEEGAATEPEGY--SGRVMLEAERLALAS--GIPASVVRLTGIYGPGREWLLS 171

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+ ++  ++ NRI  ED A  + FL+     G      +   DD+PAP  +V
Sbjct: 172 QVRQ--GYRVAEEPPLYGNRIHAEDAASLLAFLLQADADGKALDDCYIGVDDDPAPLADV 229

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           +    + M +T            S   R     +KR SNA+ ++LG+   YP+Y+
Sbjct: 230 VAWLRAYMGVT----------EWSDEQRVRRTGSKRCSNARARALGWAPEYPSYK 274


>gi|189218819|ref|YP_001939460.1| nucleoside-diphosphate-sugar epimerase [Methylacidiphilum
           infernorum V4]
 gi|189185677|gb|ACD82862.1| Nucleoside-diphosphate-sugar epimerase [Methylacidiphilum
           infernorum V4]
          Length = 279

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 126/279 (45%), Gaps = 19/279 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           + ++I G GY G+ +A           G  ++  + + L+ +GI P + AD   N   R 
Sbjct: 3   LPVVIIGCGYIGRILALRLKSQQKAVMGIVKTEESRINLEKQGI-PAIAADITDNRFPRV 61

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYL--SSTSIYGNREGQWVDE 118
               +  +       SE        S    + +   K I  L  SSTS+Y   EG+WV+E
Sbjct: 62  LPPASALVFSASSNRSEAGLFGKIFSIGLDQVLESAKGIPLLLVSSTSVYSQVEGEWVNE 121

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            S   P +        AE+      K L     VLR SGIYGP+R   I    +  +R+ 
Sbjct: 122 DSPAIPTTPSGVILKQAEQ------KVLERGGTVLRASGIYGPQRAYRITGLVERRVRID 175

Query: 179 KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT-PPLEQ 237
            + +  N++   D+AR +   +T  + G+FN+SDD P   ++        + +  PPL Q
Sbjct: 176 PRKKWINQVHGFDLARAIEHFLT--VPGLFNISDDLPTLEEDFYSWLCQNLNVPFPPLGQ 233

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                   P  +  Y+ NKRISN K KS+GF+L +P ++
Sbjct: 234 K------PPHPKRGYS-NKRISNKKAKSMGFRLDFPTFK 265


>gi|87307256|ref|ZP_01089401.1| hypothetical protein DSM3645_17075 [Blastopirellula marina DSM
           3645]
 gi|87289996|gb|EAQ81885.1| hypothetical protein DSM3645_17075 [Blastopirellula marina DSM
           3645]
          Length = 291

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 111/285 (38%), Gaps = 11/285 (3%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           +IFG GY G  +A    K G      TRS          G+ P + AD    + L +   
Sbjct: 9   LIFGCGYVGLRVAQRWRKQGDVVFAVTRSADTAAQFAADGLQP-IIADVTDEDSLGDLPA 67

Query: 64  FTTHIVQCIKPSSEGDPC----IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEH 119
             T +       + G P     +  ++K       H   + Y+SST ++G+  GQ VDE 
Sbjct: 68  VDTVLFAVGYDRTAGKPIEDVYVAGLAKVLDHLPSHCGRLIYISSTGVFGDAAGQVVDEQ 127

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +   P          AE E L        K   LRL+GIYGP R P  K           
Sbjct: 128 TPCDPRRSGGKACLAAE-ELLRSHPSWQAKHVSLRLAGIYGPGRIPRAKEIAAQIAIPAP 186

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
                N I V+D A  V+   TH     ++ +SD  P        + A  +    P+   
Sbjct: 187 GAGALNLIHVDDAAETVLLAATHPAPQSLYIISDGHPVERTEYYAQIARSLNAPDPV--- 243

Query: 239 FDTANISPFTRFFYADNKRISNA-KIKSLGFQLLYPNYRISLKQL 282
           ++ A+         A N+R+SNA  ++ LG    YP+YR  L  +
Sbjct: 244 YEAADPQSPAALRAATNRRMSNALAVEHLGLTPQYPDYRAGLAAI 288


>gi|104784346|ref|YP_610844.1| hypothetical protein PSEEN5450 [Pseudomonas entomophila L48]
 gi|95113333|emb|CAK18061.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 285

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 130/293 (44%), Gaps = 45/293 (15%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLLREK 61
           +I G G  G  +A   L  G    G  RSV  L      G+ P     AD++  +   E+
Sbjct: 7   LIVGCGDVGSRLARQLLAQGWQVSGLRRSVGQL----PAGVRPIAADLADRRQPDAWPER 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIYGN 110
                ++V C+  S   +         + + + HV  W+           ++SS+S+Y  
Sbjct: 63  --APDYLVYCVAASQHDE---AGYQAAYVEGLRHVLGWLERSGQQPRRLLFVSSSSVYAQ 117

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KI 169
           ++G+W+DE +   P          AE+  LA+     I  +++RL+GIYGP R   + ++
Sbjct: 118 QDGEWIDETASTAPEGYSGKVMLQAER--LALES--GIPASIVRLTGIYGPGREWLLSQV 173

Query: 170 RQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEPAPPQNVIM 223
           RQ    R+ ++  ++ NRI  ED A  +  L+   + G+     +   DD+PAP  +V+ 
Sbjct: 174 RQ--GYRVAEEPPLYGNRIHAEDAASLLAHLLQADVQGVVLDDCYIGVDDDPAPLADVVA 231

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                + +T            S   R     +KR SNA+ ++LG+   YP+Y+
Sbjct: 232 WLREYLGVT----------EWSDEQRVRRTGSKRCSNARARALGWVPQYPSYK 274


>gi|313501279|gb|ADR62645.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida BIRD-1]
          Length = 285

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 129/295 (43%), Gaps = 43/295 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLL 58
           + +M+ G G  G  +A   L  G    G  RSV  L      G+ P     A+  +    
Sbjct: 4   LSVMVVGCGDVGGRLAKQMLAKGWQVSGLRRSVDQL----PAGVQPVAADLAEPSMPQAW 59

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG----------YLSSTSIY 108
            +      ++V C+  S   +    +   D  + +  + W+           ++SS+S+Y
Sbjct: 60  PQGA--LDYLVYCVAASQHDEAGYEAAYVDGLRHV--LAWLAERGQRPRRLLFVSSSSVY 115

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
             ++G+W+ E +   P     + R   E E LA+     I  +V+RL+GIYGP R   + 
Sbjct: 116 AQKDGEWIAEGAATEPEGY--SGRVMLEAERLALAS--GIPASVVRLTGIYGPGREWLLS 171

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+ ++  ++ NRI  ED A  + FL+     G      +   DD+PAP  +V
Sbjct: 172 QVRQ--GYRVAEEPPLYGNRIHAEDAASLLAFLLQADADGKALDDCYIGVDDDPAPLADV 229

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           +    + M +T            S   R     +KR SNA+ ++LG+   YP+Y+
Sbjct: 230 VAWLRAYMGVT----------EWSDEQRVRRTGSKRCSNARARALGWAPEYPSYK 274


>gi|113478236|ref|YP_724297.1| NAD-dependent epimerase/dehydratase [Trichodesmium erythraeum
           IMS101]
 gi|110169284|gb|ABG53824.1| NAD-dependent epimerase/dehydratase [Trichodesmium erythraeum
           IMS101]
          Length = 273

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 95/185 (51%), Gaps = 12/185 (6%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K  P VK I Y  S S+YG++ G+WVDE+S V P +         E+  L+ +     ++
Sbjct: 95  KKTPTVKQIIYTGSYSVYGDKNGEWVDENSSVTPATEGGKILHETEQVLLSASTPQQ-RV 153

Query: 151 AVLRLSGIYGPKRNPFIKI--RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIF 208
            +LRL GIYGP R   +KI  R +   R    N V N I ++D+   + F     L GI+
Sbjct: 154 CILRLGGIYGPGRE-LVKIFSRWEGQTRPGSGNDVTNWIHLDDIVEALEFAKKKQLQGIY 212

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
           NL ++ P   + ++     L K     +  +D +  S  TR F   N R+SN K+++ GF
Sbjct: 213 NLVNNVPMISRELL---DGLHKYQGLGQIYWDDSTFS--TRPF---NARVSNQKLRNEGF 264

Query: 269 QLLYP 273
           +L++P
Sbjct: 265 ELVHP 269


>gi|213400936|gb|ACJ47116.1| hypothetical protein [Wolbachia endosymbiont of Coptotermes
           acinaciformis]
          Length = 136

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 82/148 (55%), Gaps = 15/148 (10%)

Query: 38  TLKHKGI-SPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV 96
           T +++GI S  LF   +++   ++ L   THI+  I P  +GD  +    + +  +  +V
Sbjct: 1   TSRNQGIRSVSLFNHNEVD---KDTLQDVTHILISIPP--DGDDVL----ERYGHYFQNV 51

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           KW+G+LS+TS+YG+  G WV E S   P+      R  +EK+WL      N+ + V RL+
Sbjct: 52  KWLGHLSATSVYGDHAGNWVTEESETRPVENRGENRLRSEKKWL----NSNLPVHVFRLA 107

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVF 184
           GIYGP RN  + + Q N +R V+K   F
Sbjct: 108 GIYGPGRNVLVDL-QLNKVRNVRKEGHF 134


>gi|291333923|gb|ADD93602.1| NAD dependent epimerase/dehydratase [uncultured marine bacterium
           MedDCM-OCT-S04-C40]
          Length = 278

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 128/297 (43%), Gaps = 36/297 (12%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M +++ G GY G  +A A  ++G    GT RS           ++P        N+   E
Sbjct: 1   MRILVIGCGYVGLPLAQALARMGHQVHGTRRS-----DFPTTDVTPHALDVTDPNSF--E 53

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG-------YLSSTSIYGNRE 112
            +     ++     SS GD  +      F     H+  W+G       + SSTS+Y   +
Sbjct: 54  AIPQDFDVIYYTPSSSRGDASVHQAV--FVDGTTHLLNWLGDTATRLIFTSSTSVYPQTD 111

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLA-VLRLSGIYGPKRNPFIKIRQ 171
           G WVDE +     +  A     AE  +     + + +LA +LR++GIYGP+R    +   
Sbjct: 112 GNWVDETANHDGATGTAINLLQAETLF-----QESPQLATILRVAGIYGPERGYLYRQFL 166

Query: 172 KNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIME--AASL 228
           K+   + +    + N I  +DV   ++  + +   GI+N SDDEP   Q    E  A  L
Sbjct: 167 KDEAVITQGGSRWINMIHRDDVVSALVTAL-NIPPGIYNASDDEPLT-QRAFFEWLAKEL 224

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
            K  PP  +           R     NKR+SNAK+K+  +QL YPN+R     L  E
Sbjct: 225 GKTVPPEGEVQ--------KRKRAVTNKRVSNAKLKATDWQLKYPNFREGYGALINE 273


>gi|329906418|ref|ZP_08274397.1| putative nucleoside-diphosphate-sugar epimerase [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327547294|gb|EGF32136.1| putative nucleoside-diphosphate-sugar epimerase [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 363

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 133/301 (44%), Gaps = 40/301 (13%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++I G G  G  +    L+        T     +  L+  G  P +    + ++L R  
Sbjct: 77  RVLIIGCGDVGMRLL-PLLRARFRVFAVTSQPGRIAELRAAGAIPIVANLDEPHSLARLS 135

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
                H+V    P SEG       +++ +  +P    + Y+S++ +YG+  G  +DE   
Sbjct: 136 -RLARHVVHLAPPQSEG--TTDRRTRNLFAILPDAATVVYVSTSGVYGDCGGALIDETRP 192

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V+P++  A +R +AE+      ++ + +L +LR+ GIYG  R P  ++R K +  LV  +
Sbjct: 193 VNPVNARARRRVDAEQVLRRWARRAHGRLGILRVPGIYGADRLPLERLR-KGTPALVAAD 251

Query: 182 QVF-NRIRVEDVARCVIFLM---------------THHLGGIFN-LSD--DEPAPPQNVI 222
            V+ N I  +D+AR +   +                  +G  F+ ++D  D P PP+   
Sbjct: 252 DVYTNHIHADDLARIIATALFRLQPNRVVHTVDDSAMKMGEYFDAVADAFDMPRPPRLPR 311

Query: 223 MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
            E   L               +SP    F ++++++SN ++K  LG +L YP    +L+ 
Sbjct: 312 TELREL---------------VSPMLLSFMSESRQLSNRRLKQELGVRLQYPTVADALRA 356

Query: 282 L 282
           +
Sbjct: 357 I 357


>gi|213400920|gb|ACJ47108.1| hypothetical protein [Wolbachia endosymbiont of Nasonia
           vitripennis]
          Length = 136

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 75/140 (53%), Gaps = 18/140 (12%)

Query: 47  FLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTS 106
            LF  +K++  L   L   TH++  I P  +GD  +    + +   + +VKW+GYLS+TS
Sbjct: 11  ILFNYEKVSQDL---LKSATHVLISIPP--DGDDVV----ERYGDCLQNVKWLGYLSATS 61

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRN 164
           +YG+  G WVDE S   PI     +R  +EK+W      LN KL V   RL+GIYGP RN
Sbjct: 62  VYGDHSGNWVDEESETRPIEIRGEKRLKSEKKW------LNSKLPVHIFRLAGIYGPSRN 115

Query: 165 PFIKIRQKNSLRLVKKNQVF 184
             I + Q    R VKK   F
Sbjct: 116 VLIDL-QLGKARNVKKEGHF 134


>gi|113953725|ref|YP_730661.1| hypothetical protein sync_1456 [Synechococcus sp. CC9311]
 gi|113881076|gb|ABI46034.1| conserved hypothetical protein [Synechococcus sp. CC9311]
          Length = 282

 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 120/281 (42%), Gaps = 22/281 (7%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLREKL 62
           + G GY G F+A +    G Y  GTTR+      L++    P     A Q  +    E  
Sbjct: 6   VIGCGYVGSFVAASMKNQGHYVVGTTRTSQRFAELRNVVNEPISLDLAQQDCDFSFLEDQ 65

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--------PHVKWIGYLSSTSIYGNREGQ 114
           +    ++  + P+  GD      S                H   + Y+SS  +YG+++G+
Sbjct: 66  H---GLLISVAPTQNGDGYQGVFSNGIRNLARALRCRQSTHQLHVTYISSAGVYGDQQGE 122

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V E S V  ++ V      AE   L I +  +  + VLRL GIYGP R+    I+Q   
Sbjct: 123 LVTEDSPVDCLNPVNAMLVEAENVLLTIDRP-DTSICVLRLGGIYGPGRDMVSMIKQAAG 181

Query: 175 LRLVKK-NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
             + K  N +     + D+   V F   + L GI+NL DD     + +  E   +  + P
Sbjct: 182 ESIPKNGNDIPAWSGIFDITNGVSFAFNNQLVGIYNLVDDMQLSRRQLSNEICDIDGL-P 240

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           P+    + A   P  R     N +++N KIK+ GF+L  P+
Sbjct: 241 PVIWANENA---PGARSM---NAKVTNDKIKTKGFRLSSPS 275


>gi|171915132|ref|ZP_02930602.1| shikimate kinase [Verrucomicrobium spinosum DSM 4136]
          Length = 471

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 122/295 (41%), Gaps = 42/295 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M  ++ G GY+G+ +AD   + G    G T S  +   L      P L AD      L  
Sbjct: 1   MRCLVVGCGYSGEKLADLLHEAGHEVTGLTHSPESAERLTASKPYPVLAADVSEEASLAS 60

Query: 61  KLYFTTH----IVQCIKPSSEGDPCIISMSKDFY--------KFMPHVKWIGYLSSTSIY 108
                +     ++ C   +  G      M +  Y           P    + + SSTS+Y
Sbjct: 61  VAATLSGPPDAVIHCASSNRGG----AEMYRKVYLEGCTHLTALFPQAHLL-FTSSTSVY 115

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
              +G  VDE S   P     T R   + E L ++        V RL+GIYGP R+  +K
Sbjct: 116 PQVDGSLVDETSPAEPER--ETGRILRQTEELVLSHGGT----VTRLAGIYGPNRSFVLK 169

Query: 169 --IRQKNSLRLVK-KNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIME- 224
             +  K S+   + + +V N+I  +DVAR ++ L+     G+FN+ DD P   +      
Sbjct: 170 NFLEGKASIEGAEGQGRVLNQIHRDDVARAIMHLVLGGHRGVFNVVDDAPMTQRECFKHL 229

Query: 225 ----AASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
               A SL  + PP  +           R     NKR++NA + + GF L YP+Y
Sbjct: 230 AARFARSLPPVAPPNNE-----------RKRAWTNKRVANAALHATGFTLTYPSY 273


>gi|330952134|gb|EGH52394.1| hypothetical protein PSYCIT7_12329 [Pseudomonas syringae Cit 7]
          Length = 282

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 128/294 (43%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A+  L  G    G  R+VS L    H G++  LF   K  +     L
Sbjct: 6   LLIAGCGDIGSRLANRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFETPKPAHWPAAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +     +    +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSATEPGNYTGTVMLEAEQ----VALNSGLPATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  L+     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAAGLLGHLLLADQRGVSLESCYLGVDDDPAALADVVAWMREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+YR     L
Sbjct: 237 LGVTGWSEE----------VSVQRVGSKRCSNARARALGWAPMYPDYRAGYAAL 280


>gi|308810359|ref|XP_003082488.1| Putative NAD+-dependent epimerases (ISS) [Ostreococcus tauri]
 gi|116060957|emb|CAL56345.1| Putative NAD+-dependent epimerases (ISS) [Ostreococcus tauri]
          Length = 380

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 115/261 (44%), Gaps = 29/261 (11%)

Query: 5   IFGAGYTGKFIADA-ALKVGVYTC-GTTRSVSNLLTLKHKGISPFLFA-DQKINNLLREK 61
           +FG G+ G+ +A A     G  T  GTTRS + +  +K + +  +    D  +   +R  
Sbjct: 12  VFGMGFLGREVARALGRDDGAKTTRGTTRS-AEVGRVKERNVRAWDGGFDADVAACVRRA 70

Query: 62  LYFTTHIVQCIKP--SSEG---DPCIISMSKDFYKFMPH----VKWIGYLSSTSIYGNRE 112
                 +V C+ P  +S+G   DP   + ++      P      ++ GY S+TS+YG+  
Sbjct: 71  RV----VVSCVPPVEASDGTWSDPVYDAYAETLASAHPDGTNVTRFFGYCSTTSVYGDHG 126

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPF-IKI 169
           G WV+E S   P S  A  R +AE +W A+  + N  +K    RL GIYGP R+     +
Sbjct: 127 GGWVNETSACAPDSDKARARLDAESKWRALAARSNGALKAVSFRLGGIYGPNRSALETAM 186

Query: 170 RQKN-------SLRLVKKNQVFNRIRVEDVARCV--IFLMTHHLGGIFNLSDDEPAPPQN 220
           R+         S R        +R+ V D A  +  I         ++N+ DD P    +
Sbjct: 187 RRAGKDASESASSRARDARAFTSRVHVRDAANVIAAIARAGDEASDVYNVVDDYPVSRLS 246

Query: 221 VIMEAASLMKITPPLEQCFDT 241
            +  A  ++ + P  ++   T
Sbjct: 247 AVKFAGQILGLCPGDDRTEST 267


>gi|160897636|ref|YP_001563218.1| NAD-dependent epimerase/dehydratase [Delftia acidovorans SPH-1]
 gi|160363220|gb|ABX34833.1| NAD-dependent epimerase/dehydratase [Delftia acidovorans SPH-1]
          Length = 313

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 118/278 (42%), Gaps = 18/278 (6%)

Query: 18  AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKP--- 74
            A + G      TR    L  L+ +GI+P L  D      LR      T +V    P   
Sbjct: 38  GAARRGPRVLALTRGTERLQDLRGRGITPLL-GDLDAPATLRRLAGLATRVVHLAPPPNP 96

Query: 75  --SSEG---DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA 129
               EG   DP   ++ +   +       + Y S++ +YGN EG W+DE     P +  A
Sbjct: 97  PAGEEGWWLDPRTTALLRVLRRRGRPASLV-YGSTSGVYGNCEGAWIDESRPPAPATARA 155

Query: 130 TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVFNR 186
            +R NAE+  +    +  ++ ++LR+ GIY P R    P  ++ +   L    ++   N 
Sbjct: 156 QRRVNAERA-VRFAGRGGLRASILRIPGIYAPDRENGTPRGRLLRGTPLLCAAEDVYTNH 214

Query: 187 IRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANIS 245
           I  +D+AR CV  L       I++ SDD           AA L  +  P     + A   
Sbjct: 215 IHADDLARACVRALWRGRPQRIYHASDDTQLRMGEYFDFAADLYGLPRPARITREQAQRE 274

Query: 246 -PFTRF-FYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
            P +   F  +++R+ N ++K+ LG +L YP     L+
Sbjct: 275 LPASLLSFMGESRRLRNQRLKAELGLRLRYPTVEQGLR 312


>gi|224823875|ref|ZP_03696984.1| NAD-dependent epimerase/dehydratase [Lutiella nitroferrum 2002]
 gi|224604330|gb|EEG10504.1| NAD-dependent epimerase/dehydratase [Lutiella nitroferrum 2002]
          Length = 292

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 12/207 (5%)

Query: 76  SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA 135
            E DP +  +     K     + I Y+S++ +YG+  G W+DE + + P S  A +R +A
Sbjct: 77  GESDPRLGKLLCALAKGKSLPQRIAYISTSGVYGDAGGAWLDETAPLRPQSARAKRRVDA 136

Query: 136 EKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR- 194
           E+   A  +     + +LR  GIY  +R P  ++     L    ++   N I  +D+AR 
Sbjct: 137 ERRLRAFARTHGTTVTILRAPGIYAAERLPTTRLINGTPLIAADEDSYGNHIHADDLARI 196

Query: 195 CVIFLMTHHLGGIFNLSDDEPAPPQNVIME-----AASL-MKITPPLEQCFDTANISPFT 248
           CV  L       ++N  D EP     ++ E     A +L M   P L +    A +SP  
Sbjct: 197 CVAALRREDGIRVYNACDAEPL----MVGEWYDRLADALGMPHAPRLPRVEVQAAVSPAL 252

Query: 249 RFFYADNKRISNAKI-KSLGFQLLYPN 274
             F A+++R+ N ++ + LG +L YP 
Sbjct: 253 WSFLAESRRLDNGRLRRELGIRLRYPT 279


>gi|149173492|ref|ZP_01852122.1| hypothetical protein PM8797T_22148 [Planctomyces maris DSM 8797]
 gi|148847674|gb|EDL62007.1| hypothetical protein PM8797T_22148 [Planctomyces maris DSM 8797]
          Length = 305

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 124/295 (42%), Gaps = 25/295 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M  +I G GY G  +A   +K G      TRS  N       GI P L    +  +L  E
Sbjct: 1   MRKLIIGCGYVGLTVAREWVKQGDQVSALTRSKDNARKFTESGIQPVLGDITQPESL--E 58

Query: 61  KLYFTTHIVQCIKPSSEGDPC-----IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
           +L     ++  +      D       +  +           + + YLSSTS+YG   G+W
Sbjct: 59  RLPEADTVLYAVGFDRTADKSRREIYVTGLDSVLKVLKQRSQKVIYLSSTSVYGQTAGEW 118

Query: 116 VDEHSFVHPIS-----CVATQRFNAEKEWLAIT-KKLNIKLAV-LRLSGIYGPKRNPFIK 168
           VDE S   P       C+  ++   +  +L+ +  K N   AV LRL+GIYGP R    +
Sbjct: 119 VDETSVCEPERENGQICLEAEQLFEQHGFLSTSVPKSNAATAVILRLAGIYGPGR-LLAR 177

Query: 169 IRQKNSLRLVKKN--QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEA 225
           + Q N+   +  N     N I + D+ + ++   T+ HL   + +SD  P   Q   +  
Sbjct: 178 MEQINAGEPLAGNPDAWLNLIHLADIVQAILRCDTNIHLDDRYLVSDSRPITRQEYYLTL 237

Query: 226 ASLMKITPPLEQCFDTANIS-PFTRFFYAD-----NKRISNAKIK-SLGFQLLYP 273
           A L+    P      +  IS   TRF   +     NKR SN +++  LG  L +P
Sbjct: 238 ARLLNAPEPRFDSDGSGEISRKSTRFNSTERAAGMNKRCSNKRLREELGVSLTFP 292


>gi|257052274|ref|YP_003130107.1| NAD-dependent epimerase/dehydratase [Halorhabdus utahensis DSM
           12940]
 gi|256691037|gb|ACV11374.1| NAD-dependent epimerase/dehydratase [Halorhabdus utahensis DSM
           12940]
          Length = 299

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 123/297 (41%), Gaps = 31/297 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR-- 59
            + + G GY G  +A      G +  G  RS S L  ++  G  P + AD    + L   
Sbjct: 3   RVAVLGCGYVGCELARQLGDAGHHVVGVRRSKSGLAAVEAAGADP-VRADVTDGDSLASV 61

Query: 60  ---EKLYFTTHIVQCIKPSS-----EGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNR 111
              E + F          ++     EG    I    D  +  P  +++ Y SST +YG+ 
Sbjct: 62  PDVEWIVFAASAGGRDADAARETYVEGLRTAIDHFAD--RDSPPDRFV-YTSSTGVYGDH 118

Query: 112 EGQWVDEHSFVHPISCVATQRFN--AEKEWLAITK-KLNIKLAVLRLSGIYGPKRNPFIK 168
           +G+WVDE + + P      +R    AE E LA  +    +   V R +G+YGP R     
Sbjct: 119 DGEWVDEETAIDP----GDERTEILAEAERLARDRPPAGVDGTVARFAGLYGPDR----- 169

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGGIFNLSDDEPAPPQNVIMEAA 226
            R +  L       V N +  +D A  V FL+      G I NL DDEP          A
Sbjct: 170 YRLQRYLDGPVTAGVLNMVHRDDAAGAVRFLLERDRGRGAIVNLVDDEPVEKWGFADWLA 229

Query: 227 SLMKITPPLEQCFDT--ANI-SPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLK 280
               +  P +Q  +   A++ S  TR      KR+SN +++  G++  +P YR   +
Sbjct: 230 EQAGVEFPPKQTVEQRLADVDSTSTRRRIRATKRVSNERLREYGYEFAFPTYRAGYR 286


>gi|218438087|ref|YP_002376416.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7424]
 gi|218170815|gb|ACK69548.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7424]
          Length = 275

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 125/286 (43%), Gaps = 26/286 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M ++I G GY GK IA    + G     TT +   +  L+       +         L+E
Sbjct: 1   MKIVIIGCGYVGKAIAQVWTQAGHEVTATTTTPEKVADLERLATGVMVVKGDN-PEALKE 59

Query: 61  KLYFTTHIVQCIKPSSEG----DPCIISMSKDFYKFMPH---VKWIGYLSSTSIYGNREG 113
            +     I+  +   S          ++ +K+    +     V+ + Y  S  + G+++G
Sbjct: 60  AIADQEVILLSVAAKSRSVDGYRETYLNTAKNLVSALEENRTVQQVIYTGSYGVLGSKQG 119

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI--RQ 171
           QW+DE + V PI+         E+  L+  ++  +KL +LRL+GIYGP+R   IKI    
Sbjct: 120 QWIDETASVTPINEHGDILLQTEQVLLSGLQE-PLKLCILRLAGIYGPRRE-LIKIFGSW 177

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNV---IMEAASL 228
             + R        N + ++D+   +  +    L GI++L+DD P P +     + E+  L
Sbjct: 178 AGTTRPGTGEDYTNWVHLDDIVGALKLIQQQQLEGIYHLADDSPMPKKEFYRRLFESHGL 237

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
               P L     + N S  +   Y  N R+SN K+K  G  L++P 
Sbjct: 238 ----PAL-----SWNSSQSSERVY--NLRLSNQKLKRAGLNLVHPE 272


>gi|170719355|ref|YP_001747043.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida W619]
 gi|169757358|gb|ACA70674.1| NAD-dependent epimerase/dehydratase [Pseudomonas putida W619]
          Length = 285

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 135/293 (46%), Gaps = 43/293 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE-K 61
           ++I G G  G  +A   L  G    G  RSV +L     + + P + AD   + + +   
Sbjct: 6   VLIVGCGDVGGRLARQLLARGWQVSGLRRSVEHL----PQRVVP-IAADLSDSGMPQAWP 60

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIYGN 110
            +   ++V C+  S   +    S    + + + HV  W+           ++SS+S++  
Sbjct: 61  QHSPDYLVYCVAASQHDEAGYQSA---YVEGLRHVLGWLAERGQRPRRLLFVSSSSVFAQ 117

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KI 169
           ++G+W+DE +   P     + R   E E LA+     +  +++RL+GIYGP R   + ++
Sbjct: 118 KDGEWIDETAPTEPQGY--SGRVMLEAERLALAS--GMPASIVRLTGIYGPGREWLLSQV 173

Query: 170 RQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEPAPPQNVIM 223
           RQ    R+  +  ++ NRI  ED A  + FL+     G+     +   DD+PAP  +V+ 
Sbjct: 174 RQ--GYRVATEPPLYGNRIHAEDAASLLAFLLQADADGVALDDCYIGVDDDPAPLADVVG 231

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
              + M +T            S   R     +KR SNA++++LG+   YP+Y+
Sbjct: 232 WLRAYMGVT----------EWSDEQRVRRTGSKRCSNARVRALGWVPEYPSYK 274


>gi|330941130|gb|EGH44010.1| hypothetical protein PSYPI_17085 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 282

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A   L  G    G  R+VS L    H G++  LF   K        L
Sbjct: 6   LLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFKTPKPAQWPDAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +          +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSPTEPGNYTGTVMLEAEQ----VALNSGFPATAVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDEPAPPQNVIMEAASL 228
           S+R +      NRI  +D A  +  ++     G+   S     DD+PA   +V+      
Sbjct: 178 SVR-IDPPVYANRIHADDAAGLLEHVLLADQRGVALESCYLGVDDDPAALADVVAWIREY 236

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           + +T   E+                 +KR SNA+ ++LG+  +YP+Y+     L
Sbjct: 237 LGVTEWSEE----------VSVQRVGSKRCSNARARALGWSPIYPDYKAGYAAL 280


>gi|213400940|gb|ACJ47118.1| hypothetical protein [Wolbachia endosymbiont of Dipetalonema
           gracile]
          Length = 136

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 10/120 (8%)

Query: 66  THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI 125
           TH++  I P  +GD  +    + +  +   +KW+GYLS+TS+YG+  G W+ E S   PI
Sbjct: 27  THVLVSIPP--DGDDVL----ERYSHYFQDIKWLGYLSATSVYGDHAGNWITEESKTRPI 80

Query: 126 SCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFN 185
                 R  +EK+WL+      + + + RL+GIYGP RN  I +R      L K+  +F+
Sbjct: 81  ETRGKNRLKSEKKWLSS----KLPVHIFRLAGIYGPGRNVLIDLRLNKIKNLQKEGHIFS 136


>gi|229593363|ref|YP_002875482.1| hypothetical protein PFLU5998 [Pseudomonas fluorescens SBW25]
 gi|229365229|emb|CAY53531.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 284

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 121/290 (41%), Gaps = 37/290 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G G  G  +A   L  G    G  R VS L      GI+  LF     +      +
Sbjct: 7   VVIAGCGDVGSRLASQLLASGWEVHGLRRDVSRLPD-GVIGIAGDLFKKDCPDTW---PI 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIYGNR 111
               ++V C   +   +         + + + HV +W+G          ++SS+S+YG +
Sbjct: 63  GGVDYLVYCAAATDHDE---AGYRAAYVQGLKHVLEWLGDYGQEPKHLLFVSSSSVYGQQ 119

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
            G+WVDE S              AE+    +     I  +++RL+GIYGP R   +   +
Sbjct: 120 NGEWVDETSETQAKGYSGQVMLEAEQ----VALNSGIPASIVRLTGIYGPGREWLLTQVR 175

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGG----IFNLSDDEPAPPQNVIMEAA 226
           +     V      NRI  ED A  + FL+ H   GG    ++   DD PAP   V+    
Sbjct: 176 QGYRVAVDPPLYGNRIHAEDAAGLLAFLLRHVESGGALDKVYIGVDDAPAPLAEVVGWLR 235

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
             + +T       + A  +   R   A +K+ SNA+ K+LG+   YP YR
Sbjct: 236 EFLGVT-------EWAEDASVRR---AGSKQCSNARAKALGWTPTYPTYR 275


>gi|213400942|gb|ACJ47119.1| hypothetical protein [Wolbachia endosymbiont of Cordylochernes
           scorpioides]
          Length = 133

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 15/117 (12%)

Query: 66  THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI 125
           TH++  I P  +GD  +    + +  ++ ++KW+GYLS+TS+YG+  G WV E S   P+
Sbjct: 24  THVLVSIPP--DGDDVL----ERYGHYLQNIKWLGYLSATSVYGDHAGNWVTEESETKPV 77

Query: 126 SCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                 R  +EK+W      LN KL V   RL+GIYGP RN  + + Q N  R V+K
Sbjct: 78  ESRGENRLRSEKKW------LNSKLPVHIFRLAGIYGPGRNALVDL-QLNKARNVRK 127


>gi|299533148|ref|ZP_07046532.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni S44]
 gi|298718678|gb|EFI59651.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni S44]
          Length = 295

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 131/295 (44%), Gaps = 31/295 (10%)

Query: 4   MIFGAGYTGK-----FIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL 58
           MI G G  G+      +A    + G+     +RS      L    + P L+ D      L
Sbjct: 1   MIVGHGDVGQRVARLLVASGRGRHGIQVLALSRSPGRAEQLHTHAVRP-LWGDLDDPAGL 59

Query: 59  REKLYFTTHIVQCIKPSS--EGDPC-------IISMSKDFYKFMPHVKWIGYLSSTSIYG 109
           R      T ++    P +   GD C          M     + +P  + + Y S++ +YG
Sbjct: 60  RRLAGIATRVLHLAPPQAPAAGDECSWLDSRTTALMRALRLRSLP--RSLVYASTSGVYG 117

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAI--TKKLNIKLAVLRLSGIYGPKR---N 164
           + EGQWV E   V P +  A +R NAE   LA+    +L ++ ++LR+ GIY P R    
Sbjct: 118 DCEGQWVAETRSVAPTTARAQRRVNAE---LAVRFAGRLGLRASILRIPGIYAPDREGGT 174

Query: 165 PFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVI 222
           P  ++ Q+ +  L  ++ V+ N I  +D+AR C++ L       I++ SDD      +  
Sbjct: 175 PRARL-QRGTAVLKPEDDVYTNHIHADDLARACLLALWRGKPQRIYHASDDTQLKMGDYF 233

Query: 223 MEAASLMKITPPLEQCFDTANIS-PFTRF-FYADNKRISNAKIK-SLGFQLLYPN 274
             AA L  +  P     + A    P +   F ++++R+SN ++K  L  +L YP 
Sbjct: 234 DLAADLYGLGRPPRISREQAQTELPASLLSFMSESRRLSNQRLKHELRLRLRYPT 288


>gi|226946846|ref|YP_002801919.1| NAD-dependent epimerase/dehydratase family protein [Azotobacter
           vinelandii DJ]
 gi|226721773|gb|ACO80944.1| NAD-dependent epimerase/dehydratase family protein [Azotobacter
           vinelandii DJ]
          Length = 286

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 85/187 (45%), Gaps = 19/187 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +YG +EG+WVDE+S   P     + R   E E LA+   L    +V+RL+GIYG
Sbjct: 110 FVSSTGVYGQQEGEWVDENSPTEPSGF--SGRVLLEAERLALGSGL--PASVVRLAGIYG 165

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEP 215
           P R   +   ++            NRI  +D A  + FL+     G+     +   DD P
Sbjct: 166 PGREWLLGQVRRGGRIAATPPLYGNRIHRDDAAGLLTFLLEADARGVPLADCYLGVDDAP 225

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           AP   V+      + +T             P +    A +KR SNA+ ++LG+   YP Y
Sbjct: 226 APLHEVVAWLRGWLGVT----------GEGPESIGRRAGSKRCSNARARALGWVPRYPGY 275

Query: 276 RISLKQL 282
           R     L
Sbjct: 276 REGYAAL 282


>gi|254423386|ref|ZP_05037104.1| NAD dependent epimerase/dehydratase family [Synechococcus sp. PCC
           7335]
 gi|196190875|gb|EDX85839.1| NAD dependent epimerase/dehydratase family [Synechococcus sp. PCC
           7335]
          Length = 271

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 121/285 (42%), Gaps = 26/285 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN----- 55
           M   I G GY G  +A      G     TT   S +  L        L  D +I      
Sbjct: 1   MKAAIIGCGYVGTAVAKLWRAKGFDLLVTTTRQSRVEALSQ------LADDVRIAIGTNA 54

Query: 56  NLLREKLYFTTHIVQCIKPSSEGD--PCIISMSKDFYKFMP--HVKWIGYLSSTSIYGNR 111
           + +R+ L     ++ C+    +       +  ++   + +P   V+ I Y S+ S+YG  
Sbjct: 55  SQMRDALVDRQVVLLCVGSHKDASYRDTYLGTARTLTEVLPSTDVQQIIYTSTCSVYGEH 114

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN-PFIKIR 170
            G WV E     PI+    +   A ++ L        K+ +LRL GIYGP R    I  R
Sbjct: 115 HGAWVTELMPPSPIT-ENGKIIEATEQTLLSAIMPQRKVCILRLGGIYGPGRTLGKIYSR 173

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
              + R  K N+  N + ++D+   + +     L G++NL  DE    + +I E     +
Sbjct: 174 AAGTTRPGKGNEGTNWVYLDDIVGGIDWARQQQLSGLYNLVQDEVPTIRELISEVCDHHQ 233

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           ++P L   +D     P TR     N R+SNAKIKS G+Q  +P +
Sbjct: 234 LSPVL---WD--ETQPSTR----KNVRVSNAKIKSTGYQFSHPTF 269


>gi|67921236|ref|ZP_00514755.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gi|67857353|gb|EAM52593.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
          Length = 310

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 130/287 (45%), Gaps = 29/287 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTT---RSVSNLLTLKHKGISPFLFADQKINNLLR 59
           + I G GY GK +A    + G    GTT     +S+L  + H   +P +     +  +  
Sbjct: 35  VAIIGCGYVGKAVASYWYQQGYIVTGTTTREEKISDLENITH---NPVVVRGDNLEAI-- 89

Query: 60  EKLYFTTH-IVQCIKPSSEGD-------PCIISMSKDFYKFMPH---VKWIGYLSSTSIY 108
           EK+      I+  I P S+            I  +K+    + +   VK + YL+S S+Y
Sbjct: 90  EKVVEDQETILVSIAPISDRQVSAEVYAQTYIPTAKNLVTVLNNNSTVKQVIYLTSGSVY 149

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
           G+++G+WVDE S +   S        AE   L + K+ +IK+ +LRL GIYGP R    +
Sbjct: 150 GDKKGEWVDETSPLDTESDYGKVLVEAENIILGL-KREDIKVCLLRLGGIYGPGRKLNKR 208

Query: 169 IRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAAS 227
           + +     L    + +   I +ED+ + + F+      G++NL +D     +    E   
Sbjct: 209 LGRMAGKTLPGNGENYVAWIHLEDIVKGIEFVQEKGCHGVYNLVNDMKLNSK----ELCD 264

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           L+     LE+ +   +   F+      N R+ N+KIK  G+Q +Y +
Sbjct: 265 LICDRQQLERVYWDDSKPSFSSL----NARVDNSKIKQEGYQFIYAD 307


>gi|159469273|ref|XP_001692792.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158278045|gb|EDP03811.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 253

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 12/131 (9%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           + W GYLSST +YG+ +G+WVDE S     S  A  R  AE  W  + ++  +   + RL
Sbjct: 88  LAWFGYLSSTGVYGDWQGEWVDESSPCRQTSSKAIVRQEAEAAWQQMCEQHGLPTHIFRL 147

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIF---------LMTHHLGG 206
            GIYGP R+    +R + +     + +   R R    ARC ++         +     G 
Sbjct: 148 GGIYGPGRSVLDSLRSQPADLSASQER---RGRQRYTARCHVYDICAVLKASMAAPRPGA 204

Query: 207 IFNLSDDEPAP 217
           ++N+ DD+PAP
Sbjct: 205 VYNIVDDDPAP 215


>gi|213400922|gb|ACJ47109.1| hypothetical protein [Wolbachia endosymbiont of Armadillidium
           vulgare]
          Length = 131

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 73/135 (54%), Gaps = 20/135 (14%)

Query: 48  LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
           LF  +K+N  L   L   TH++  I P  +GD  +          + +VKW+GYLS+T++
Sbjct: 12  LFDYEKVNQDL---LKSATHVLISIPP--DGDDIVERYG------LQNVKWVGYLSATNV 60

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNP 165
           YG+  G WV+E S   PI     +R ++EK+W      LN KL V   RL+GIYGP RN 
Sbjct: 61  YGDHCGNWVNEESETKPIEIRGEKRLDSEKKW------LNSKLPVHIFRLAGIYGPGRNA 114

Query: 166 FIKIRQKNSLRLVKK 180
            I + Q    R VKK
Sbjct: 115 LIDL-QLGKARNVKK 128


>gi|213400930|gb|ACJ47113.1| hypothetical protein [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 136

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 15/117 (12%)

Query: 66  THIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPI 125
           TH++  I P  +GD  +    + +  ++ ++KW+GYLS+TS+YG+  G WV E S   P+
Sbjct: 27  THVLVSIPP--DGDDVL----ERYGHYLQNIKWLGYLSTTSVYGDHAGNWVTEESETKPV 80

Query: 126 SCVATQRFNAEKEWLAITKKLNIKLA--VLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
                 R  +EK+W      LN KL   V RL+GIYGP RN  + + Q N  R V+K
Sbjct: 81  ESRGKSRLKSEKKW------LNSKLPVHVFRLAGIYGPGRNVLVDL-QVNKARNVRK 130


>gi|260220665|emb|CBA28435.1| hypothetical protein Csp_A07240 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 317

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 120/260 (46%), Gaps = 13/260 (5%)

Query: 30  TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG--DPCIISMSK 87
           T S   +  L+  G+ P L    K ++L R      + ++    P +EG  DP   ++++
Sbjct: 54  TSSEERITELRKAGVMPLLGNLDKASSL-RRLAGLGSRLMYLAPPPTEGCTDPRAAALTR 112

Query: 88  DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN 147
                 P    + Y S+T +YG+  G+WV E   V P +  A +R +AE       K   
Sbjct: 113 VLRLRSPLHSAV-YGSTTGVYGDCFGEWVAETRAVSPQTPRAQRRVHAEAVLRTWGKATG 171

Query: 148 IKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTH 202
             +AVLR+ GIY P R    P  ++ QK +  L  ++ V+ N I  +D+AR C+  L   
Sbjct: 172 TPIAVLRIPGIYAPDREGGTPRTRL-QKGTPVLQPQDDVYTNHIHADDLARACMRALWAG 230

Query: 203 HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA--NISPFTRFFYADNKRISN 260
               I+N+SDD      +    AA L  +  P     D+A   +      F ++++RI N
Sbjct: 231 APQRIYNVSDDTQLKMGDYFDMAADLYGLPRPPRVARDSAQKQLPVMLLSFMSESRRIDN 290

Query: 261 AKIKS-LGFQLLYPNYRISL 279
            ++K+ L  +L YP+    L
Sbjct: 291 RRMKTELRLRLRYPDVAAGL 310


>gi|192360600|ref|YP_001983946.1| hypothetical protein CJA_3493 [Cellvibrio japonicus Ueda107]
 gi|190686765|gb|ACE84443.1| conserved hypothetical protein [Cellvibrio japonicus Ueda107]
          Length = 288

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 91/188 (48%), Gaps = 24/188 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +Y  ++G WVDE S   P      +   AE+    +  +      ++R SGIYG
Sbjct: 113 FVSSTGVYTQQDGSWVDESSPTEPTHFSGRRLLEAEQ----LISQSGFPHCIVRPSGIYG 168

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMT----HHLGGIFNLSDDE 214
           P R   I ++RQ+ +      +Q F NRI  EDVA  +  L+     H +  ++  SD  
Sbjct: 169 PGRYRLIEQVRQQQA----SPSQHFTNRIHAEDVAGAISHLVEYSRHHPIATLYLASDMA 224

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PAP  +V+   A  M+I  P      + N S         NKRI+N ++ + GF+  YP+
Sbjct: 225 PAPMADVVHWLAGQMEIRDPF-----SVNTS-----HERSNKRINNQRLLNSGFKFRYPD 274

Query: 275 YRISLKQL 282
           YR    +L
Sbjct: 275 YRQGYAEL 282


>gi|213400934|gb|ACJ47115.1| hypothetical protein [Wolbachia endosymbiont of Nasutitermes
           nigriceps]
          Length = 136

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           N + ++     THI+  I P  +GD  +    + +  +  +VKW+GYLS+TS+YG+  G 
Sbjct: 16  NEVSKDTFQDVTHILISIPP--DGDDVL----ERYGHYFQNVKWLGYLSATSVYGDHAGN 69

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WV E S   P       R  +EK+WL      N+ + V RL+GIYGP RN  + ++   +
Sbjct: 70  WVTEESETRPAEHRGENRLRSEKKWL----NSNLPVHVFRLAGIYGPGRNVLVDLQLSKA 125

Query: 175 LRLVKKNQVF 184
             + ++   F
Sbjct: 126 RNVRREGHFF 135


>gi|85713230|ref|ZP_01044257.1| Capsular polyglutamate biosynthesis secreted protein CapB,
           ATP-dependent mur ligase family protein [Idiomarina
           baltica OS145]
 gi|85692948|gb|EAQ30919.1| Capsular polyglutamate biosynthesis secreted protein CapB,
           ATP-dependent mur ligase family protein [Idiomarina
           baltica OS145]
          Length = 277

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 89/184 (48%), Gaps = 17/184 (9%)

Query: 98  WIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSG 157
           ++ Y+SST +YG  EG+WVDE S   P S        AE     + + L +   +LR SG
Sbjct: 105 YVIYVSSTGVYGQHEGEWVDESSPTAPDSDSGKMLLQAE----YLIRDLPVPSTILRCSG 160

Query: 158 IYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM--THHLGGIFNLSDDEP 215
           IYG  R+ F++ +Q  + +   ++   NRI  +DVA  +  L+    H   +F +SDD+P
Sbjct: 161 IYGEGRD-FMR-KQLQAGKATLRDSWTNRIHQDDVASFIYHLVRFPQHRHRMFLVSDDQP 218

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           +    V    A    IT       +     P  R     +KR SN  ++S G+ L+YP Y
Sbjct: 219 SKQYQVYQYLAEQAGIT-----LNEPVQPGPGPR----GSKRCSNRLLRSTGYTLMYPTY 269

Query: 276 RISL 279
           +  L
Sbjct: 270 KEGL 273


>gi|213400918|gb|ACJ47107.1| hypothetical protein [Wolbachia endosymbiont of Nasonia
           longicornis]
          Length = 136

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (52%), Gaps = 14/137 (10%)

Query: 48  LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
           LF  +K++  L   L   TH++  I P  +GD  +    + +   + +VKW GYLS+TS+
Sbjct: 12  LFNYEKVSQDL---LKSATHVLISIPP--DGDDVV----ERYGDCLQNVKWFGYLSATSV 62

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           YG+  G WV+E S   PI     +R  +EK WL       + + + RL+GIYGP RN  I
Sbjct: 63  YGDHSGNWVNEESETKPIEIRGEKRLRSEKRWL----NSRLPVHIFRLAGIYGPGRNVLI 118

Query: 168 KIRQKNSLRLVKKNQVF 184
            + Q    R VKK   F
Sbjct: 119 DL-QLGKARNVKKEGHF 134


>gi|312963865|ref|ZP_07778336.1| NAD-dependent epimerase/dehydratase [Pseudomonas fluorescens WH6]
 gi|311281900|gb|EFQ60510.1| NAD-dependent epimerase/dehydratase [Pseudomonas fluorescens WH6]
          Length = 283

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 90/200 (45%), Gaps = 22/200 (11%)

Query: 82  IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLA 141
           ++   KD+ +   H+    ++SS+S+YG + G+WVDE S              AE+    
Sbjct: 92  VLEWLKDYGQEPKHLL---FVSSSSVYGQQNGEWVDETSQTQAKGYSGQVMLEAEQ---- 144

Query: 142 ITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT 201
           +     I  +++RL+GIYGP R   +   ++     V      NRI  +D A  + FL+ 
Sbjct: 145 VALNSGIPASIVRLTGIYGPGREWLLTQVRQGYRVAVDPPLYGNRIHADDAAGLLAFLLR 204

Query: 202 H-HLGG----IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNK 256
           H   GG    ++   DD PAP          L ++   L +       S       A +K
Sbjct: 205 HVEQGGSLDKVYIGVDDAPAP----------LAEVVAWLREYLGVTEWSEDASVRRAGSK 254

Query: 257 RISNAKIKSLGFQLLYPNYR 276
           + SNA+ K+LG++  YP YR
Sbjct: 255 QCSNARSKALGWKPTYPTYR 274


>gi|146309409|ref|YP_001189874.1| NAD-dependent epimerase/dehydratase [Pseudomonas mendocina ymp]
 gi|145577610|gb|ABP87142.1| NAD-dependent epimerase/dehydratase [Pseudomonas mendocina ymp]
          Length = 285

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS+ +YG +EG+W+DE S     S  A     AE+    +     +    +RL+G+YG
Sbjct: 109 FASSSGVYGQQEGEWIDEDSAAEAQSFSAVIMREAER----VAFASGLPATTVRLTGLYG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGI-----FNLSDDE 214
           P R  ++  + +   R+ +   ++ NRI V+D A  +  L+     G+     +   DDE
Sbjct: 165 PGRE-WLLSQVRGGYRVSETPPLYGNRIHVDDAAGLLATLLQADAAGVPLAACYLGVDDE 223

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PAP          L ++   L +    ++ S   R   A +KR SNA+ ++LG+   YP+
Sbjct: 224 PAP----------LHEVVAWLRERLGVSHWSDEQRVRRAGSKRCSNARARALGWAPQYPS 273

Query: 275 YR 276
           YR
Sbjct: 274 YR 275


>gi|170693593|ref|ZP_02884751.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170141375|gb|EDT09545.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 364

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 97/190 (51%), Gaps = 8/190 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE   V P +  A +R +AE++    T + +I  ++ R+ GIY 
Sbjct: 171 YASTTGVYGDCGGAWIDETRSVEPANARAKRRVSAERQLRRATARGSIAASIARIPGIYA 230

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  LV  + V+ N I  +D+A  ++ L TH     + + SDD     
Sbjct: 231 GNRLPLARL-EKRTPALVATDDVYTNHIHADDLAAILVRLATHGRPARVIHASDDSSLKM 289

Query: 219 Q---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
               +++ +A  L +  P + +    A I P    F  +++R+ N ++K  LG +L YP+
Sbjct: 290 GEYFDLVADAFGLAR-PPRITREQAEAQIEPTLLSFMRESRRLVNRRLKEELGVRLRYPS 348

Query: 275 YRISLKQLWK 284
               L++  +
Sbjct: 349 VEDFLREAGR 358


>gi|134094002|ref|YP_001099077.1| putative nucleoside-diphosphate-sugar epimerases [Herminiimonas
           arsenicoxydans]
 gi|133737905|emb|CAL60950.1| putative nucleoside-diphosphate-sugar epimerase [Herminiimonas
           arsenicoxydans]
          Length = 304

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 132/286 (46%), Gaps = 14/286 (4%)

Query: 3   LMIFGAGYTG-KFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           L+I G G  G + +     +  ++   T  S  +   L+  G  P +    +   L R  
Sbjct: 19  LLILGCGDVGMRLLPLLCTRFRIFAVTTQASRQD--ALRAAGAIPIIANLDQPATLARLA 76

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
                +I+    P S+G   I   +++    +P    + Y+S++ +YG+  G  +DE   
Sbjct: 77  -RLAQNIIHLAPPQSDGS--IDRRTRNLTSILPDHAVLVYVSTSGVYGDCGGACIDETRT 133

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
           V P +  AT+R +AE+      ++   +L +LR+ GIY   R P  ++ QK    L    
Sbjct: 134 VQPHNLRATRRVDAEQVLRNWARRSQSRLGILRVPGIYAGDRLPLERL-QKGLPALAADE 192

Query: 182 QVF-NRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQ---NVIMEAASLMKITPPLE 236
            V+ N I  +D+A+ + + L     G +++  DD         + + +A +L +  P L 
Sbjct: 193 DVYTNHIHADDLAQVIALALFRAQPGRVYHAVDDSEMKMGSYFDAVADAFALER-PPRLT 251

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQ 281
           +      +SP    F ++++R+SN ++K+ LG +L +P    +LKQ
Sbjct: 252 REKLRYAVSPMMLSFMSESRRMSNQRMKAELGMRLRHPTVAHALKQ 297


>gi|264679757|ref|YP_003279666.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni CNB-2]
 gi|262210272|gb|ACY34370.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni CNB-2]
          Length = 295

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 131/295 (44%), Gaps = 31/295 (10%)

Query: 4   MIFGAGYTGK-----FIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL 58
           MI G G  G+      +A    + G+     +RS      L    + P L+ D      L
Sbjct: 1   MIVGHGDVGQRVARLLVASGRGRHGIQVLALSRSPGRAEQLHAHAVRP-LWGDLDDPASL 59

Query: 59  REKLYFTTHIVQCIKPSS--EGDPC-------IISMSKDFYKFMPHVKWIGYLSSTSIYG 109
           R      T ++    P +   G+ C          M     + +P  + + Y S++ +YG
Sbjct: 60  RRLAGIATRVLHLAPPQAPAAGNECSWLDSRTTALMRALRLRSLP--RSLVYASTSGVYG 117

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAI--TKKLNIKLAVLRLSGIYGPKR---N 164
           + EGQWV E   V P +  A +R +AE   LA+    +L ++ ++LR+ GIY P R    
Sbjct: 118 DCEGQWVAETRSVAPTTARAQRRVSAE---LAVRFAGRLGLRASILRIPGIYAPDREGGT 174

Query: 165 PFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVI 222
           P  ++ Q+ +  L  ++ V+ N I  +D+AR C++ L       I++ SDD      +  
Sbjct: 175 PRARL-QRGTAVLKPEDDVYTNHIHADDLARACLLALWRGKPQRIYHASDDTQLKMGDYF 233

Query: 223 MEAASLMKITPPLEQCFDTANIS-PFTRF-FYADNKRISNAKIK-SLGFQLLYPN 274
             AA L  +  P     + A    P +   F ++++R+SN ++K  L  +L YP 
Sbjct: 234 DLAADLYGLARPPRISREQAQTELPASLLSFMSESRRLSNQRLKHELRLRLRYPT 288


>gi|153004644|ref|YP_001378969.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152028217|gb|ABS25985.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 280

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 121/290 (41%), Gaps = 27/290 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLL 58
           MH+++ G G+ G  +A   ++ G    G  R       L   GI P     AD       
Sbjct: 1   MHVLVAGCGWLGTALARRLVERGDRVTGIRRDPGRAAALSALGIEPLAVDLADPSAAG-- 58

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM------PHVKWIGYLSSTSIYGNRE 112
             +L     IV C    ++G     +   +  + +         + + Y  ST ++G R+
Sbjct: 59  --RLPAVDAIVACQSAGADGADAYRAAYVEANRTLLAAAARGGTRALVYTGSTGVFGQRD 116

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G  VDE +   P S  A     AE      +    ++ +V+RLSG+YGP R   +   + 
Sbjct: 117 GSEVDEATAPAPASGTAAVLVEAESLVRGASAG-PLRTSVVRLSGLYGPGRTGIVDRVRA 175

Query: 173 NSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMK 230
             L L   +  + N   ++D    V+  +    GG +++ SD EPA  + V+   A+ + 
Sbjct: 176 GRLALGPGDDAWMNFCHLDDAIAFVLAALERAEGGAVYHGSDAEPARRREVVEWIAARLG 235

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISL 279
           +TPP     D     P        ++RI + + ++ LG  L YP++R  L
Sbjct: 236 MTPPRS---DAPAEGP--------SRRIRSERTRAVLGVTLTYPSFRDGL 274


>gi|77461775|ref|YP_351282.1| NAD-dependent epimerase/dehydratase [Pseudomonas fluorescens Pf0-1]
 gi|77385778|gb|ABA77291.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 285

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 84/181 (46%), Gaps = 19/181 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+S+YG + G+WVDE S    ++   + R   E E +A+     I  +++RL+GIYG
Sbjct: 108 FVSSSSVYGQQSGEWVDEKS--ETVAAGYSGRLMLEAEQVALNS--GIPASIVRLTGIYG 163

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEP 215
           P R   +   ++     V      NRI  +D A  + FL+     G     I+   DD P
Sbjct: 164 PGREWLLTQVRRGYRVAVDPPLYGNRIHADDAAGLMAFLLDADRKGVTLDDIYIGVDDAP 223

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           AP          L ++   L +       S         +KR SNA+ K+LG+   YP+Y
Sbjct: 224 AP----------LAEVVAWLREYLGVTEWSEDESVRRTGSKRCSNARAKTLGWVPKYPSY 273

Query: 276 R 276
           R
Sbjct: 274 R 274


>gi|294341013|emb|CAZ89408.1| putative nucleoside-diphosphate-sugar epimerase [Thiomonas sp. 3As]
          Length = 308

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 129/296 (43%), Gaps = 20/296 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTC-GTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            L+I G G  G  +A  AL  G Y     T S   L +L+  GI P +    +   L R 
Sbjct: 11  RLLIVGCGDIGMRVA--ALARGRYRLLALTSSPQRLESLRSAGIVPLVGNLDQPQTLWRL 68

Query: 61  KLYFTTHIVQCIKPSSEGDPC------IISMSKDFYKFMPHVK---WIGYLSSTSIYGNR 111
                  ++    P     P       +IS  K         K    + Y S++ +YG+ 
Sbjct: 69  AQLAPQRVLMLAPPGDTSGPRDQRSRHLISRLKQSGMLSGPGKNTLRVVYASTSGVYGDC 128

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIY-GPKRNPFIKIR 170
           +G+   E     P +  A +R +AE+ W     +   ++ +LR+ GIY G  R+P  ++ 
Sbjct: 129 QGELAPETRPCQPQTERAQRRCDAERLWRRAGVQHRWRVGLLRIPGIYDGGSRSPKGRLE 188

Query: 171 QKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASL 228
           +   + L   + V+ N I  +D+AR C++ L     G ++N+ DD      +    AA L
Sbjct: 189 RGLPV-LAPADDVYTNHIHADDLARLCLLALERAAPGRVYNVCDDSTLRMGDYFDLAADL 247

Query: 229 MKITPPLEQCFDTA---NISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
             +  P+    D A    +SP    F  +++R+ N ++K+ LG +L YP   + L+
Sbjct: 248 YGLPRPVRVARDQALASGLSPMMLSFMRESRRLDNTRMKAELGARLRYPEVLLGLR 303


>gi|213400938|gb|ACJ47117.1| hypothetical protein [Wolbachia endosymbiont of Ctenocephalides
           canis]
          Length = 136

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           N + ++     TH++  I P  +GD  +    + +  +  ++KW+GYLS+TS+YG+  G 
Sbjct: 16  NKVGKDTFQDVTHVLVSIPP--DGDDVL----ERYGYYFQNIKWLGYLSATSVYGDHAGN 69

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WV E S   PI      R  +E++WL    KL I   + RL+GIYGP RN  I + Q N 
Sbjct: 70  WVTEESETKPIESRGKSRLRSEQKWL--NSKLPIH--IFRLAGIYGPGRNVLIDL-QLNK 124

Query: 175 LRLVKK 180
            R V K
Sbjct: 125 ARNVHK 130


>gi|253700869|ref|YP_003022058.1| NAD-dependent epimerase/dehydratase [Geobacter sp. M21]
 gi|251775719|gb|ACT18300.1| NAD-dependent epimerase/dehydratase [Geobacter sp. M21]
          Length = 281

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 96/187 (51%), Gaps = 10/187 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK---EWLAITKKLNIKLAVLRLSG 157
           Y+S++++YG+     V E S  +P +    +R +AE+   EW    ++ ++ + +LR++G
Sbjct: 97  YISTSAVYGDCGTATVTEESEANPQTSRGKRRLHAERLVSEW---GRERHVPVVILRVTG 153

Query: 158 IYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPA 216
           IY   R P  ++     +   +++   NRI  +D++R C+  L     G +FN+SD    
Sbjct: 154 IYAADRLPVTQLTTGQPVLREEESLPSNRIHADDLSRICLAALERGKDGALFNVSDGSST 213

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYP 273
              +    AA  + +  P +   + A   +SP    ++++ + +SN K I+ LG +LLYP
Sbjct: 214 TMTSYFNAAADRLGLPRPRQVTMEEARQVMSPLMISYFSEGRVVSNRKMIEELGIELLYP 273

Query: 274 NYRISLK 280
           +    LK
Sbjct: 274 DLESGLK 280


>gi|168699153|ref|ZP_02731430.1| hypothetical protein GobsU_06505 [Gemmata obscuriglobus UQM 2246]
          Length = 284

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 122/290 (42%), Gaps = 40/290 (13%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           +I G GY G+ +A   L  G      TRS  N   L+  G+ P +  D      LR    
Sbjct: 12  LIIGCGYLGRVVAARWLARGHRVAALTRS--NAEKLRTVGVEP-ITGDVLDPTSLRALPT 68

Query: 64  FTTHIVQCIKPSSEGDP---CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            +T +       + G P     ++   +  + +P      Y+SSTS+YG  +G WVDE S
Sbjct: 69  ASTVLYAVGFDRTAGRPMHEVYVTGLANVLRALPPCSRFVYVSSTSVYGQSDGGWVDETS 128

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP----KRNPFIKIRQKNSLR 176
              P     + R   E E L  T K +    VLR +G+YGP    +R P +     N   
Sbjct: 129 PTAPTE--DSGRVVLEAEQLLRTHKPDA--IVLRSAGLYGPHRLLRRQPVL-----NGEP 179

Query: 177 LV-KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
           L+   ++  N + V D A  V+F     H G  +NL+D  P   ++     A L+     
Sbjct: 180 LIGDADKWLNLVHVSDAADAVLFAEGKGHPGETYNLADGVPVTRRDFYTRLAELLN---- 235

Query: 235 LEQCFDTANISPFTRFFY-----ADNKRISNAKIKSLGFQLLYPNYRISL 279
                     +P  +F +     A N+RI+ +K + LG+   Y +Y  SL
Sbjct: 236 ----------APAAKFEHKPEPGAPNRRINASKFRDLGWAPQYASYHDSL 275


>gi|294053801|ref|YP_003547459.1| NAD-dependent epimerase/dehydratase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293613134|gb|ADE53289.1| NAD-dependent epimerase/dehydratase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 287

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 129/295 (43%), Gaps = 25/295 (8%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           MIFG GY G+ +A   L+ GV     TR+      LK  G+   + AD   ++   + L 
Sbjct: 1   MIFGCGYVGRALAQRLLQAGVRVGALTRNADKAAELKALGLQEVVVADLD-SDAWHDALS 59

Query: 64  FT-THIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG--------YLSSTSIYGNREG 113
            T   +V C+  +  G   +    + + +    + +W          Y SSTS+Y   EG
Sbjct: 60  GTYGAVVNCVSSAGGG---LAGYRRSYVEGQASILRWAQTQELSAYVYTSSTSVYPQSEG 116

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
             VDE + +   S  + +     +  LA      +   VLRL+GIYGP+R+ +I  + ++
Sbjct: 117 VIVDEAADLSAAS-ESGRLLLEAENLLAAGAPQGVHWTVLRLAGIYGPQRH-YILNQLRD 174

Query: 174 SLRLVKKNQV--FNRIRVEDVARCVIF-LMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
            L++   +     N +  +D+   ++  LM     GI+NL+D  P   Q ++   A  + 
Sbjct: 175 GLQVFPGSGAHRLNLVHRDDIVEGILLGLMRRGAAGIYNLADGTPVTKQALVEWIAEQLH 234

Query: 231 ITPPLEQCFDTANISP--FTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
              P    FD +   P    R     ++ I + K +  LG+   +P+YR   + L
Sbjct: 235 CPVP---SFDPSQTPPRQLRRGAQVPDRVIDSQKAQGLLGWTPKFPSYREGYRDL 286


>gi|186684763|ref|YP_001867959.1| NAD-dependent epimerase/dehydratase [Nostoc punctiforme PCC 73102]
 gi|186467215|gb|ACC83016.1| NAD-dependent epimerase/dehydratase [Nostoc punctiforme PCC 73102]
          Length = 273

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 125/284 (44%), Gaps = 26/284 (9%)

Query: 1   MHLMIFGAGYTGKFIADA-ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M++ I G GY G  +A     K+      TT S   +  L+      F+ +   +++L  
Sbjct: 1   MNVAIIGCGYVGYQVAQYWQQKMNFVVSTTTTSPERVPALQSVSQRVFVTSGNDLDSL-- 58

Query: 60  EKLYFTTHIVQCIKPSSEG----DPCIISMSKDFYKFM---PHVKWIGYLSSTSIYGNRE 112
            K       V  +   ++G    +   +  +++    +   P VK + Y  S ++YG+R 
Sbjct: 59  -KSVLHNQDVVLLSVGAKGAEVYEETYLQTAQNLVSCLQQNPSVKQLIYTGSYAVYGDRN 117

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G WVDE + + P +  A Q     ++ L      N+++ + RL GIYGP R       + 
Sbjct: 118 GVWVDEETPLAPANLNA-QILRKTEDILLSASSENLRVCIFRLGGIYGPGRELLKIFSRY 176

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNV---IMEAASLM 229
           +         + N I ++D+   + F     L GI+NL DD     +++   + E  +L 
Sbjct: 177 SGTNRPGGEDITNWIHLDDIVGAIEFARNRRLQGIYNLVDDAHLTSRDLLDSLFEKHNLP 236

Query: 230 KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           K+       +DT   S  TR +   N  +SN K+K  G+QL++P
Sbjct: 237 KV------IWDTTVKS--TRPY---NAWVSNEKLKEAGYQLIHP 269


>gi|296136844|ref|YP_003644086.1| NAD-dependent epimerase/dehydratase [Thiomonas intermedia K12]
 gi|295796966|gb|ADG31756.1| NAD-dependent epimerase/dehydratase [Thiomonas intermedia K12]
          Length = 308

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 129/296 (43%), Gaps = 20/296 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTC-GTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            L+I G G  G  +A  AL  G Y     T S   L +L+  GI P +    +   L R 
Sbjct: 11  RLLIVGCGDIGMRVA--ALARGRYRLLALTSSPQRLESLRSAGIVPLVGNLDQPQTLWRL 68

Query: 61  KLYFTTHIVQCIKPSSEGDPC------IISMSKDFYKFMPHVK---WIGYLSSTSIYGNR 111
                  ++    P     P       +IS  K         K    + Y S++ +YG+ 
Sbjct: 69  AQLAPQRVLMLAPPGDTSGPRDQRSRHLISRLKQSGILSGSGKNTLRVVYASTSGVYGDC 128

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIY-GPKRNPFIKIR 170
           +G+   E     P +  A +R +AE+ W     +   ++ +LR+ GIY G  R+P  ++ 
Sbjct: 129 QGELAPETRPCQPQTERAQRRCDAERLWRRAGVQHRWRVGLLRIPGIYDGGSRSPKGRLE 188

Query: 171 QKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASL 228
           +   + L   + V+ N I  +D+AR C++ L     G ++N+ DD      +    AA L
Sbjct: 189 RGLPV-LAHADDVYTNHIHADDLARLCLLALERAAPGRVYNVCDDSTLRMGDYFDLAADL 247

Query: 229 MKITPPLEQCFDTA---NISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
             +  P+    D A    +SP    F  +++R+ N ++K+ LG +L YP   + L+
Sbjct: 248 YGLPRPVRVARDQALASGLSPMMLSFMRESRRLDNTRMKAELGARLRYPEVLLGLR 303


>gi|213400932|gb|ACJ47114.1| hypothetical protein [Wolbachia endosymbiont of Folsomia candida]
          Length = 121

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQ 114
           N + ++     TH +  I P+  GD  I    + +  ++ ++KW+GYLS+TS+YG+  G 
Sbjct: 1   NEIDKDIFKSVTHALISIPPN--GDDVI----ERYGSYLQNIKWLGYLSATSVYGDHSGN 54

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WV E S   PI      R   EK+WL       + + + RL+GIYGP RN  I + Q   
Sbjct: 55  WVTEESETKPIERRGKDRLKHEKKWL----DSGLPVHIFRLAGIYGPGRNVLIDL-QLGK 109

Query: 175 LRLVKKNQVF 184
            R VKK   F
Sbjct: 110 ARNVKKEGHF 119


>gi|254445603|ref|ZP_05059079.1| NAD dependent epimerase/dehydratase family [Verrucomicrobiae
           bacterium DG1235]
 gi|198259911|gb|EDY84219.1| NAD dependent epimerase/dehydratase family [Verrucomicrobiae
           bacterium DG1235]
          Length = 349

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 122/281 (43%), Gaps = 28/281 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF--LFADQKINNLLRE 60
           L++ G GY G  + D A+  G+     +R++  L   +  G   F  +  +   +     
Sbjct: 55  LLVLGCGYLGTRLVDEAVSRGMRVKAVSRNLDTLAEARSIGADVFEGMVDEAGWHEFAGS 114

Query: 61  KLYFTTHIVQCIKPSSEG----DPCIISMSKDFYKFMPHVKWIG---YLSSTSIYGNREG 113
           ++ F   +V C+  +  G        I  ++   K+     + G   Y SS S+YG+  G
Sbjct: 115 EVDF---VVNCVSSAGGGLAGYRQSYIGGNESLCKWAEQSGFEGRAIYTSSVSVYGDAGG 171

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWL-AITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
            WVDE S   P +   +    +E  +L  + K   +   VLRL+G+YGP R+  +   ++
Sbjct: 172 DWVDEDSDCDPSNERGSLVRESEAVFLDGLWKGTGV---VLRLAGLYGPGRHIMLNRLKE 228

Query: 173 NSLRLVKKNQVF-NRIRVEDVARCV-----IFLMTHHLGGIFNLSDDEPAPPQNVI-MEA 225
               L      + N +R+EDV   V        +T    GI+ + DDEPA  Q+++   A
Sbjct: 229 GPGELPGWGDYYLNLVRIEDVVSAVRACLEAVALTE---GIYTVVDDEPALKQDMVEWLA 285

Query: 226 ASLMKITPPLEQCFDTANISP--FTRFFYADNKRISNAKIK 264
            +L    P      D++  +           N+RISNAK+K
Sbjct: 286 GTLGTPVPEFSGRADSSGRASRRLGETGRPANRRISNAKLK 326


>gi|322419769|ref|YP_004198992.1| NAD-dependent epimerase/dehydratase [Geobacter sp. M18]
 gi|320126156|gb|ADW13716.1| NAD-dependent epimerase/dehydratase [Geobacter sp. M18]
          Length = 280

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 126/293 (43%), Gaps = 32/293 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNL----- 57
           L+I G G  G+ +A  AL  G+  C   R           G +P   A     NL     
Sbjct: 4   LLIVGCGAVGRRVAALALAQGMSVCTFNR-----------GEAPLAGAQHHAGNLDEPDT 52

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV------KWIGYLSSTSIYGNR 111
           LR        ++    P   G    I  ++  + F+  +      + + Y+S++ +YG  
Sbjct: 53  LRGLPTRGAGVIYLAPPPGGG----IEDTR-MWAFLFSIAAGDEPEKVVYISTSGVYGGG 107

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
             + V E +   P +    +R +AE+   A  K+  + + VLR++ IY   R P  ++  
Sbjct: 108 N-EVVTEETEPDPQTARGKRRLHAERLLQAWGKERGVAVVVLRVTAIYAADRLPVTQLST 166

Query: 172 KNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
              +   ++    NRI  +D++R C+  L     G +FN+SD  P+        AA  + 
Sbjct: 167 GQPVLREEEALPSNRIHADDLSRVCLAALERGKDGAVFNVSDGAPSTMTAYFNAAADKLG 226

Query: 231 ITPPLEQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLK 280
           +  P +   + A   ++P    ++++ + + ++K +K LG  LLYP+    LK
Sbjct: 227 LPRPRQVSMEEARKVMTPLMISYFSEGRVVDSSKMLKELGITLLYPDLEAGLK 279


>gi|298492889|ref|YP_003723066.1| NAD-dependent epimerase/dehydratase ['Nostoc azollae' 0708]
 gi|298234807|gb|ADI65943.1| NAD-dependent epimerase/dehydratase ['Nostoc azollae' 0708]
          Length = 274

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 125/284 (44%), Gaps = 25/284 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALK----VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINN 56
           M++ I G GY G  ++    +    +   T  T   V  L T+  K I       + + +
Sbjct: 1   MNIAIIGCGYVGYAVSQYWQQNKNFIITATTTTPERVPGLRTVAQKVIVTEGNDLESLKS 60

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM---PHVKWIGYLSSTSIYGNREG 113
           +L+ +      +    K ++  +   +  +K+    +   P+ + + Y  S S+YG+R G
Sbjct: 61  VLQNQDVILLSV--GAKAATTYEETYLQTAKNLVSLLRTLPNTQQLIYTGSYSVYGDRNG 118

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI--RQ 171
            WVDE +   P +  A Q     ++ L   +   +++ +LRL GIYGP R   +KI  R 
Sbjct: 119 VWVDEETPTAPPNLNA-QILRKTEDVLLSAENETLRVCILRLGGIYGPGRE-LVKIFGRI 176

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
             +    K   + N + +ED+   + F   H L GI+NL DD     + +I     L K 
Sbjct: 177 AGTTCPGKGEDISNWVHLEDIVGVIEFARYHRLQGIYNLVDDSHLTSRELIDNV--LTKN 234

Query: 232 TPPLEQCFDTANIS--PFTRFFYADNKRISNAKIKSLGFQLLYP 273
             P    +D  N S  P+       N  +SN K+K  G++ ++P
Sbjct: 235 NLP-NVIWDVTNKSNRPY-------NTWVSNQKLKDAGYEFIHP 270


>gi|56476399|ref|YP_157988.1| putative oxidoreductase protein [Aromatoleum aromaticum EbN1]
 gi|56312442|emb|CAI07087.1| putative oxidoreductase protein [Aromatoleum aromaticum EbN1]
          Length = 295

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 125/282 (44%), Gaps = 10/282 (3%)

Query: 2   HLMIFGAGYTG-KFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            ++I G+G    + I   A +  VY    TRS +    L+ +G  P L AD      L  
Sbjct: 3   RILIVGSGDVAMRAIPWLAKRFRVYA--VTRSPAACAALRSRGAIPLL-ADLDDRRSLAR 59

Query: 61  KLYFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
                  ++    P + G  DP    +     +     + + Y+S+T +YG+  G WV E
Sbjct: 60  LAGIADVVLHFAPPPAHGIQDPRTAWLLAALAQRPSLPQRVIYISTTGVYGDCGGAWVGE 119

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            S   P +  A +R +AE+      ++  + +++LR  GIY  +R P  ++++   + L 
Sbjct: 120 ASRCMPRTDRARRRVDAERRLRRFGRRCAVAVSILRAPGIYAAERLPLARLQRGEPVLLA 179

Query: 179 KKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI--TPPL 235
            ++   N I  +D+A+   + +     G ++N  DD      +    AA    +   P +
Sbjct: 180 AQDVHTNHIHADDLAQLACLAIFRGRPGRVYNAVDDTSMKMGDYFDFAADFFGVPRPPRM 239

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYR 276
            +    A +SP    F ++++R+SN +I + L  +L YP  R
Sbjct: 240 SRADIAAALSPMALSFMSESRRLSNERIRRELRARLKYPTVR 281


>gi|149926231|ref|ZP_01914493.1| Nucleoside-diphosphate-sugar epimerase [Limnobacter sp. MED105]
 gi|149825049|gb|EDM84261.1| Nucleoside-diphosphate-sugar epimerase [Limnobacter sp. MED105]
          Length = 299

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 93/181 (51%), Gaps = 8/181 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S+T +YGN +GQW++E++ ++  S  A +R +AE + L +  K  + + +LR  GI
Sbjct: 113 ISYVSTTGVYGNAQGQWINEYTPLNAQSERAKRRVHAETQ-LRLGLKHGVHVHLLRAPGI 171

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIF---NLSDDEP 215
           YG  R P  +I+ +    L  ++   N I   D+ R   ++  ++ GG F   N  D +P
Sbjct: 172 YGDDRLPIDRIKNRTPALLPDEDAWSNHIHELDLGRLSRWV--NYKGGTFEVLNACDAKP 229

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           +   +     A   ++  P     +     +SP    F ++++RI +   K LGF+L YP
Sbjct: 230 SKMGDYFDMVADAYQLPRPPRFSREEVKRMVSPMMWSFMSESRRIESLNQKKLGFRLRYP 289

Query: 274 N 274
           +
Sbjct: 290 S 290


>gi|197118349|ref|YP_002138776.1| NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
           [Geobacter bemidjiensis Bem]
 gi|197087709|gb|ACH38980.1| NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
           [Geobacter bemidjiensis Bem]
          Length = 281

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 94/184 (51%), Gaps = 4/184 (2%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++++YG+     V E S  +P +    +R +AE+      ++ ++ + +LR++ IY 
Sbjct: 97  YISTSAVYGDCGTATVTEESEANPQTSRGKRRLHAERLLSDWGRERHVPVVILRVTAIYA 156

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQ 219
             R P  ++     +   +++   NRI  +D++R C+  L     G IFN+SD +     
Sbjct: 157 ADRLPVTQLTTGQPVLREEESLPSNRIHADDLSRICLAALERGKDGAIFNVSDGQSTTMT 216

Query: 220 NVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYR 276
           +    AA  + +  P +   + A   +SP    ++++ + +SN K I+ LG +LLYP+  
Sbjct: 217 SYFNAAADRLGLPRPRQVAMEEARRVMSPLMISYFSEGRVVSNRKMIEELGIELLYPDLE 276

Query: 277 ISLK 280
             LK
Sbjct: 277 SGLK 280


>gi|330812605|ref|YP_004357067.1| hypothetical protein PSEBR_a5536 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380713|gb|AEA72063.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 285

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 94/183 (51%), Gaps = 23/183 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+S+YG ++G+WVDE S    ++   + R   E E +A+     I  + +RL+GIYG
Sbjct: 108 FVSSSSVYGQQQGEWVDETSPT--VAGGYSGRLMLEAEQVALDS--GIPASRVRLTGIYG 163

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDD 213
           P R   + ++RQ    R+V    ++ NRI  +D A  + FL+     G      +   DD
Sbjct: 164 PGREWLLSQVRQ--GYRVVIDPPLYANRIHADDAAGLLAFLLEADRQGQVLDDCYIGVDD 221

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
            PAP   V+      M +T    Q  + A++        A +KR SNA+ K+LG+   YP
Sbjct: 222 APAPLAEVVGWLREYMGVT----QWSEDASVR------RAGSKRCSNARAKALGWAPRYP 271

Query: 274 NYR 276
           ++R
Sbjct: 272 SFR 274


>gi|39997741|ref|NP_953692.1| hypothetical protein GSU2647 [Geobacter sulfurreducens PCA]
 gi|39984633|gb|AAR36019.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506676|gb|ADI85399.1| NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
           [Geobacter sulfurreducens KN400]
          Length = 289

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 120/283 (42%), Gaps = 10/283 (3%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYF 64
           I G G  GK +A  AL  G       RS     +L+  G++       + ++L    +  
Sbjct: 6   IVGCGDIGKKVARIALADGAGVAALIRSPEKAESLREMGVTALEANLDERDSLA--GMPT 63

Query: 65  TTHIVQCIKPSSEG---DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
              +V    P   G   DP + +   D        + I YLS++ +YG+  G  V E + 
Sbjct: 64  RGAVVFYFAPPPGGGVTDPRVRAFC-DAIAPGEEPRKIVYLSTSGVYGDCGGDVVTEETP 122

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKN 181
            +P +  A +R++AE  +     +  + + +LR++GIYGP R P  ++     +      
Sbjct: 123 PNPQTSRARRRYDAETVFRQWGAERGVPVVILRVTGIYGPGRLPLQQLTSGQPVLEESLA 182

Query: 182 QVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
              NRI  ED+AR  +    H   G IFN+SD  P          A  + +  P     +
Sbjct: 183 PFTNRIHSEDLARICLAAAEHGEDGDIFNVSDGHPTTMTAYFDACADALGLPRPRRVTLE 242

Query: 241 TAN--ISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLK 280
            A   ++P    +  +++++ N  ++  L   LLYP  +  ++
Sbjct: 243 EARRVMTPLMFSYVTESRKMDNRLMREKLHVTLLYPTMQEGVR 285


>gi|253998400|ref|YP_003050463.1| NAD-dependent epimerase/dehydratase [Methylovorus sp. SIP3-4]
 gi|253985079|gb|ACT49936.1| NAD-dependent epimerase/dehydratase [Methylovorus sp. SIP3-4]
          Length = 284

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 124/298 (41%), Gaps = 33/298 (11%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           ++ G G  G+ +A      G+   G  RS ++L    H      L AD      L+    
Sbjct: 6   LVVGCGDLGQAVASLLQDGGLEVYGLKRSATDLPAGVH-----LLQADVTQPETLQGLAA 60

Query: 64  FTTHIV-QCIKPSSEGDPCIISMSKDFYK------FMPHVKWIGYLSSTSIYGNREGQWV 116
               IV  C+   +  D    +   D  +           + + ++SST +YG      +
Sbjct: 61  LKPRIVIYCVAADAHRDDSYRAHYVDGLRNTLAALRQAPPEHVFFVSSTGVYGQVSDDLL 120

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE +   P      +   AE+    + ++      +LR SGIYGP R   + + ++ + R
Sbjct: 121 DEATIPLPDGFSGERMLQAEQ---LLAREYPAAHTILRFSGIYGPGRRRMLDLAREPA-R 176

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASLMKI 231
              +N   NRI  +D A  + +L+     G     ++ ++DD PA    V+   A  M +
Sbjct: 177 WPAQNGWTNRIHRDDGAAAIAYLVKQLFSGKPVEPLYVVTDDRPASQYEVLQWLAQQMGV 236

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
           +       D    +P      + NKR+SN +++  GFQL YP+Y+     L ++ ENL
Sbjct: 237 S-------DAPQDAPAI----SGNKRLSNQRLRHTGFQLRYPDYQTGYAALLEQ-ENL 282


>gi|126666525|ref|ZP_01737503.1| Nucleoside-diphosphate-sugar epimerase [Marinobacter sp. ELB17]
 gi|126628913|gb|EAZ99532.1| Nucleoside-diphosphate-sugar epimerase [Marinobacter sp. ELB17]
          Length = 292

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 113/294 (38%), Gaps = 30/294 (10%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
             +++ G G  G  IA   L+ G    G  R    L     +G++P + AD  +   L+ 
Sbjct: 10  QRILLAGCGNLGGAIATLLLQSGANVFGLRRRTDQL----PQGVTP-VAADLTLPATLKN 64

Query: 61  KLY-FTTHIVQCIKPS---SEG--DPCIISMSKDFYKFMPHV-KWIGYLSSTSIYGNREG 113
            L      ++ C+ PS   ++G     +  +    Y+        + ++SST +YG  + 
Sbjct: 65  TLPPRLDQVIYCLTPSDYTAQGYHAAYVEGLENLLYELQGQTPNRLFFISSTGVYGQDDN 124

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
            WVDE S   P      Q    E+  LA      I   V+R SGIYGP R  F++     
Sbjct: 125 GWVDEESATQPGGFSGRQVLLGEQTALAS----RIPATVVRFSGIYGPSRQSFLQAVMDG 180

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASL 228
            L     +   NRI  +D  R ++ L T    G      +  SD EP     V+      
Sbjct: 181 RLNPPDHSNYSNRIHEQDAIRAIVHLSTMAAAGETLQSCYLASDCEPVRLDQVVRWVRQH 240

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
                P         +          +K  SN ++   GF+  YP++R   ++L
Sbjct: 241 TDCEEPAGDARSGGRVG---------SKLCSNRRLLKTGFEFRYPDFRAGYREL 285


>gi|282890057|ref|ZP_06298590.1| hypothetical protein pah_c010o047 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500063|gb|EFB42349.1| hypothetical protein pah_c010o047 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 271

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 118/277 (42%), Gaps = 23/277 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTR--SVSNLLTLKHKGISPFLFADQKINNLL 58
           +++ I G GY GK  A +       T  T R   +  L T   K     +  ++  ++LL
Sbjct: 5   LNIGILGCGYVGKAAAQSLQHQHCVTASTRRLNRIEELSTYATK----VVLLEKSFDSLL 60

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM---PHVKWIGYLSSTSIYGNREGQW 115
            E+      +      S E   C +  ++   + +   P +K I Y SSTS+YG  +G W
Sbjct: 61  EEQDILIVSVAPSQNDSYE--QCYLETARAITQSIADYPRIKQIIYTSSTSVYGEHQGAW 118

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           VDE +   P +         E   L++  +  + + +LRL  I+GP R    +       
Sbjct: 119 VDEDTEPKPSNKKTCILLETENTLLSLASE-TLSICILRLGEIFGPGRELINRFNSHERK 177

Query: 176 RLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP- 233
                 + F N   + D+ + + + + + LGGI+NL  DE  PP+ ++ E        P 
Sbjct: 178 IFPGSGENFTNLTPLRDIVQVINYAINNSLGGIYNLCLDE-HPPRKLLYEQICKRNNFPV 236

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
           PL   +DT       +  +  NKR+   KIK  G+ L
Sbjct: 237 PL---WDTQK-----QTIHVGNKRVLCDKIKLTGYSL 265


>gi|332526033|ref|ZP_08402171.1| NAD-dependent epimerase/dehydratase [Rubrivivax benzoatilyticus
           JA2]
 gi|332109876|gb|EGJ10504.1| NAD-dependent epimerase/dehydratase [Rubrivivax benzoatilyticus
           JA2]
          Length = 287

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 97/207 (46%), Gaps = 8/207 (3%)

Query: 75  SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN 134
             +GDP   ++ +   +    V+ + Y S+T +YG+  G   DE   V P +  A +R +
Sbjct: 73  EGDGDPRTRALLQALARAG-RVQTLVYASTTGVYGDAGGARFDETRAVAPATPRARRRVD 131

Query: 135 AEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVFNRIRVED 191
           AE++     ++  +++AVLR+ GIY P R   +P  ++R+   L L   +   N +  +D
Sbjct: 132 AEEQVRRFGRRHGVRVAVLRVPGIYAPDREGGDPRERVRRGAPLLLPPHDPYTNHVHADD 191

Query: 192 VAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA--NISPFT 248
           +AR CV  L+      +++ SDD      +     A +  +  P     D A   +   T
Sbjct: 192 LARICVATLLRAAPQRVYHASDDGEFTMGDYYELVARVCGLPAPPRVTRDEARRTLGAMT 251

Query: 249 RFFYADNKRISNAKIK-SLGFQLLYPN 274
             F  +++R+ N ++K  L   L YP 
Sbjct: 252 MSFLGESRRLDNTRLKRELRVALRYPT 278


>gi|307730741|ref|YP_003907965.1| hypothetical protein BC1003_2721 [Burkholderia sp. CCGE1003]
 gi|307585276|gb|ADN58674.1| hypothetical protein BC1003_2721 [Burkholderia sp. CCGE1003]
          Length = 346

 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 90/180 (50%), Gaps = 8/180 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE     P +  A +R +AE++    T +  I  ++ R+ GIY 
Sbjct: 153 YASTTGVYGDCGGAWIDETRAAKPANARAKRRMSAERQLRRATARGTIAASIARIPGIYA 212

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  L+  + V+ N I  +D+A  ++ L TH     + + SDD     
Sbjct: 213 GNRLPLARL-EKRTPALIDADDVYTNHIHADDLAAILVRLATHGRPARVIHASDDSSLKM 271

Query: 219 Q---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
               +++ +A  L +  P + +      I P    F  +++R+ N ++K  LG +L YP+
Sbjct: 272 GEYFDLVADAFGLAR-APRITRAQAEQQIEPTLLSFMRESRRLVNRRLKEELGVRLRYPS 330


>gi|146280533|ref|YP_001170686.1| epimerase/dehydratase-related protein [Pseudomonas stutzeri A1501]
 gi|145568738|gb|ABP77844.1| epimerase/dehydratase-related protein [Pseudomonas stutzeri A1501]
          Length = 286

 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 87/188 (46%), Gaps = 21/188 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +Y  R+G+W+DE S   P          AE+    +     +    +R+ G+Y 
Sbjct: 109 FVSSTGVYAQRDGEWIDEDSPTEPTGFTGQVMLEAEQ----LALGCGLPATCVRMGGLYD 164

Query: 161 PKRNPFIKIRQKNSLRLVKK-NQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-----DDE 214
           P R P+++ + +  LR+ +   Q  NRI  +D A  + FL+     G    S     DDE
Sbjct: 165 PSR-PWLQNQVRAGLRVERDPPQYSNRIHRDDAAALLSFLLQADASGTALQSCYLGVDDE 223

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PAP   V+      + +T   EQ          TR   A +KR SNA+ ++LG++  + +
Sbjct: 224 PAPLHEVVDWLRERLGVTHWAEQS--------MTR--RAGSKRCSNARARALGWKPRFAS 273

Query: 275 YRISLKQL 282
           YR     L
Sbjct: 274 YRDGYASL 281


>gi|213400926|gb|ACJ47111.1| hypothetical protein [Wolbachia endosymbiont of Tribolium confusum]
          Length = 130

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 73/133 (54%), Gaps = 14/133 (10%)

Query: 48  LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
           LF  +K++  L   L   TH++  I P  +GD  +    + +   + ++KW+GYLS+T++
Sbjct: 9   LFDYEKVDQDL---LKSVTHVLVSIPP--DGDDVM----ERYGHCLENIKWLGYLSATNV 59

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           Y +  G WV+E S   PI     +R  +EK+WL+      + + + RL+GIYGP RN  I
Sbjct: 60  YSDHCGNWVNEESETKPIEIRGEKRLESEKKWLSS----KLPVHIFRLAGIYGPGRNALI 115

Query: 168 KIRQKNSLRLVKK 180
            + Q    R VKK
Sbjct: 116 DL-QLGKARNVKK 127


>gi|110742622|dbj|BAE99223.1| hypothetical protein [Arabidopsis thaliana]
          Length = 143

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 63/106 (59%), Gaps = 4/106 (3%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           +++W+ YLSSTS+YG+  G WV+E+   +P +  A  R  AE+ WL++ + L +   +LR
Sbjct: 16  NLRWLCYLSSTSVYGDCGGAWVNENHLPNPKTQSAKVRLAAEQGWLSLGRDLGVSTQILR 75

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQV----FNRIRVEDVARCV 196
           L GIYGP R+    + ++  L   +K +      +R+ VED+ + +
Sbjct: 76  LGGIYGPGRSAIDTLLKQERLSEGQKRRASRKFTSRVHVEDICQVL 121


>gi|307546998|ref|YP_003899477.1| NAD-dependent epimerase/dehydratase [Halomonas elongata DSM 2581]
 gi|307219022|emb|CBV44292.1| NAD-dependent epimerase/dehydratase [Halomonas elongata DSM 2581]
          Length = 292

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 119/294 (40%), Gaps = 31/294 (10%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           +I G G  G  +      VG    G  R    L     +G+S  L   + +  L    + 
Sbjct: 6   LILGCGDIGTVLGKELHGVGHRVVGVRRDARELAGTAIEGVSADLGDAEALAALPDADIL 65

Query: 64  --------FTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
                   F     +   P       + ++  +F +     + + ++SSTS+Y  ++G+ 
Sbjct: 66  VYVVSADRFEEDAYRAAYPDG-----LKAVLAEFAERKRAPRHVFFVSSTSVYAQQDGEV 120

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           VDE S   P     T    AE+  +    +  +  +V+R SGIYGP R+  I+   +  +
Sbjct: 121 VDEESPTEPRGFSGTLMREAEQALV----EHRLPGSVVRFSGIYGPGRDRLIRQVGEGRI 176

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASLMK 230
                    NRI  +D A  +  L+   L G     ++  SD EPAP   V+   A  +K
Sbjct: 177 AAATPTMYSNRIHRDDCAGVLAHLIERALAGETLHDLYLASDCEPAPIHEVMTWLAKQLK 236

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWK 284
           +     +  +T   SP  R     +KR  N ++   G++  YP+YR    Q+ +
Sbjct: 237 V-----ESSETIQ-SPLRRRA---SKRCDNTRLLESGYRFRYPSYREGYAQVLR 281


>gi|56460181|ref|YP_155462.1| NAD-dependent epimerase/dehydratase [Idiomarina loihiensis L2TR]
 gi|56179191|gb|AAV81913.1| Capsular polyglutamate biosynthesis secreted protein CapB,
           ATP-dependent mur ligase family [Idiomarina loihiensis
           L2TR]
          Length = 280

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 87/178 (48%), Gaps = 17/178 (9%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+SST +Y  R+G+W+DE+S   P S        AE    +I   L  + ++LR SGIYG
Sbjct: 106 YVSSTGVYAQRDGEWIDENSATEPTSDSGKALLQAE----SIINALPGQTSILRCSGIYG 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH--HLGGIFNLSDDEPAPP 218
             R+  ++   + +++L  ++   NRI  +DVA  ++ L+T       ++ ++DDEP   
Sbjct: 162 EGRDFLLRQLTQGNVQL--RDSWTNRIHQDDVAGFIVHLLTQVNQPKPVYLVNDDEPVKQ 219

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
             V    A  + I           NI+   +     +KR  N  +K  G+QL Y N+R
Sbjct: 220 YEVYQWLAEQLGIEL-------AGNIN--KKVGPRGSKRCMNKGLKDSGYQLQYANFR 268


>gi|296157143|ref|ZP_06839979.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. Ch1-1]
 gi|295892479|gb|EFG72261.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. Ch1-1]
          Length = 341

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 6/189 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE     P +  A +R +AE++   +T + ++   + R+ GIY 
Sbjct: 153 YASTTGVYGDCGGAWIDETRVTQPANARARRRVSAERQLRRVTARGSVAARIARIPGIYA 212

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  L+  + V+ N I  +D+A  ++ L TH   G + + SDD     
Sbjct: 213 GNRLPLARL-EKGTPALIDADDVYTNHIHADDLAAILVRLATHGRPGRVVHASDDSSLKM 271

Query: 219 QNVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
                E A    +   P + +      I P    F  +++R+ N ++K  L  +L YP+ 
Sbjct: 272 GEYFDEVADAFGLPRAPRITRDEAEQQIEPTLLSFMRESRRLLNRRLKQELSVRLRYPSV 331

Query: 276 RISLKQLWK 284
              L++  K
Sbjct: 332 EDFLRESVK 340


>gi|213400924|gb|ACJ47110.1| hypothetical protein [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 130

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 18/135 (13%)

Query: 48  LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
           LF  +K++  L   L   TH++  I P  +GD  +    + +   + ++KW+GYLS+T++
Sbjct: 9   LFNYEKVDQDL---LKSVTHVLVSIPP--DGDDVM----ERYGHCLENIKWLGYLSATNV 59

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LRLSGIYGPKRNP 165
           YG   G WV+E S   PI     +R  +E++W      LN KL V   RL+GIYGP RN 
Sbjct: 60  YGEHCGNWVNEESETKPIEIRGKKRLKSEEKW------LNSKLPVHIFRLAGIYGPGRNA 113

Query: 166 FIKIRQKNSLRLVKK 180
            I + Q    R VKK
Sbjct: 114 LIDL-QLGKARNVKK 127


>gi|330505641|ref|YP_004382510.1| NAD-dependent epimerase/dehydratase [Pseudomonas mendocina NK-01]
 gi|328919927|gb|AEB60758.1| NAD-dependent epimerase/dehydratase [Pseudomonas mendocina NK-01]
          Length = 285

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 86/182 (47%), Gaps = 21/182 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS+ +YG +EG+W+DE S     S  A     AE+    +     +    +RL+G+YG
Sbjct: 109 FASSSGVYGQQEGEWIDEDSPAEAQSFSAVIMREAER----VALGSGLSATTVRLTGLYG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDE 214
           P R  ++  + +   R+ +   ++ NRI V+D A     L+   + G      +   DDE
Sbjct: 165 PGRE-WLLSQVRGGYRVSETPPLYGNRIHVDDAAGLFATLLQADVAGKPLADCYLGVDDE 223

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PAP          L ++   L +    ++ S   R   A +KR SNA+  +LG+   YP+
Sbjct: 224 PAP----------LHEVVAWLREQLGVSHWSDEQRVRRAGSKRCSNARACALGWAPQYPS 273

Query: 275 YR 276
           YR
Sbjct: 274 YR 275


>gi|291612746|ref|YP_003522903.1| NAD-dependent epimerase/dehydratase [Sideroxydans lithotrophicus
           ES-1]
 gi|291582858|gb|ADE10516.1| NAD-dependent epimerase/dehydratase [Sideroxydans lithotrophicus
           ES-1]
          Length = 287

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 94/190 (49%), Gaps = 8/190 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++ +YG+  G +VDE    HP +  A +R +AEK+     ++  ++  +LR+ GIY 
Sbjct: 98  YISTSGVYGDCGGAYVDETRHAHPQTARAQRRVDAEKQIRRWARRNGVQATILRVPGIYA 157

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQ 219
            +R P  +IR      +  ++   N I  +D+AR ++  L       +++ SDD      
Sbjct: 158 AERLPLERIRSGTPALVAAEDGYTNHIHADDLARIIVAALQRGKPNRVYHASDDGEMKMG 217

Query: 220 ---NVIMEAASLMKITPPLEQCFDTANISPFTRF-FYADNKRISNAKIK-SLGFQLLYPN 274
              +V+ +A  L +  PP     +   + P +   F  +++R+ N ++K  LG +L Y  
Sbjct: 218 DYFDVVADAYQLPR--PPRISRAEAQRVLPESLLSFVNESRRLGNGRMKRELGVRLQYST 275

Query: 275 YRISLKQLWK 284
               LK L++
Sbjct: 276 VMDLLKYLYR 285


>gi|114319696|ref|YP_741379.1| NAD-dependent epimerase/dehydratase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226090|gb|ABI55889.1| NAD-dependent epimerase/dehydratase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 283

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 87/177 (49%), Gaps = 17/177 (9%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SSTS+YG+ +G+WVDE +   P    AT+R  A      + ++  ++  V+R SGIYG
Sbjct: 108 FVSSTSVYGHDDGRWVDEWTEPTP----ATRRAEALLASEQLARESGLETTVVRFSGIYG 163

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDD-EPAPPQ 219
           P R   +++ ++   R  + N   NRI  ED  R +  L    +     ++ D EP    
Sbjct: 164 PGREYLVRLAREG--RPCRPNHWTNRIHHEDCVRALAHLRLRDVEATTYIATDCEPVRQC 221

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            V+   A  +    P     D    +P T       KR+SN+ + + GF+ LYP+YR
Sbjct: 222 EVLDWLADRVGADRPPRADSD----APVT------GKRLSNSFLLASGFRFLYPDYR 268


>gi|313200476|ref|YP_004039134.1| nad-dependent epimerase/dehydratase [Methylovorus sp. MP688]
 gi|312439792|gb|ADQ83898.1| NAD-dependent epimerase/dehydratase [Methylovorus sp. MP688]
          Length = 282

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 123/298 (41%), Gaps = 33/298 (11%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           ++ G G  G+ +A      G+   G  RS ++L    H      L AD      L+    
Sbjct: 6   LVVGCGDLGQAVASLLQDGGLEVYGLKRSATDLPAGVH-----LLQADVTQPETLQGLAA 60

Query: 64  FTTHIV-QCIKPSSEGDPCIISMSKDFYK------FMPHVKWIGYLSSTSIYGNREGQWV 116
               IV  C+   +  D    +   D  +           + + ++SST +YG      +
Sbjct: 61  LKPRIVIYCVAADAHRDDSYRAHYVDGLRNTLAALRQAPPEHVFFVSSTGVYGQVSDDLL 120

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           DE +   P      +   AE+    +  +      +LR SGIYGP R   + + ++ + R
Sbjct: 121 DEATLPVPDGFSGERMLQAEQ---LLASEYPAAHTILRFSGIYGPGRRRMLDLAREPA-R 176

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASLMKI 231
              +N   NRI  +D A  + +L+     G     ++ ++DD PA    V+   A  M +
Sbjct: 177 WPAQNGWTNRIHRDDGAAAIAYLVKQLFAGKPVELLYVVTDDRPASQYEVLQWLAQQMGV 236

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
            P   Q  D   IS         NKR+SN +++  GFQL YP+Y+     L ++ ENL
Sbjct: 237 -PDAPQ--DAPAIS--------GNKRLSNQRLRHTGFQLRYPDYQTGYAALLEQ-ENL 282


>gi|317968748|ref|ZP_07970138.1| hypothetical protein SCB02_04343 [Synechococcus sp. CB0205]
          Length = 296

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 127/288 (44%), Gaps = 37/288 (12%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLREKL 62
           + G GY G  +       G     T R  +    ++  G +P L   A  + N    E+L
Sbjct: 7   VIGCGYVGSAVCRRLSFAGHDVLATIRDEARFPRVEALGATPTLLDLASDQANFSFLEEL 66

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVK--------WIGYLSSTSIYGNREGQ 114
                ++  + P+ + +      SK     +  +K         I Y+S+  ++G++ GQ
Sbjct: 67  ---DGLLISVAPTRQDESYEEVFSKGIKNLVQALKICPRHRPLHITYISTVGVFGDQGGQ 123

Query: 115 WVDEHSFV---HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
            V E S +   HPI+ +  +   AE++ L + +  N  + VLRL GIYGP R+  + + Q
Sbjct: 124 EVGEGSPLDRSHPINRLLIE---AEQQLLDL-QGPNWSVCVLRLGGIYGPGRD-MVSLVQ 178

Query: 172 KNSLRLVKKN--QVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ---NVIMEAA 226
           + + R + ++   +     +ED++R V F  +H L G FNL DD     +   N+I E  
Sbjct: 179 QAAGRQISRDGDHIPAWTHLEDISRGVEFAWSHDLKGTFNLVDDMRLTRRQLSNIICERR 238

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            L    PP+  C   +            N  +SNAKIK  GF  L P+
Sbjct: 239 GL----PPVIWCGAPSGARVV-------NASVSNAKIKRRGFTFLSPS 275


>gi|32471727|ref|NP_864720.1| nucleoside-diphosphate-sugar epimerase [Rhodopirellula baltica SH
           1]
 gi|32397098|emb|CAD72402.1| conserved hypothetical protein-putative
           nucleoside-diphosphate-sugar epimerase [Rhodopirellula
           baltica SH 1]
          Length = 407

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 116/297 (39%), Gaps = 26/297 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G GY G+ +   A + G     TTRS     TL  +G  P  F          ++L
Sbjct: 111 LLIVGCGYLGRRVGRLAQRAGWQIHATTRS--RFETLAAEGFHPIAFDWNDSRTF--DRL 166

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKD-FYKFMPHVK---------WIGYLSSTSIYGNRE 112
             TTH++  +           +   D   + + H+           + Y+S+T +Y    
Sbjct: 167 PTTTHVLIAVAYDRHSRVDRYASQVDGLARLIRHLDNGRPTDQSADVCYISTTGVYHQTG 226

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G WVDE S  HP          AE +  ++  ++      LRL+GIYGP R P       
Sbjct: 227 GVWVDETSPTHPTREGGKAHLAAEAKLRSL--RVGRPTTTLRLAGIYGPDRVPRAADVIA 284

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVI------FLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
                   +   N I V+D A  V+         +     ++ ++DDEP   +    E A
Sbjct: 285 ERPIASPPHGHLNLIHVDDAATAVMNSFDNQRFASRARSPLYVVADDEPVVRREFYREIA 344

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
              + T   E  F         RF    +KRI N ++ + L  Q+ YP YR  L+ +
Sbjct: 345 ---RATRSAEPTFVDPAADSGVRFRSETDKRIWNRRVRRDLLPQMRYPTYREGLRDV 398


>gi|116075228|ref|ZP_01472488.1| hypothetical protein RS9916_26749 [Synechococcus sp. RS9916]
 gi|116067425|gb|EAU73179.1| hypothetical protein RS9916_26749 [Synechococcus sp. RS9916]
          Length = 282

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 128/291 (43%), Gaps = 30/291 (10%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRS---VSNLLTLKHKGISPFLFADQKINNLLREK 61
           + G GY G  +A      G +  GTTRS   +  L  L H+     L  D   +    + 
Sbjct: 6   VIGCGYVGSDVAVLMKAGGHHVVGTTRSAERIPELQELVHEAHQVDL-TDPDGDLSFVDD 64

Query: 62  LYFTTHIVQCIKPSSEGD-------PCIISMSKDFYKFMPHVKW-IGYLSSTSIYGNREG 113
           L     ++  + P+ +G+         I  + +   +   H    +  +SST +YG+++G
Sbjct: 65  L---DGLLISVAPTQQGEGYRSVFAQGISRLGRALRRRTSHRPLHVTLISSTGVYGDQQG 121

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
           Q VDE S +   + +      AE + L+I +  +  + VLRL GIYGP R+    I++  
Sbjct: 122 QAVDEESRLDTSNPINALLAAAEDQLLSIDRP-DTGICVLRLGGIYGPGRDMVAMIQRAA 180

Query: 174 SLRLVKK-NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLM--- 229
             ++ K  N V     + D+ + V F   H+L GI+NL DD     Q    E ++L+   
Sbjct: 181 GQQVPKNGNAVPAWSGILDITQGVAFAFRHNLRGIYNLVDDM----QLSRRELSTLICDR 236

Query: 230 KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLK 280
              PP+       N S         N R+SN KIK  GF+   P+   ++K
Sbjct: 237 DGLPPVLWGHSEPNGSRML------NARVSNRKIKDAGFRFSSPSMLEAVK 281


>gi|116669466|ref|YP_830399.1| NAD-dependent epimerase/dehydratase [Arthrobacter sp. FB24]
 gi|116609575|gb|ABK02299.1| NAD-dependent epimerase/dehydratase [Arthrobacter sp. FB24]
          Length = 301

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 83/186 (44%), Gaps = 8/186 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN--IKLAVLRLSGI 158
           ++SST++YG+ +G WVDE +   P     + R   E E L   + L   I   VLRL GI
Sbjct: 111 FVSSTAVYGDADGGWVDESTAPAPGGF--SGRIIREAEDLLHRRLLGTGITPVVLRLGGI 168

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL--MTHHLGGIFNLSDDEPA 216
           YGP R   I   +  +     + +  NRI  +D A  ++ L  M    G ++   D++PA
Sbjct: 169 YGPGRTRLIDQVRSGTAAAPAEPRYTNRIHRDDAAAAIVHLCTMAAEPGPVYLGVDNDPA 228

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
               V    A  + +  P     D              NKR SNA ++  GF+  YP++R
Sbjct: 229 ELGEVQRFLADELGLPRPSSDAPDGDGGG--REPSRGGNKRCSNALLRGTGFEFAYPSFR 286

Query: 277 ISLKQL 282
              + +
Sbjct: 287 EGYRSI 292


>gi|15789556|ref|NP_279380.1| hypothetical protein VNG0267H [Halobacterium sp. NRC-1]
 gi|169235267|ref|YP_001688467.1| hypothetical protein OE1417F [Halobacterium salinarum R1]
 gi|10579904|gb|AAG18860.1| hypothetical protein VNG_0267H [Halobacterium sp. NRC-1]
 gi|167726333|emb|CAP13114.1| conserved hypothetical protein [Halobacterium salinarum R1]
          Length = 297

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 110/303 (36%), Gaps = 49/303 (16%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + I G GY G  +A   L  G    G  RS  +L  ++  G +          +L   
Sbjct: 1   MRVAILGCGYVGCALARRLLAAGHDVVGVCRSPDSLDAVRETGATAVRADVTDAASLA-- 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG----------YLSSTSIYGN 110
            +     +V        G      +  D  + +  V+  G          Y SST +YG+
Sbjct: 59  AVPDADAVVFAASSGGRGADAAREVYVDGLRTV--VEQFGGRDDPPEQLVYTSSTGVYGD 116

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
            +G WVDE + + P +       +AE+  L    +  +   V+R +G+YGP R      R
Sbjct: 117 HDGDWVDEETPLDPTTEKTAALVDAERVALTDASEHGLDPTVVRFAGLYGPDR-----YR 171

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPA-------------- 216
               L         N I  +D A  V F +T     +    DD+P               
Sbjct: 172 LTRYLDGPVTEGYLNMIHRDDAAGVVAFALTDADADVLLAVDDDPVSKWAFADWLADEAG 231

Query: 217 ---PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
              P +  + E  +   ++ P E+   T             +KR SNA++  LG+   +P
Sbjct: 232 VPQPAKQTVAERIAAGDLSTPAERRLRT-------------SKRCSNARLTELGYSFAHP 278

Query: 274 NYR 276
            +R
Sbjct: 279 TFR 281


>gi|213400928|gb|ACJ47112.1| hypothetical protein [Wolbachia endosymbiont of Dirofilaria
           immitis]
          Length = 120

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 38  TLKHKGISPF-LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV 96
           T +++GI    LF  +KIN  + + +   THI+  I P  +GD  +    + +  +   +
Sbjct: 1   TSRNQGIQSINLFDYEKINKDIFQNV---THILVSIPP--DGDDVL----ERYGHYFQDI 51

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV--LR 154
           +W+GYLS+T +YG+  G WV E S   P+      R  +EK+W      LN KL V   R
Sbjct: 52  RWLGYLSATIVYGDHFGNWVTEESETKPVESRGKSRLKSEKKW------LNSKLPVHIFR 105

Query: 155 LSGIYGPKRNPFIKI 169
           L+GIYGP RN  + +
Sbjct: 106 LAGIYGPGRNMLVNL 120


>gi|308176148|ref|YP_003915554.1| NAD dependent epimerase/dehydratase family protein [Arthrobacter
           arilaitensis Re117]
 gi|307743611|emb|CBT74583.1| putative NAD dependent epimerase/dehydratase family protein
           [Arthrobacter arilaitensis Re117]
          Length = 284

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 95/185 (51%), Gaps = 16/185 (8%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL 153
           P ++   Y+SS+++ G   GQWVDE + + P     T +  A+ E +A+     + + +L
Sbjct: 97  PKLRRFIYVSSSAVMGGEAGQWVDESAPLAPTR--ETSKVLAQTE-IALAGS-GLPVTIL 152

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL--MTHHLGGIFNLS 211
           R SGIYGP R   + I +  + +L  ++   NRI  +D+A+ ++ +  +      ++  S
Sbjct: 153 RASGIYGPGRTRLVDIVRSGTAQLPIQSHWTNRIHRDDLAQAIVHVAALGEQAAELYLAS 212

Query: 212 DDEPAPPQNVIMEAASLMKI-TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
           D  PA    V    A  + +  PP       A+ +P TR   A ++R+ NA++ + G QL
Sbjct: 213 DSAPAQLGEVYEFLAKQLDLPVPP------GASEAP-TR--SAADRRLDNARLLASGLQL 263

Query: 271 LYPNY 275
            YP+Y
Sbjct: 264 EYPSY 268


>gi|89092441|ref|ZP_01165395.1| hypothetical protein MED92_06498 [Oceanospirillum sp. MED92]
 gi|89083529|gb|EAR62747.1| hypothetical protein MED92_06498 [Oceanospirillum sp. MED92]
          Length = 280

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 122/293 (41%), Gaps = 33/293 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR--E 60
           ++I G G  G  I     K G    G  R++ N L    +GIS  L     +   L+  E
Sbjct: 6   IVIAGCGDVGSAIGQLLNKAGHKVIGLRRNI-NQLPQGIQGISADLTQLDALKQSLKQIE 64

Query: 61  KLYFTTHIVQCIKPSSEG-DPCIISMSKDFYKFMPHV-KWIGYLSSTSIYGNREGQWVDE 118
           +     +       + EG     +   K+    +P     + + SST +Y   +  WVDE
Sbjct: 65  QYDILVYAASASTSTEEGYRSAYVDGLKNTLAALPMTPSHLFFTSSTGVYHQNDHSWVDE 124

Query: 119 HSFVHPISCVATQRFNAEK--EWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKNSL 175
            S   P      QRF+ +   E   +     I   V+R SGIYGP R   I K+R+ N L
Sbjct: 125 ESPCEP------QRFSGQVMLEAEQLLHAQGIPATVVRFSGIYGPGRGYLINKVREGN-L 177

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMT-----HHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
                 Q  NRI  +D A  V  L+      H +   +  SDD P           S+ +
Sbjct: 178 APESPLQYSNRIHRDDCAGVVAHLVNRVFEGHPVDKCYLASDDHP----------CSMHE 227

Query: 231 ITPPLEQCFDTANIS-PFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           IT  L    + +  S   TRF  + +KR SN ++K  G+Q +YP+++   K L
Sbjct: 228 ITHWLAGELNASMQSKSVTRF--SGSKRCSNKRLKESGYQFIYPDFKTGYKTL 278


>gi|289207670|ref|YP_003459736.1| ketopantoate reductase [Thioalkalivibrio sp. K90mix]
 gi|288943301|gb|ADC71000.1| Ketopantoate reductase ApbA/PanE domain protein [Thioalkalivibrio
           sp. K90mix]
          Length = 281

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 94/202 (46%), Gaps = 32/202 (15%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H + I ++SSTS++G  +G+WVDE S   P          AE+  LA +    +   V+R
Sbjct: 99  HPRRIVFVSSTSVFGADDGRWVDETSPAEPTRFSGRCLLEAEQ-LLADSPFAGV---VVR 154

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLS-- 211
             GIYGP R   ++ + +  +R   +  V+ NRI  ED     + L+TH    +F+L   
Sbjct: 155 FGGIYGPGREYHLR-KVREGVRGQHEAPVWTNRIHRED----CVGLLTH----LFHLDEP 205

Query: 212 -------DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK 264
                  DDEPA    ++   A  M++ PP         +           K   NA+++
Sbjct: 206 EPLYLGVDDEPALRHELLGWLAQEMELDPPGTPPMPAGEVC---------GKHCRNARLR 256

Query: 265 SLGFQLLYPNYRISLKQLWKEI 286
           + G++L YP+YR   + L  ++
Sbjct: 257 ASGYRLRYPDYRTGYRALLDQL 278


>gi|237654379|ref|YP_002890693.1| NAD-dependent epimerase/dehydratase [Thauera sp. MZ1T]
 gi|237625626|gb|ACR02316.1| NAD-dependent epimerase/dehydratase [Thauera sp. MZ1T]
          Length = 291

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 96/211 (45%), Gaps = 6/211 (2%)

Query: 75  SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFN 134
           + EGDP +  +           + + Y+S+T +YG+  G  VDE       +    +R +
Sbjct: 76  TGEGDPRMARLLAALAGRSSLPQGVVYISTTGVYGDCAGVRVDETRPCRAQTARGRRRVD 135

Query: 135 AEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR 194
           AE+   A  ++  +++A+LR  GIY   R P  ++R+ + +    ++   N I  ED+AR
Sbjct: 136 AERRLRAFGRRNRVRVALLRAPGIYAADRLPLERLRRADPVLAADEDVHTNHIHAEDLAR 195

Query: 195 -CVIFLMTHHLGGIFNLSDDEPAPPQ---NVIMEAASLMKITPPLEQCFDTANISPFTRF 250
              + L     G  +N SDD         + + E   L +  P + +     ++SP    
Sbjct: 196 IACLALFRAGPGRAYNASDDSGLRMGEYFDAVAERFGLAR-PPRMARAEIVRHLSPLALS 254

Query: 251 FYADNKRISNAKIK-SLGFQLLYPNYRISLK 280
           F ++++R+ N ++K  L   L YP     L+
Sbjct: 255 FMSESRRLDNRRLKRELRLHLRYPTVADGLR 285


>gi|70733349|ref|YP_263124.1| ActC family protein [Pseudomonas fluorescens Pf-5]
 gi|68347648|gb|AAY95254.1| ActC family protein [Pseudomonas fluorescens Pf-5]
          Length = 285

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 83/181 (45%), Gaps = 19/181 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+S+Y  ++G+WVDE S     +        AE+    +     I   V+RL+GIYG
Sbjct: 108 FVSSSSVYEQKDGEWVDETSVAEAQAYSGRMMLEAEQ----VALGSGIPATVVRLTGIYG 163

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI-----FNLSDDEP 215
           P R   +   ++     ++     NRI  +D A  + FL+     G      +   DD P
Sbjct: 164 PGREWLLTQVRRGYRVAIEPPLYGNRIHADDAAGLLAFLIKADRSGTALDDCYIGVDDAP 223

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           AP   V+      + +T    +  D A++          +KR SNA+ ++LG+   YP+Y
Sbjct: 224 APLAEVVDWLRDYLGVT----EWADDASVR------RTGSKRCSNARARALGWVPRYPSY 273

Query: 276 R 276
           R
Sbjct: 274 R 274


>gi|196230588|ref|ZP_03129450.1| ActC family protein [Chthoniobacter flavus Ellin428]
 gi|196225518|gb|EDY20026.1| ActC family protein [Chthoniobacter flavus Ellin428]
          Length = 217

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 85/176 (48%), Gaps = 13/176 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+Y   +G+WV E S   P     T R   E E L + +       V+RL+GIYG
Sbjct: 38  FTSSTSVYAQTDGEWVTEESPAEP--ARETGRLLRETEELVVAQNG----IVVRLAGIYG 91

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           P R+  + K     ++      +  N+   +D+A  ++ L+     G+FN++DD+P   +
Sbjct: 92  PGRSVLLRKFFDGTAIIEGDGAKWINQAHRDDIASAIVHLIETRARGVFNVNDDQPLAQR 151

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           ++    A       P     D      +T      NKR+SNAK+++LG+   +P++
Sbjct: 152 DLYAWLAERFAQPLPPSGPIDLNRKRGWT------NKRVSNAKLRALGWTPRFPSF 201


>gi|121595301|ref|YP_987197.1| NAD-dependent epimerase/dehydratase [Acidovorax sp. JS42]
 gi|120607381|gb|ABM43121.1| NAD-dependent epimerase/dehydratase [Acidovorax sp. JS42]
          Length = 318

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 121/268 (45%), Gaps = 22/268 (8%)

Query: 30  TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG--------DPC 81
           T S + +  L+  G++P L        L R      T ++    P  E         DP 
Sbjct: 52  TSSPTRVPQLRGAGVTPLLGNLDDAATLARLA-GVATRVLHLAPPPGEREVGPRWWLDPR 110

Query: 82  IISMSKDFYK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWL 140
             ++++   +  +P    + Y S++ +YG+  G WV E   V P +  A +R NAE+   
Sbjct: 111 STALARALRRRTLPQS--LVYASTSGVYGDCAGAWVPESRPVAPATPRAQRRVNAERAMR 168

Query: 141 AITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-C 195
            + +   + +++LR+ GIY P R    P  ++R+   + L + + V+ N I  +D+AR C
Sbjct: 169 HLGRA-GVPVSILRVPGIYAPDREGGTPEARLRRGTPV-LAEPDDVYTNHIHADDLARAC 226

Query: 196 VIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT-PPLEQCFDTANISPFTRF-FYA 253
           ++ L       I+N++DD      +    AA L  +  PP  Q        P +   F  
Sbjct: 227 MLALWRARAQRIYNVADDSQLKMGDYFDFAADLYGLPRPPRVQRSTAQEQLPLSLLSFMG 286

Query: 254 DNKRISNAKI-KSLGFQLLYPNYRISLK 280
           +++R++  ++ + L  +L YP  R  L+
Sbjct: 287 ESRRLTTTRMARELRLRLRYPTVREGLQ 314


>gi|120553572|ref|YP_957923.1| NAD-dependent epimerase/dehydratase [Marinobacter aquaeolei VT8]
 gi|120323421|gb|ABM17736.1| NAD-dependent epimerase/dehydratase [Marinobacter aquaeolei VT8]
          Length = 288

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 117/293 (39%), Gaps = 31/293 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVG-VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            +++ G G  G  IA   L  G VY     R   + +     GI   L   + +   L E
Sbjct: 11  QILVAGCGKLGGDIATVLLGAGDVYGL---RRNPDRVPQGVTGIGADLTRPESMAGKLPE 67

Query: 61  KLYFTTHIVQCIKPSS---EG-DPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQ 114
            L     +V C+ PSS   EG     ++  K+    +    +K + ++SSTS++   +  
Sbjct: 68  HLDI---VVYCLTPSSYDEEGYHQAYVTGLKNLLNVIGEQSLKRLIFISSTSVFAQNDDS 124

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WVDE+S   P      Q    E+  L           V+R SGIYGP R  F++   +  
Sbjct: 125 WVDENSPADPDRFTGQQILQGERTAL----NSGHPATVVRFSGIYGPSRQRFLEEVLEGR 180

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASLM 229
           +         NRI   D A  V +L    L G     ++  SD EP     V+    + +
Sbjct: 181 MNPQPPAPFSNRIHEVDAANAVAWLAQKALNGEILEPLYVASDCEPVRLDEVVDWVRTQV 240

Query: 230 KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
               P+E                A +KR SN K+   GF+  YP+YR   +++
Sbjct: 241 PCKAPVEGARKGGR---------AGSKRCSNRKLLQSGFEFRYPDYRAGYREM 284


>gi|222111585|ref|YP_002553849.1| nad-dependent epimerase/dehydratase [Acidovorax ebreus TPSY]
 gi|221731029|gb|ACM33849.1| NAD-dependent epimerase/dehydratase [Acidovorax ebreus TPSY]
          Length = 318

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 121/268 (45%), Gaps = 22/268 (8%)

Query: 30  TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEG--------DPC 81
           T S + +  L+  G++P L        L R      T ++    P  E         DP 
Sbjct: 52  TSSPTRVPQLRGAGVTPLLGNLDDTATLARLA-GVATRVLHLAPPPGEREVGPRWWLDPR 110

Query: 82  IISMSKDFYK-FMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWL 140
             ++++   +  +P    + Y S++ +YG+  G WV E   V P +  A +R NAE+   
Sbjct: 111 STALARALRRRTLPQS--LVYASTSGVYGDCAGAWVPESRPVAPATPRAQRRVNAERAMR 168

Query: 141 AITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-C 195
            + +   + +++LR+ GIY P R    P  ++R+   + L + + V+ N I  +D+AR C
Sbjct: 169 HLGRA-GVPVSILRVPGIYAPDREGGTPEARLRRGTPV-LAEPDDVYTNHIHADDLARAC 226

Query: 196 VIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT-PPLEQCFDTANISPFTRF-FYA 253
           ++ L       I+N++DD      +    AA L  +  PP  Q        P +   F  
Sbjct: 227 MLALWRARAQRIYNVADDSQLKMGDYFDFAADLYGLPRPPRVQRSTAQEQLPLSLLSFMG 286

Query: 254 DNKRISNAKI-KSLGFQLLYPNYRISLK 280
           +++R++  ++ + L  +L YP  R  L+
Sbjct: 287 ESRRLTTKRMARELRLRLRYPTVREGLQ 314


>gi|295677420|ref|YP_003605944.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. CCGE1002]
 gi|295437263|gb|ADG16433.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. CCGE1002]
          Length = 345

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 89/182 (48%), Gaps = 8/182 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y S+T +YG+  G W+DE     P +  A +R +AE++    T + ++  ++ R+ GI
Sbjct: 151 IVYASTTGVYGDCRGAWIDETRATQPANARAKRRVSAERQLRRATARGSVAASIARIPGI 210

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPA 216
           Y   R P  ++ ++ +  LV  + V+ N I  +D+A  ++ L  H       + SDD   
Sbjct: 211 YAANRLPLARL-ERGTPALVDADDVYTNHIHADDLAAILVRLAKHGRPARALHASDDSSL 269

Query: 217 PPQ---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLY 272
                 + + +A  L +  P + +      I P    F  +++R+ N ++K  LG +L Y
Sbjct: 270 KMGEYFDAVADAFGLAR-APRITREQAEQQIDPMLLSFMRESRRLVNRRLKEELGVRLRY 328

Query: 273 PN 274
           P+
Sbjct: 329 PS 330


>gi|331005614|ref|ZP_08328984.1| Nucleoside-diphosphate-sugar epimerase [gamma proteobacterium
           IMCC1989]
 gi|330420587|gb|EGG94883.1| Nucleoside-diphosphate-sugar epimerase [gamma proteobacterium
           IMCC1989]
          Length = 285

 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 85/192 (44%), Gaps = 13/192 (6%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           + I ++SSTS+Y  ++G WVDE S   P S    +   AEK    +          +R S
Sbjct: 101 RLIVFVSSTSVYAQQDGSWVDERSPTEPESYSGRRLLEAEK----LVADSGYNYCHVRFS 156

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM----THHLGGIFNLSD 212
           GIYG  R   ++         V+     NRI  +D A  +  L+    TH +  ++  SD
Sbjct: 157 GIYGRGRGYLVEQVMAGKGTPVEPAIYTNRIHADDCAGVLTHLIERQKTHTIDNLYIASD 216

Query: 213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
            +PAP    + E    M+ T  L +     N +P T+     NKR SNA +   G+   Y
Sbjct: 217 HQPAP----LHEVKQWMRETLGLPENNFQEN-APLTKRTARSNKRCSNALLVESGYVFRY 271

Query: 273 PNYRISLKQLWK 284
           P+++     L K
Sbjct: 272 PSFKEGYTPLLK 283


>gi|327542782|gb|EGF29246.1| NAD-dependent epimerase/dehydratase [Rhodopirellula baltica WH47]
          Length = 301

 Score = 72.0 bits (175), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 114/297 (38%), Gaps = 26/297 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G GY G+ +   A + G     TTRS     TL  +G  P  F          ++L
Sbjct: 5   LLIVGCGYLGRRVGRLAQRAGWQVHATTRS--RFETLAAEGFHPIAFDWNDSRTF--DRL 60

Query: 63  YFTTHIVQCIKPSSEGD-PCIISMSKDFYKFMPHVK---------WIGYLSSTSIYGNRE 112
             TTH++  +            S      + + H+           + Y+S+T +Y    
Sbjct: 61  PTTTHVLIAVAHDRHSRVDRYASQVDGLARLIRHLDNGRPTDQSADVCYISTTGVYHQTG 120

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G WVDE S   P          AE +  ++  ++      LRL+GIYGP R P       
Sbjct: 121 GVWVDETSPTRPTREGGKAHLAAEAKLRSL--RVGRPTTTLRLAGIYGPDRVPRAADVIA 178

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVI------FLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
                   +   N I V+D A  V+         +     ++ ++DDEP   +    E A
Sbjct: 179 ERPIASPPHGHLNLIHVDDAATAVMNSFDNQRFASRARSPLYVVADDEPVVRREFYREIA 238

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
              + T   E  F         RF    +KRI N ++ + L  Q+ YP YR  L+ +
Sbjct: 239 ---RATRSAEPTFVDPAADSGVRFRSETDKRIWNRRVRRDLLPQMRYPTYREGLRDV 292


>gi|260434489|ref|ZP_05788459.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 8109]
 gi|260412363|gb|EEX05659.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. WH 8109]
          Length = 287

 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 118/299 (39%), Gaps = 52/299 (17%)

Query: 1   MHLMIFGAGYTGKFIAD------AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M L I G GY G  +A+        LK+ + T  + R +  L  L  +        D   
Sbjct: 1   MDLTIVGCGYVGLALAERLQPRRPQLKLTLTTTSSER-LEQLRPLADR----VELCDATD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGD--------------PCIISMSKDFYKFMPHVKWIG 100
              LR+ L  +++ V C+ P  +                 C+ S+       +P ++ I 
Sbjct: 56  PAQLRDALRQSSNAVFCLGPKGDRQVDANGYRHTFVDSFRCLTSL----LPQLPELRQIV 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y  S S+YG+ EG WVDE +   P           E+    I+ +   ++ +LRL  +YG
Sbjct: 112 YTGSCSVYGDAEGDWVDEQTPPAPGRGHGDVLLEGEQLLNGISGR---RVCILRLGALYG 168

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           P R+   ++     L        + N + V D A  +   +     G+ N+ +DEP   +
Sbjct: 169 PGRDLDRRLHGLAGLERPGSGSTYSNWLHVVDAAGALEAAIDAEWAGLVNVVNDEPIRLR 228

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYAD-----NKRISNAKIKSLGFQLLYP 273
           +++  +     + P               R+   D      +RI N ++K LG+QL +P
Sbjct: 229 DLVGRSLQRQGLAP--------------VRWLGQDEPGSGGRRIRNTRLKQLGYQLQHP 273


>gi|78184560|ref|YP_376995.1| hypothetical protein Syncc9902_0985 [Synechococcus sp. CC9902]
 gi|78168854|gb|ABB25951.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 287

 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 114/285 (40%), Gaps = 39/285 (13%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF---ADQKINNLLREK 61
           + G GY G   A    ++G    GTT S S L  L      P ++   A     + L   
Sbjct: 7   VVGCGYVGAAAAQHFAQIGFEVTGTTTSPSRLQELCSIVDHPRIYRAGAPHSDTSFLDS- 65

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYK---------FMPHVK--------WIGYLSS 104
                 ++  I P+S      +SM +D Y+          +  +K         + YLSS
Sbjct: 66  ---LDGLLVAIAPTS------VSMEEDQYRSVYGAGVSALVEAIKSRQSSRPLHVSYLSS 116

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
             +YGN+ G+  DE + V   +       +AE   L++         VLRL GIYGP ++
Sbjct: 117 AGVYGNQGGEVCDESTPVDRSNSANALLADAESAVLSL-NDFGTSSCVLRLGGIYGPNKD 175

Query: 165 PFIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIM 223
               IR  +   + K     N  + + D+   + F     L G++NL DD     +++  
Sbjct: 176 IASFIRSASGQMVPKNGSHINAWVHLHDIVHGINFAFDQRLQGLYNLVDDLQVSRRDLSN 235

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
                  + P +    D     P +R F   N R+SN K+K LGF
Sbjct: 236 MLCDEHGLAPVIWDNHDR----PDSRIF---NARVSNGKLKGLGF 273


>gi|121997499|ref|YP_001002286.1| NAD-dependent epimerase/dehydratase [Halorhodospira halophila SL1]
 gi|121588904|gb|ABM61484.1| NAD-dependent epimerase/dehydratase [Halorhodospira halophila SL1]
          Length = 292

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 87/185 (47%), Gaps = 17/185 (9%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK--EWLAITKKLNIKLAVLRLSGI 158
           ++SST++YG ++G+W+DE S   P       RF+ ++  E  AI         V R  GI
Sbjct: 119 FVSSTAVYGQQDGEWIDEDSPTEP------GRFSGQRLLEAEAIALGGPWAGVVARYGGI 172

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAP 217
           YG  R+ F+ IR+  +    +  Q  NRI   DV   +  L    + GG++   DD P+ 
Sbjct: 173 YGTGRD-FL-IRKVEAGEPCQAEQYTNRIHSADVVGSLAHLGRADVPGGVYLGVDDAPST 230

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
              V+   A L+ +  P      +  +          +KR SN K+K+ G++  YP +R 
Sbjct: 231 QCEVMDGIAELLGVPRPPRGEPGSGGMRGVG------SKRGSNRKLKASGYRFRYPTFRE 284

Query: 278 SLKQL 282
             ++L
Sbjct: 285 GYREL 289


>gi|187925111|ref|YP_001896753.1| NAD-dependent epimerase/dehydratase [Burkholderia phytofirmans
           PsJN]
 gi|187716305|gb|ACD17529.1| NAD-dependent epimerase/dehydratase [Burkholderia phytofirmans
           PsJN]
          Length = 341

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 90/186 (48%), Gaps = 6/186 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE       +  A +R +AE++    T + ++  ++ R+ GIY 
Sbjct: 153 YASTTGVYGDCGGAWIDETRATQAANPRAKRRVSAERQLRRATARGSVAASIARIPGIYA 212

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  LV  + V+ N I  +D+A  ++ L TH   G + + SDD     
Sbjct: 213 GNRLPLARL-EKRTPALVDADDVYTNHIHADDLAAILVRLATHGRPGRVVHASDDTSLKM 271

Query: 219 QNVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
                E A    +   P + +    + I P    F  +++R+ N ++K  L  +L YP+ 
Sbjct: 272 GEYFDEVADAFGLARAPRITRAEAESQIEPTLLSFMRESRRLINRRLKGELRVRLRYPSV 331

Query: 276 RISLKQ 281
              L++
Sbjct: 332 EDFLRE 337


>gi|86158449|ref|YP_465234.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774960|gb|ABC81797.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 283

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 118/292 (40%), Gaps = 20/292 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+++ G G+ G  IA   L  G    G  R  +    L   GI+P    D        E
Sbjct: 1   MHVLVAGCGWLGSAIARRLLFEGRRVTGIRRDPARAAALAATGIAPLAL-DLAAPG-AEE 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYK-FMPHVKWIG----YLSSTSIYGNREGQW 115
           +L     +V C   +S+      +   D  +  + H +  G    Y  ST + G  +G  
Sbjct: 59  RLPAVDAVVACQSATSDTPEAYRAAYLDANRALLAHARRCGARLVYTGSTGVLGQSDGLD 118

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           VDE S   P+   A     AE+  +       ++  V+RLSG+YGP R   ++  +   L
Sbjct: 119 VDESSPPMPLGPTAEVLAEAERA-IQAAGAAGLQACVVRLSGLYGPGRAGIVERVRSGRL 177

Query: 176 RLVKKNQVF-NRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
            L    Q + N   ++D    V+  +     G +++ SD  PA  + V+   A  + + P
Sbjct: 178 ALGAGEQAWMNFCHLDDAVSFVLAAIARGAPGAVYHGSDAAPARRREVVRWIADRIGVEP 237

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE 285
                   A ++P       D + +S     +LG  L YP++R  L  L  E
Sbjct: 238 ------ARATVAPPG----PDRRVLSERTRAALGVTLAYPSFREGLLPLVPE 279


>gi|332706257|ref|ZP_08426325.1| nucleoside-diphosphate-sugar epimerase [Lyngbya majuscula 3L]
 gi|332354962|gb|EGJ34434.1| nucleoside-diphosphate-sugar epimerase [Lyngbya majuscula 3L]
          Length = 279

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 88/187 (47%), Gaps = 24/187 (12%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKL------- 146
           P VK + YLSS ++YGN++G WVDE+S + P         N     L++T+ +       
Sbjct: 104 PTVKQVIYLSSCAVYGNQQGAWVDENSPIVPA--------NEHGRVLSLTEHILLGASSE 155

Query: 147 NIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG 205
           N  + +LRL GIYGP R    +  +     L      F N I  +D+ + V F   +   
Sbjct: 156 NCNVCILRLGGIYGPGRELSKRFERLAGTTLPGSGDNFINWIHRDDIVQAVEFARQNRCQ 215

Query: 206 GIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS 265
           GI+NL +D     + +  +      +   L   +D++  S     F  +N R+ N K+K 
Sbjct: 216 GIYNLVNDLKLTTRELTDQICDRYHLPKVL---WDSSQPS-----FRTNNARVHNRKLKV 267

Query: 266 LGFQLLY 272
            G++L++
Sbjct: 268 AGYELIH 274


>gi|284164628|ref|YP_003402907.1| NAD-dependent epimerase/dehydratase [Haloterrigena turkmenica DSM
           5511]
 gi|284014283|gb|ADB60234.1| NAD-dependent epimerase/dehydratase [Haloterrigena turkmenica DSM
           5511]
          Length = 300

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 115/293 (39%), Gaps = 27/293 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ I G G+ G  +       G    G  RS   +  ++  G     F   + +   RE
Sbjct: 1   MNIAILGCGHVGLELGRQLTDRGHEAIGVRRSDEGVEAIEDAG-----FEAVQADVTDRE 55

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM-PHVKWIG----------YLSSTSIYG 109
            L     +   +  +S G     +  + + + +   V+  G          Y SST ++G
Sbjct: 56  GLAAVPDVDAIVFAASSGGRGAEAAREVYVEGLRTAVEQFGERENGPERLVYTSSTGVHG 115

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           + +G WVDE + + P +        AE+       +   +  V R +G+YGP R      
Sbjct: 116 DHDGDWVDEATPIEPTTEKTEVLAEAERIARESPAEYGFEGTVARYAGLYGPGR-----Y 170

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPPQNVIMEAAS 227
           R +  L         N +  +D A  V +L+   L  G +  + DDEPA         A 
Sbjct: 171 RLERYLEGPVTEGYLNMVHRDDAAGAVRYLLEEDLARGEVVQVVDDEPAHKWEFADWLAE 230

Query: 228 LMKITPPLEQC----FDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
             ++  P +Q         ++S   +     +KR +N K++ LG++  YP YR
Sbjct: 231 RCEVEQPPKQTKAERLADDDVSEAGKRRILTSKRCANEKLRDLGYEFAYPTYR 283


>gi|318040786|ref|ZP_07972742.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. CB0101]
          Length = 285

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 121/294 (41%), Gaps = 39/294 (13%)

Query: 1   MHLMIFGAGYTGKFIA-----DAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN 55
           M + I G GY G+ +A      AA+ + V T    R V  L+ +  +     L       
Sbjct: 3   MRVTIVGCGYVGEALARRWGEQAAVDLTVTTTREERRV-ELIPVARR----VLVVRASDP 57

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMS------------KDFYKFMPHVKWIGYLS 103
           + L + L      V C+ P   GD  + + +            ++    MP ++ I Y S
Sbjct: 58  SALFQALDGAEAAVFCMAPG--GDRQVDADAYAATYRDSMRALQELLPDMPQLRQIVYTS 115

Query: 104 STSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR 163
           S  +YG+  G WVDE +   P    A     +E + L   +    ++ VLRL  IYGP R
Sbjct: 116 SCGVYGDAAGAWVDESTPAIPRDAHAAVLLESE-QLLEQCRADQRRVCVLRLGAIYGPGR 174

Query: 164 NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEP---APPQ 219
           +   + +           +++ N I  +DVA  +   +        N+ DD+P   A   
Sbjct: 175 DLIRRFKTLAGTTRTGDGRIYCNWIHRDDVAGAIAAAVAGGWDQTVNVVDDQPWLVADLL 234

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           N I  +A L    PP++         P        ++RISN  + SLG++LL+P
Sbjct: 235 NQICNSADL----PPVQWSGSEPGAKPMV------DRRISNRHLHSLGYELLHP 278


>gi|30248609|ref|NP_840679.1| putative oxidoreductase protein [Nitrosomonas europaea ATCC 19718]
 gi|30180204|emb|CAD84506.1| putative oxidoreductase protein [Nitrosomonas europaea ATCC 19718]
          Length = 303

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 93/188 (49%), Gaps = 4/188 (2%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++ +YG+  G  V E    +P +  A +R +AE++  +   +  I++++LR+ GIY 
Sbjct: 110 YISTSGVYGDCSGSRVSESHPTNPKNARAFRRLDAERQVRSWGIRNRIQVSILRVPGIYA 169

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQ 219
             R P  +++Q+  + L  ++   N I  +D+AR ++  L +   G I++ SDD      
Sbjct: 170 HNRLPIERLQQRTPVLLSTEDSYTNHIHADDLARIIVAVLRSGRPGRIYHASDDSCLKMG 229

Query: 220 NVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
                 A    ++ P       A   ISP    F  +++R++N +IK  L  +L YP   
Sbjct: 230 EYFDLVADHFALSRPERITRQEARKVISPGLLSFMLESRRLTNDRIKRELRVRLRYPTVS 289

Query: 277 ISLKQLWK 284
             L ++ K
Sbjct: 290 DCLAEMRK 297


>gi|182414590|ref|YP_001819656.1| NAD-dependent epimerase/dehydratase [Opitutus terrae PB90-1]
 gi|177841804|gb|ACB76056.1| NAD-dependent epimerase/dehydratase [Opitutus terrae PB90-1]
          Length = 310

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 125/307 (40%), Gaps = 36/307 (11%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L+IFG GY G  IA  A+  G+     TR+ +   +L+  G+ P + AD   +    + 
Sbjct: 8   RLVIFGCGYVGSAIARQAIARGLRVTALTRNPATAESLQAGGVEPVV-ADLAGSAWHPQI 66

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KW------IG---YLSSTSIYGNR 111
                +++  +   S G   I      +   M  +  W      IG   Y SSTS+Y   
Sbjct: 67  AGGARYVLNAV---SAGGGGIDGYRHSYVDGMRSILAWARARGGIGTLVYTSSTSVYPQG 123

Query: 112 EGQWVDEHSFVHPIS------------CVATQRFNAEKEWLAITKKLNIKLAVLRLSGIY 159
           +G  VDE +    +                            +  +  ++  VLRL+GIY
Sbjct: 124 DGVVVDESASSEGVGERGELLLESERLLSPDTGGTPTPPGPVVPPREYMRCFVLRLAGIY 183

Query: 160 GPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV--IFLMTHHLGG-IFNLSDDEPA 216
           GP R+  +  + +  +   +     N I +ED+   +   F     +G  +FN++DD PA
Sbjct: 184 GPGRHQLLD-QVRTGIVAGRGGHRLNLIHLEDICAAIWSAFDAPPEIGSDVFNVADDRPA 242

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
              +V    A  + +  P         +   TR     ++ ISNAKIK  LG+Q  +P+Y
Sbjct: 243 TKSDVAGWLAQRLGVGAPT-----FTGLPAGTRRSVTPDRVISNAKIKRVLGWQPRFPDY 297

Query: 276 RISLKQL 282
           R   + +
Sbjct: 298 RAGYENI 304


>gi|108760626|ref|YP_631416.1| hypothetical protein MXAN_3215 [Myxococcus xanthus DK 1622]
 gi|13752435|gb|AAK38651.1|AF350253_3 ActC [Myxococcus xanthus DK 1622]
 gi|108464506|gb|ABF89691.1| ActC [Myxococcus xanthus DK 1622]
          Length = 437

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 127/277 (45%), Gaps = 32/277 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G+GYT   +A A  + G      TR  +    L+  G         ++ +L  + L
Sbjct: 5   LVLLGSGYTLTRLAVAEARAGRDVLAATRDAARRAELERAG--------ARVTDL-EDAL 55

Query: 63  YFTT--HIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
             T   H+V  + P +  D  I S        +P    + YLSST +YG   G  VDE +
Sbjct: 56  TRTAGAHVVVSVPPDAGLDTRIASA---LAGQVP--ARLVYLSSTGVYGRARGH-VDEDT 109

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V   +  + +R  AE  +L +         V+R++GIYGP R    ++    +LRL + 
Sbjct: 110 PVELSTPSSRERIEAESRYLPLGAM------VMRIAGIYGPGRGIHTRL-LSGALRLPEG 162

Query: 181 NQV-FNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQC 238
                +RI V+D+   +  ++T    G ++ ++DD  AP +  +   +  + +  P+   
Sbjct: 163 GGGRISRIYVDDLVESIRVVLTRGEPGALYCVADDRSAPSEEPVAWLSQRLGV--PMPPR 220

Query: 239 FDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
              A ++   R     ++ ISNA++KSLG+   YP++
Sbjct: 221 IPLAQLNETLR----GDRDISNARLKSLGWAPRYPDF 253


>gi|226939357|ref|YP_002794430.1| NAD-dependent epimerase/dehydratase [Laribacter hongkongensis
           HLHK9]
 gi|226714283|gb|ACO73421.1| NAD-dependent epimerase/dehydratase [Laribacter hongkongensis
           HLHK9]
          Length = 318

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 72/155 (46%), Gaps = 16/155 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+SS+S+YG+  GQ +DE     P S  A +R +AE+ W  + ++  ++L +LR  GIY 
Sbjct: 116 YISSSSVYGHCHGQSIDETRRPAPGSARARRRLDAEQVWRWLAQRSGLRLTLLRTPGIYA 175

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI--FNLSDDEPAP- 217
            +R P  +I       L  ++ +   +  +D+A+  +  +    GG   +NL D +  P 
Sbjct: 176 AERLPLARILAGIPALLPGEDSLHTHVHADDLAQACVLSLARRRGGTRCYNLGDHDALPG 235

Query: 218 -------------PQNVIMEAASLMKITPPLEQCF 239
                        P+   + AA L  +  PL   F
Sbjct: 236 GDRLDLVADAFGLPRVPRLPAADLQAVVGPLRWSF 270


>gi|322371091|ref|ZP_08045643.1| 3-beta hydroxysteroid dehydrogenase/isomerase family superfamily
           protein [Haladaptatus paucihalophilus DX253]
 gi|320549081|gb|EFW90743.1| 3-beta hydroxysteroid dehydrogenase/isomerase family superfamily
           protein [Haladaptatus paucihalophilus DX253]
          Length = 284

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 114/292 (39%), Gaps = 40/292 (13%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M++ + G GY G  +A   L  G    G  RS   L  ++  G +  + AD    + L  
Sbjct: 1   MNVAVLGCGYVGCELARELLADGHEVVGVRRSSEGLRAVEKTG-ADAVRADVTDGDSLSS 59

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-------KWIGYLSSTSIYGNREG 113
                  +        +      +  +     + H        + + Y SST +YG+R+G
Sbjct: 60  IPDANVLVYAVSADGRDSAAARTAYVEGLRTALDHFAARESSPERVVYTSSTGVYGDRDG 119

Query: 114 QWVDEHSFVHP------ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
             VDE + + P      I   A +   AE+ W            + R SG+YGP R    
Sbjct: 120 ARVDESTPLEPRTEREEILADAEEIVRAERGW---------DWTITRFSGLYGPDR---- 166

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG--GIFNLSDDEPAPPQNVIMEA 225
             R +  L     ++  N +  +D A  + +L+    G   +  +SDDEP     +    
Sbjct: 167 -YRLERYLEGPVSDRYLNLLHRDDAAGTIRYLLDTGRGRNEVVLVSDDEPVRKPTLADWL 225

Query: 226 ASLMKIT-PPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           A    ++ PP E         P T      +KR SN K++ LG++L YP YR
Sbjct: 226 ADECGVSHPPRE---------PATSERARASKRCSNEKLRELGYELRYPTYR 268


>gi|119489799|ref|ZP_01622557.1| hypothetical protein L8106_10647 [Lyngbya sp. PCC 8106]
 gi|119454373|gb|EAW35523.1| hypothetical protein L8106_10647 [Lyngbya sp. PCC 8106]
          Length = 276

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 88/187 (47%), Gaps = 20/187 (10%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P VK + Y  S  +YG++ G  VDE S V P S      + AE+  L +  + N+K+ +
Sbjct: 100 VPEVKQLIYTGSFGLYGDQNGATVDESSPVKPSSKNHEILYKAEQILLELASE-NLKVCI 158

Query: 153 LRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNR------IRVEDVARCVIFLMTHHLGG 206
           LRL GIYGP R   +KI      R+    Q  N       I ++D+   + F+  + L G
Sbjct: 159 LRLGGIYGPGRE-IVKIFS----RMFGTTQAGNGRYPTAWIHLDDIIGAIEFVRQNQLEG 213

Query: 207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSL 266
           I+NL D+     + +I        + P +       N  P+       N R+SN KI+  
Sbjct: 214 IYNLVDNSNLTRRELIDLMCDKHDV-PNVTWDVSQPNNRPY-------NVRVSNQKIQEA 265

Query: 267 GFQLLYP 273
           G+Q ++P
Sbjct: 266 GYQFIHP 272


>gi|119962391|ref|YP_945895.1| NAD dependent epimerase/dehydratase-related protein [Arthrobacter
           aurescens TC1]
 gi|119949250|gb|ABM08161.1| putative NAD dependent epimerase/dehydratase-related protein
           [Arthrobacter aurescens TC1]
          Length = 288

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 10/186 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST++Y +  G  VDE +   P          AE+   + T+    +   LRL GIYG
Sbjct: 102 FVSSTAVYKDSGGAVVDESTPTEPTRFSGKVLVEAEELLFSRTRGTATQPISLRLGGIYG 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL--MTHHLGGIFNLSDDEPAPP 218
           P R   I   +     +  + +  NR+  +D A  ++ L  MT     ++   DD  A  
Sbjct: 162 PGRTRLIDQVRTGQAVIPAQPRHTNRVHRDDAAAMIVHLTTMTPTPDRVYVGVDDHAAEM 221

Query: 219 QNVIMEAASLMKI-TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
            +V+   AS M    PP  +    ++  P        +KR SNA+I++ GF+  +P Y+ 
Sbjct: 222 GDVMRFLASEMGCPEPPTAEPGGASDAGP-------GDKRCSNARIRATGFEFTFPTYKE 274

Query: 278 SLKQLW 283
             + L 
Sbjct: 275 GYRALL 280


>gi|148242030|ref|YP_001227187.1| nucleoside-diphosphate-sugar epimerase [Synechococcus sp. RCC307]
 gi|147850340|emb|CAK27834.1| Nucleoside-diphosphate-sugar epimerase [Synechococcus sp. RCC307]
          Length = 302

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 121/298 (40%), Gaps = 37/298 (12%)

Query: 1   MHLMIFGAGYTGKFIADA-ALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M L + G GY G+ IA     + G+    TT S      L        + +    + LL 
Sbjct: 1   MRLSLVGCGYVGEAIAQQLQGRAGLELTVTTTSEERRGELSAMADQVLVISADDPDGLL- 59

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKF----------MPHVKWIGYLSSTSIYG 109
             L      + C+ P            + F             +P ++ I Y  S SIYG
Sbjct: 60  AALKGRDAAIFCLGPKGNRQVDAAGYRRTFNDSFRCLEQLLPKLPVLQQIIYTGSCSIYG 119

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK- 168
           +  G WVDE +   P          AE++ LA+      ++ +LRL  +YGP+R  F + 
Sbjct: 120 DAGGGWVDESTTAQPRDEHGAVLLEAERQLLAMGSPQR-RVCILRLGALYGPQRE-FEQR 177

Query: 169 -IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAAS 227
             R   S +  +  +  N +  +D A   I  +  H  GI N+ DD P P   ++   AS
Sbjct: 178 FARLAGSTQPGRGERFTNWVHRDDAAAAAIAALDGHWQGIVNVVDDAPVPLAELLN--AS 235

Query: 228 LMKITPPLEQCFDTANISPFTRFFYAD------NKRISNAKIKSLGFQLLYPNYRISL 279
           L +           A ++P T    ++      N+RISN  +KS  F+L +P  RI+L
Sbjct: 236 LAQ-----------AGLAPITWQPASEPGNPGLNRRISNRLLKSKSFELNHP--RIAL 280


>gi|197122257|ref|YP_002134208.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter sp. K]
 gi|196172106|gb|ACG73079.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter sp. K]
          Length = 283

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 116/295 (39%), Gaps = 20/295 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+++ G G+ G  IA   L  G    G  R  +    L   GI+P    D         
Sbjct: 1   MHVLVAGCGWLGSAIARRLLFEGQRVTGIRRDPARAAALASTGIAPLAL-DLAAPG-AEA 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYK-FMPHVKWIG----YLSSTSIYGNREGQW 115
           +L     +V C   +S+      +   D  +  + H +  G    Y  ST + G  +G  
Sbjct: 59  RLPAVDAVVACQSATSDTTEAYRAAYLDANRALLAHARRCGARLVYTGSTGVLGQSDGLD 118

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           VDE S   P+   A     AE+  +       +   V+RLSG+YGP R   ++  +   L
Sbjct: 119 VDESSPPMPLGPTAEVLAEAERA-IQAAGAAGLGACVVRLSGLYGPGRAGIVERVRSGRL 177

Query: 176 RLVKKNQVF-NRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
            L    Q + N   ++D    V+  +     G +++ SD  PA  + V+   A  + + P
Sbjct: 178 ALGAGEQAWMNFCHLDDAVSFVLAAIARGAPGAVYHGSDAAPARRREVVRWIADRIGVEP 237

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIEN 288
                   A ++P       D + +S     +LG  L  P++R  L  L  E+  
Sbjct: 238 ------ARATVAPPG----PDRRVLSERTRAALGVTLACPSFREGLIPLVPEVRR 282


>gi|220917040|ref|YP_002492344.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954894|gb|ACL65278.1| NAD-dependent epimerase/dehydratase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 283

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 116/295 (39%), Gaps = 20/295 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           MH+++ G G+ G  IA   L  G    G  R  +    L   GI+P    D         
Sbjct: 1   MHVLVAGCGWLGSAIARRLLFEGQRVTGIRRDPARAAALASTGIAPLAL-DLAAPG-AEA 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYK-FMPHVKWIG----YLSSTSIYGNREGQW 115
           +L     +V C   +S+      +   D  +  + H +  G    Y  ST + G  +G  
Sbjct: 59  RLPAVDAVVACQSATSDTPEAYRAAYLDANRALLAHARRCGARLVYTGSTGVLGQSDGLD 118

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           VDE S   P+   A     AE+  +       +   V+RLSG+YGP R   ++  +   L
Sbjct: 119 VDESSPPMPLGPTAEVLAEAERA-IQAAGAAGLGACVVRLSGLYGPGRAGIVERVRSGRL 177

Query: 176 RLVKKNQVF-NRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
            L    Q + N   ++D    V+  +     G +++ SD  PA  + V+   A  + + P
Sbjct: 178 ALGAGEQAWMNFCHLDDAVSFVLAAIARGAPGAVYHGSDAAPARRREVVRWIADRIGVEP 237

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIEN 288
                   A ++P       D + +S     +LG  L  P++R  L  L  E+  
Sbjct: 238 ------ARATVAPPG----PDRRVLSERTRAALGVTLACPSFREGLIPLVPEVRR 282


>gi|219850620|ref|YP_002465053.1| NAD-dependent epimerase/dehydratase [Chloroflexus aggregans DSM
           9485]
 gi|219544879|gb|ACL26617.1| NAD-dependent epimerase/dehydratase [Chloroflexus aggregans DSM
           9485]
          Length = 307

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 91/210 (43%), Gaps = 19/210 (9%)

Query: 77  EGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE 136
           +G+  +I+MS        +V    + S+ + YG+    WVDE S + P   + T    AE
Sbjct: 92  DGNQHLIAMSVRARTVRAYV----WASNAAPYGDHSENWVDEDSPIAPSYPLGTILATAE 147

Query: 137 KEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCV 196
           +  L   +       +LR++ +YGP R+P   I                 I ++D    +
Sbjct: 148 QIILQAVRAYRFPAIILRMATVYGPDRDPLEAIASGQLTIYGNGRNFIPHIHIDDALEVL 207

Query: 197 I-FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP--------LEQCFDTANISPF 247
           I  +    +G I+N+SDDEP     ++ E    + + PP        L    D + I   
Sbjct: 208 IRTVEMGQIGAIYNVSDDEPLRLIEIVSEVRRRLGMLPPRTFDPQVGLRAGLDRSVIGAL 267

Query: 248 TRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
           T      + R++NA+++  LG +L YP+ R
Sbjct: 268 T-----SSVRMNNARMRHDLGIELRYPSLR 292


>gi|254447454|ref|ZP_05060920.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium
           HTCC5015]
 gi|198262797|gb|EDY87076.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium
           HTCC5015]
          Length = 279

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 86/169 (50%), Gaps = 2/169 (1%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           + Y+S++S+YG+  G WVDE +   P S    +R +AE++W +      ++L +LR+ GI
Sbjct: 95  VQYISTSSVYGDCGGDWVDETAPRKPSSDRGQRRADAEEQWQSWCDSHGVELQILRVPGI 154

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPP 218
            G  R+   ++++   +    +    N I  +D+AR ++ L +    GI+N+SDD P   
Sbjct: 155 VGRGRDKLERLKKGEPILNPDEATWTNVIDADDLARLLLALASKAPAGIYNISDDCPTTS 214

Query: 219 QNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS 265
               +     + I PP  + +    A  SP    F  +++R+   K+KS
Sbjct: 215 SERALRLCQKLDIPPPPFITRQEAEATWSPMRLSFLNESRRLDIQKLKS 263


>gi|89902067|ref|YP_524538.1| NAD-dependent epimerase/dehydratase [Rhodoferax ferrireducens T118]
 gi|89346804|gb|ABD71007.1| NAD-dependent epimerase/dehydratase [Rhodoferax ferrireducens T118]
          Length = 305

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 119/281 (42%), Gaps = 12/281 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G G  G  +A A L   V     T SV     L+  GI+P L  +      LR   
Sbjct: 1   MLIVGCGDIGLRVAQA-LPARVRLLALTSSVERTAELRQCGITP-LAGNLDAPASLRRLG 58

Query: 63  YFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
                ++    P  EG  D   +++++           + Y S++ +YG+  G+   E  
Sbjct: 59  GLAHRVLHLAPPPDEGWTDARSLALTRAL-GLRSRPDALVYASTSGVYGDCHGEVAIETR 117

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRL 177
             H  +  A +R +AE       +   ++ ++LR+ GIY P R    P  ++ +   +  
Sbjct: 118 ATHADTARARRRIDAENTMRFFGRASGVRSSILRIPGIYAPDRLNGTPQARLIKGTPVLQ 177

Query: 178 VKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT--PP 234
              +   N I  +D+AR CV  L       I+N++DD      +    AA L  +   P 
Sbjct: 178 AADDVYTNHIHADDLARACVAALWRAQAQRIYNVNDDTCLKMGDYFDLAADLYGLARPPR 237

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
           + +   +A++S     F ++++R+ N ++K  L   L YP 
Sbjct: 238 VPRSTASAHLSLMLLSFMSESRRMDNTRLKRELRLALRYPT 278


>gi|254414893|ref|ZP_05028657.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178382|gb|EDX73382.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Microcoleus
           chthonoplastes PCC 7420]
          Length = 314

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 89/182 (48%), Gaps = 16/182 (8%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V+ + YLSS S+YGN+ G WVDE S V   +      + AE+  L    + ++ + +LRL
Sbjct: 141 VQQLIYLSSCSVYGNKNGDWVDETSGVDTDNEYNQVLYEAEQILLNSAPE-DLSVCILRL 199

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFN-RIRVEDVARCVIFLMTHHLGGIFNLSDDE 214
            GIYGP R    ++ +     L    + F   I ++D+   V F   + L GI+NL ++ 
Sbjct: 200 GGIYGPGRELIKRLSRLAGKTLPGSGESFACWIHLDDIVTAVDFACQNRLNGIYNLVNNL 259

Query: 215 PAPPQNV---IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
               + +   + +   L ++       +D    S     F A N RI+N KIK+ G+ L+
Sbjct: 260 RWTSRELCDYVCDNQGLERVI------WDATKPS-----FRALNARINNQKIKAAGYPLI 308

Query: 272 YP 273
           +P
Sbjct: 309 HP 310


>gi|76803237|ref|YP_331332.1| sugar epimerase/dehydratase-like protein [Natronomonas pharaonis
           DSM 2160]
 gi|76559102|emb|CAI50700.1| sugar epimerase/dehydratase homolog [Natronomonas pharaonis DSM
           2160]
          Length = 297

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 75/181 (41%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SST +YG+ +G WVDE + + P +        AE+     T    I   V R +G+YG
Sbjct: 108 YTSSTGVYGDHDGDWVDESTPLSPTTDKTQVLAEAERLARERTADYGISGGVARFAGLYG 167

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQ 219
           P R      R    L     +   N I  +D A  V F++T      +    DDEP    
Sbjct: 168 PDR-----YRLNRYLDGPVTDGYLNMIHRDDAAGVVRFMLTTATESEVLVAVDDEPVDKW 222

Query: 220 NVIMEAASLMKITPP----LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
                 A    +  P     E+  +  ++S   R     +KR SN +++ LG+   YP Y
Sbjct: 223 AFADWLADECGVESPPKRTKEERLEDDSLSEAARRRILTSKRCSNDRVRELGYSFSYPTY 282

Query: 276 R 276
           R
Sbjct: 283 R 283


>gi|163848512|ref|YP_001636556.1| NAD-dependent epimerase/dehydratase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222526446|ref|YP_002570917.1| NAD-dependent epimerase/dehydratase [Chloroflexus sp. Y-400-fl]
 gi|163669801|gb|ABY36167.1| NAD-dependent epimerase/dehydratase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450325|gb|ACM54591.1| NAD-dependent epimerase/dehydratase [Chloroflexus sp. Y-400-fl]
          Length = 307

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 127/304 (41%), Gaps = 33/304 (10%)

Query: 2   HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT--LKHKGISPF---LFADQKIN 55
           H +I GA GY G  +A   L  G    G   S  + +   L  +G++ +   L   + I+
Sbjct: 3   HYLIAGAAGYIGSRLAARLLAAGHRVRGLVYSAEDPVVERLAARGMAVWIGDLTRPETID 62

Query: 56  NLLRE--KLYFTTHIVQCIKPS------SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSI 107
            +  E   ++  T+ +    P+       +G+  +I+MS        ++    + SS + 
Sbjct: 63  GITDEIDVVFNLTNRMPIDNPALLRALYIDGNQHLIAMSVRSRTVRTYL----WASSIAA 118

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           YG+    WVDE S V P   + +    AE+  L   +       +LR++ +YGP R+P  
Sbjct: 119 YGDHGESWVDEDSPVAPSYPLGSIFATAEQTVLQAVRAYRFPAIILRMATVYGPDRDPLE 178

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM-THHLGGIFNLSDDEPAPPQNVIMEAA 226
            I                 I V+D    ++       +G I+N+ DDEP    +++ E  
Sbjct: 179 AIASGQLTIYGNGRNFVPHIHVDDAVEVLLRAAEVGQIGAIYNVGDDEPLRLIDLVSEVR 238

Query: 227 SLMKITPP--------LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRI 277
             + + PP        L    D + I   T      + R+SNA+++  LG +L YP  R 
Sbjct: 239 RRLGMLPPRTFDPNVGLRAGIDRSVIGALTA-----SVRLSNARMRHDLGIELHYPGLRY 293

Query: 278 SLKQ 281
            +++
Sbjct: 294 WIEE 297


>gi|34499240|ref|NP_903455.1| hypothetical protein CV_3785 [Chromobacterium violaceum ATCC 12472]
 gi|34105091|gb|AAQ61447.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 305

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 85/178 (47%), Gaps = 4/178 (2%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++ +YG+  G  +DE + + P +  A +R +AE +      +    L +LR  GIY 
Sbjct: 102 YISTSGVYGDAGGGLLDEAAAIRPRNERAQRRADAEAQLRRFACRRRCALTILRAPGIYA 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQ 219
            +R P  +      L +  ++   N I  +D+A+ CV  L       ++N  DD P P  
Sbjct: 162 DERLPLSRFASGAPLIIDAEDSWSNHIHADDLAQLCVAALRRRRGIRVYNACDDRPMPVG 221

Query: 220 NVIMEAASLMKIT--PPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
                    + ++  P L +    A ++P    F A+++R+ N+++ + L  +L +P+
Sbjct: 222 QWYAALGETLGLSMPPRLPRAEVKARVAPSQWSFLAESRRLDNSRMRRELDVRLRWPS 279


>gi|49083326|gb|AAT51002.1| PA5343 [synthetic construct]
          Length = 284

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 123/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGILPVAGDLQAPECPAQWPS 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + 
Sbjct: 115 AQTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG-----GIFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+    G     G +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEGCYIGVDDAPV----A 224

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
           + E A  ++    + Q  D  ++        A +KR SN + ++LG+   YP+YR
Sbjct: 225 MHEVADYLRQRLGVSQWADEHSVR------RAGSKRCSNRRARALGWVPRYPSYR 273


>gi|289582271|ref|YP_003480737.1| NAD-dependent epimerase/dehydratase [Natrialba magadii ATCC 43099]
 gi|289531824|gb|ADD06175.1| NAD-dependent epimerase/dehydratase [Natrialba magadii ATCC 43099]
          Length = 302

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 13/183 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SST ++G+ +G WVD  + + P +        AE+  L  + +  I   V R +G+YG
Sbjct: 111 YTSSTGVHGDHDGDWVDSETPIEPTTPKTEVLAEAEQIALEYSAEFGIDGTVARYAGLYG 170

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPP 218
           P R      R +  L         N +  +D A  V FL+   L  G +  + DDEP   
Sbjct: 171 PDR-----YRLQRYLEGPVTEGYLNMVHRDDAAGAVRFLLEEDLGRGEVVQIVDDEPVEK 225

Query: 219 QN-VIMEAASLMKITPP----LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
                  A    +  PP     E+  D     P  R     +KR +N +++ LG++  YP
Sbjct: 226 WAFADWLADGCGREHPPKRTKAERLADGDLSEPAQRRILT-SKRCANDRLRELGYEFSYP 284

Query: 274 NYR 276
            +R
Sbjct: 285 TFR 287


>gi|46446796|ref|YP_008161.1| hypothetical protein pc1162 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46400437|emb|CAF23886.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 269

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 105/235 (44%), Gaps = 36/235 (15%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSN---LLTLKHK-------GISPFLFA 50
           M + I G GY G+  A        +   TTR +     L T  H+        I PFL A
Sbjct: 1   MRIGILGCGYVGQAAAVFWKNQSHFLTVTTRQIEKINFLQTFAHQVHQLTDDNILPFL-A 59

Query: 51  DQKINNLLREKLYFTTHIVQCIKPSSEGD--PCIISMSKDFYKFMPH---VKWIGYLSST 105
           +Q I             ++  +  +S  D     +  ++   + +P    +K I Y  ST
Sbjct: 60  NQDI-------------LLVSVAAASSRDYQNTYLETARRIIELLPQTPSLKQIIYTGST 106

Query: 106 SIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR-- 163
           S+YG+ +G WVDE + ++P++  +      E+ +L     +N+   + RL  IYGP R  
Sbjct: 107 SVYGDFQGNWVDETTLLNPLNEQSYCLSQTEQFFLKAPSSVNV--TIFRLGEIYGPGRWI 164

Query: 164 -NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAP 217
            +  I++ Q +       NQ+ N I + D+ R + F + + L GIFNL +D   P
Sbjct: 165 TDRVIRMHQYSFPG--TGNQLTNVIHLTDIVRALDFALQNKLHGIFNLCNDFHIP 217


>gi|87121088|ref|ZP_01076979.1| NAD-dependent epimerase/dehydratase [Marinomonas sp. MED121]
 gi|86163580|gb|EAQ64854.1| NAD-dependent epimerase/dehydratase [Marinomonas sp. MED121]
          Length = 288

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 92/199 (46%), Gaps = 23/199 (11%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWV--DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLA 151
           PHV    ++SSTS+YG  +   +   E +   P S  A     AEK WL    +  ++  
Sbjct: 100 PHVF---FVSSTSVYGAEQDGAIGLQESTPAMPSSETAKVLRQAEKVWL----EGQLEHT 152

Query: 152 VLRLSGIYGPKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG---- 206
           V+R SGIYGP RN  + KI Q         NQ  NRI  +D    ++F+   +  G    
Sbjct: 153 VVRFSGIYGPGRNRTLDKIAQGQGFS--APNQWTNRIHRDDCVESLVFMAQAYFAGTRLE 210

Query: 207 -IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS 265
            ++  +D+ P     ++   A+ M +   L      A++ P         K++S+  +++
Sbjct: 211 PLYIGTDNAPVSQWELVNWIAAQMGVKQTLTSELSLADMIP------NKGKQLSSQALQN 264

Query: 266 LGFQLLYPNYRISLKQLWK 284
           LG+Q +YP+Y    + L K
Sbjct: 265 LGYQFIYPSYVQGYQALLK 283


>gi|74318580|ref|YP_316320.1| putative oxidoreductase protein [Thiobacillus denitrificans ATCC
           25259]
 gi|74058075|gb|AAZ98515.1| putative oxidoreductase protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 291

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 122/288 (42%), Gaps = 11/288 (3%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G G   + +  A L    +  G  R    +  L+  G+ P+L        L  ++L
Sbjct: 4   ILIVGFGDVAERLVRAYLGQAEF-IGVVRRAERVSALRALGVRPYLGDLDDPATL--KRL 60

Query: 63  YFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
                +     P ++G  D     +     +  P    + Y+S++ +YG+  G WV E  
Sbjct: 61  PRADAVFHFAPPPADGRSDSRTAHLLHALGRHKPGA--LVYISTSGVYGDCGGNWVAETR 118

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
            V P++  A +R +AE+   A  ++ ++++ +LR  GIY   R P  +I++     L + 
Sbjct: 119 PVAPVNARAVRRVDAERRLRAWGRQRHVQVTILRAPGIYAADRLPLARIQRGTPALLSQD 178

Query: 181 NQVFNRIRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI--TPPLEQ 237
           +   N I  +D+AR     L       I++  D  P    +     A    +   P +E+
Sbjct: 179 DSYTNHIHADDLARLAWAALFRGRDQRIYHAVDAHPLKMGDWFDSCADAFGLPRPPRVER 238

Query: 238 CFDTANISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISLKQLWK 284
                 +S     F  +++++SNA+  + L  +  YP     L+++ +
Sbjct: 239 AEAEKVLSEALLSFLRESRQLSNARTTRELRMKYRYPTSDALLREIGR 286


>gi|325962332|ref|YP_004240238.1| nucleoside-diphosphate-sugar epimerase [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468419|gb|ADX72104.1| nucleoside-diphosphate-sugar epimerase [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 286

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 81/185 (43%), Gaps = 13/185 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST++YG+ +G WVDE +   P          AE+               LRL GIYG
Sbjct: 103 FVSSTAVYGDADGGWVDERTPPAPGGFSGRVLVEAEQLLQDRFTGTPTSATSLRLGGIYG 162

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT--HHLGGIFNLSDDEPAPP 218
           P R   I   +     + +  +  NRI  +D A  ++ L T       I+   D++PA  
Sbjct: 163 PGRTRLIDQVRGGDAVIPEDVRYTNRIHRDDAAAAIVHLATTPAEPAPIYGGVDNDPADL 222

Query: 219 QNVI-MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
            +V+   AA + +  PP+       +  P        NKR  N  ++S GF+  +P++R 
Sbjct: 223 GSVLRFLAAEMGQPEPPV------GDAGP----ARGGNKRCRNDLLRSTGFEFAFPSFRE 272

Query: 278 SLKQL 282
             + +
Sbjct: 273 GYRDI 277


>gi|319762127|ref|YP_004126064.1| trka-n domain protein [Alicycliphilus denitrificans BC]
 gi|330826042|ref|YP_004389345.1| TrkA-N domain-containing protein [Alicycliphilus denitrificans
           K601]
 gi|317116688|gb|ADU99176.1| TrkA-N domain protein [Alicycliphilus denitrificans BC]
 gi|329311414|gb|AEB85829.1| TrkA-N domain protein [Alicycliphilus denitrificans K601]
          Length = 313

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 125/298 (41%), Gaps = 22/298 (7%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVY--TCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
            L+I G G  G  +A +    G        T S + +  L+  G+ P +       +L R
Sbjct: 19  RLLIIGCGDVGLRVARSLGAGGPRPRVLALTSSPARVPQLRAAGVMPLVGNLDDAASLAR 78

Query: 60  EKLYFTTHIVQCIKPSSEG--------DPCIISMSKDFYK-FMPHVKWIGYLSSTSIYGN 110
                 T ++    P  EG        D    ++ +   +  +P    + Y S++ +YG+
Sbjct: 79  LA-GLATRVLHLAPPPGEGAVGPRWWLDRRSTALVRVLRRRALPQA--LVYASTSGVYGD 135

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFI 167
             G+WV E   V P +  A +R NAE+    + +   ++ ++LR+ GIY P R    P  
Sbjct: 136 CAGEWVAESRPVAPATPRAQRRVNAERAVRHLGRA-GVRASILRVPGIYAPDREGGTPEA 194

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           ++R+   +     +   N I  +D+AR CV  L        +N++DD      +    AA
Sbjct: 195 RLRRGTPVLAAPDDVYTNHIHADDLARACVAALWRGRPQRAYNVADDSQLKMGDYFDLAA 254

Query: 227 SLMKITPPLEQCFDTANIS-PFTRF-FYADNKRISNAKI-KSLGFQLLYPNYRISLKQ 281
           +L  +  P       A    P +   F  +++R+   ++ + L  +L YP  R  L++
Sbjct: 255 NLYGLPRPPRVARSLAQQQLPLSLLSFMGESRRLVTTRMARELRLRLRYPTVREGLQR 312


>gi|323527104|ref|YP_004229257.1| hypothetical protein BC1001_2783 [Burkholderia sp. CCGE1001]
 gi|323384106|gb|ADX56197.1| hypothetical protein BC1001_2783 [Burkholderia sp. CCGE1001]
          Length = 346

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 88/180 (48%), Gaps = 8/180 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE   V P +  A +R +AE++    T +  I  ++ R+ GIY 
Sbjct: 153 YASTTGVYGDCGGAWIDETRVVAPANARAKRRVSAEQQLRRATARGAIAASIARIPGIYA 212

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFL-MTHHLGGIFNLSDDEPAPP 218
             R P  ++ +K +  LV  + V+ N I  +D+A  ++ L +        + SDD     
Sbjct: 213 GNRLPLARL-EKGTPALVAADDVYTNHIHADDLAAILVRLALRGRPARAIHASDDSSLKM 271

Query: 219 Q---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
               + + +A  L +  P + +      I P    F  +++R+ N ++K  LG +L YP+
Sbjct: 272 GEYFDRVADAFGLAR-PPRITRAQAEEQIEPTLLSFMRESRRLVNRRLKEELGVRLRYPS 330


>gi|90023359|ref|YP_529186.1| phosphate ABC transporter permease [Saccharophagus degradans 2-40]
 gi|89952959|gb|ABD82974.1| NAD-dependent epimerase/dehydratase [Saccharophagus degradans 2-40]
          Length = 296

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 117/259 (45%), Gaps = 33/259 (12%)

Query: 42  KGISPFLFA--DQKINNLLREKLYFTTHIVQCIKP---SSEG------DPCIISMSKDFY 90
           +G+S +L +  D +I N + +  + T  +V  + P   S EG      DP + ++S  + 
Sbjct: 41  EGVSQWLGSAQDAEILNKISQTAFDT--VVITLTPAARSDEGYKAGYVDP-LQALSNAWQ 97

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
                 K + ++SSTS+YG  E +WVDE S   P +    +   AEK  L++ +      
Sbjct: 98  ASNTPPKCVIFVSSTSVYGQNEDEWVDETSTCKPTNYSGQRILEAEKLALSLAENGTTTS 157

Query: 151 AVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGI-- 207
            ++R SGIYGP R+  +    +  L      + + NRI  +D A  +  L+  H  G   
Sbjct: 158 CIVRFSGIYGPGRDQLL----RQVLAGKAGTEAYTNRIHADDCAGVLAHLIQLHASGQQL 213

Query: 208 ---FNLSDDEPAPPQNVIMEAA-SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI 263
              +  SD EP     V  +AA   +     L +     + +  TR   A +KR +N +I
Sbjct: 214 ASHYLASDCEP-----VTAKAARQWLGKQLGLPETHLKRDPTAKTR---AGSKRCNNKRI 265

Query: 264 KSLGFQLLYPNYRISLKQL 282
              G+  +Y +YR   K +
Sbjct: 266 LESGYSFIYSSYREGYKDI 284


>gi|296392203|ref|ZP_06881678.1| hypothetical protein PaerPAb_28787 [Pseudomonas aeruginosa PAb1]
          Length = 283

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGILPVAGDLQAPECPAQWPS 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + 
Sbjct: 115 AQTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+    GG      +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEDCYIGVDDAP------ 222

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 223 ----VAMHEVVDYLRQRLGVSQWADGHSVRRAGSKRCSNRRARALGWVPRYPSYR 273


>gi|187734583|ref|YP_001876695.1| NAD-dependent epimerase/dehydratase [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187424635|gb|ACD03914.1| NAD-dependent epimerase/dehydratase [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 284

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 121/296 (40%), Gaps = 33/296 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G GY GK +A++  K G      T  +        K I     ADQ     L  ++
Sbjct: 12  VLILGTGYLGKALAESLRKAG--HTALTADID-----PQKAIYEADVADQASMQGLAARI 64

Query: 63  YFTTHIVQCIKPSSEGDPCIISM-------SKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
                IV C      G+    ++       + + +   P +    + SST++YG  +G+W
Sbjct: 65  PSPQIIVMCASTRGGGEEAYRNLYAHGTRNTLEAFSGTPVI----FCSSTAVYGITDGRW 120

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKNS 174
           + E   V+P S        AE+  LA          V+RL  +YGP R   + +   K  
Sbjct: 121 ITEEHNVYPSSGKNGLLIQAEQAVLAAGGT------VVRLGALYGPGRCVLVSQYVTKGK 174

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMT--HHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
                 N+  N I  +D A  +  L T      GI+NL+D  P     +    ++L+   
Sbjct: 175 ALPGAMNRWLNYIHRDDAAAALHLLCTLREPPAGIYNLTDRTPMQMGEIYSYLSNLLGKP 234

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIEN 288
            P  +         F+      N+RIS +++ +LG++ LYP++   +  + + +E 
Sbjct: 235 APQPEPLPAEARRGFS------NQRISCSRLLALGWEPLYPSFADGVHNVLEALEE 284


>gi|15600536|ref|NP_254030.1| hypothetical protein PA5343 [Pseudomonas aeruginosa PAO1]
 gi|116053490|ref|YP_793817.1| hypothetical protein PA14_70550 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313106770|ref|ZP_07792986.1| putative epimerase [Pseudomonas aeruginosa 39016]
 gi|9951662|gb|AAG08728.1|AE004946_12 hypothetical protein PA5343 [Pseudomonas aeruginosa PAO1]
 gi|115588711|gb|ABJ14726.1| putative epimerase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310879488|gb|EFQ38082.1| putative epimerase [Pseudomonas aeruginosa 39016]
          Length = 283

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGILPVAGDLQAPECPAQWPS 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + 
Sbjct: 115 AQTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+    GG      +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEDCYIGVDDAP------ 222

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 223 ----VAMHEVVDYLRQRLGVSQWADEHSVRRAGSKRCSNRRARALGWVPRYPSYR 273


>gi|254237964|ref|ZP_04931287.1| hypothetical protein PACG_04075 [Pseudomonas aeruginosa C3719]
 gi|126169895|gb|EAZ55406.1| hypothetical protein PACG_04075 [Pseudomonas aeruginosa C3719]
          Length = 283

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVGAL----PQGILPVAGDLQAPECPAQWPS 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + 
Sbjct: 115 AQTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+    GG      +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEDCYIGVDDAP------ 222

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 223 ----VAMHEVVDYLRQRLGVSQWADEHSVRRAGSKRCSNRRARALGWVPRYPSYR 273


>gi|114331041|ref|YP_747263.1| NAD-dependent epimerase/dehydratase [Nitrosomonas eutropha C91]
 gi|114308055|gb|ABI59298.1| NAD-dependent epimerase/dehydratase [Nitrosomonas eutropha C91]
          Length = 301

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 126/294 (42%), Gaps = 13/294 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G     +A+  L       G  R V N   L+  GI+P      +  +L R   
Sbjct: 5   LLIVGCGDIASRVANL-LGQCYQLFGLCRRVENFDHLRTLGITPIAGDLDQPASLERMAG 63

Query: 63  YFTTHIVQCIKPSSEG--DPCIISMSKDFYKFMPHVK------WIGYLSSTSIYGNREGQ 114
                ++    P  +G  D   + +     +   + K       + Y+S++ +YG+  G 
Sbjct: 64  VAAHSVLHLAPPPGQGKRDTRTLHLLSALSRRQSNTKKRILPQQLIYISTSGVYGDCSGN 123

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V+E   V+P +  A +R +AE++      +  +++++LR+ GIY   R P  ++RQ   
Sbjct: 124 RVNESYPVNPRNDRAYRRLDAERQIRNWGMRNGVRVSILRVPGIYAHNRLPLERLRQGTP 183

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKI-- 231
             L  ++   N I  +D+AR ++  +     G I++ SDD            A+      
Sbjct: 184 ALLPAEDSYTNHIHADDLARIIVAALRFGKSGRIYHASDDSCLKMGEYFDLVANHFNFPG 243

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNYRISLKQLWK 284
           T  + +      +SP    F  +++R++N +IK  L  +L YP     L ++ K
Sbjct: 244 TRKITRQEAKETLSPSLLSFMLESRRLTNDRIKRELQVRLRYPTVGACLAEIEK 297


>gi|218894446|ref|YP_002443316.1| putative epimerase [Pseudomonas aeruginosa LESB58]
 gi|254243771|ref|ZP_04937093.1| hypothetical protein PA2G_04598 [Pseudomonas aeruginosa 2192]
 gi|126197149|gb|EAZ61212.1| hypothetical protein PA2G_04598 [Pseudomonas aeruginosa 2192]
 gi|218774675|emb|CAW30492.1| putative epimerase [Pseudomonas aeruginosa LESB58]
          Length = 283

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGILPVAGDLQAPECPAQWPS 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQARGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + 
Sbjct: 115 AQTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+    GG      +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEDCYIGVDDAP------ 222

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 223 ----VAMHEVVDYLRQRLGVSQWADEHSVRRAGSKRCSNRRARALGWVPRYPSYR 273


>gi|120610658|ref|YP_970336.1| NAD-dependent epimerase/dehydratase [Acidovorax citrulli AAC00-1]
 gi|120589122|gb|ABM32562.1| NAD-dependent epimerase/dehydratase [Acidovorax citrulli AAC00-1]
          Length = 315

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 118/268 (44%), Gaps = 20/268 (7%)

Query: 30  TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE--------GDPC 81
           T + + +  L+  G  P L  D      LR      T ++    P  E         DP 
Sbjct: 51  TSTPARMAGLRAAGTVP-LVGDLDDVRTLRRLAGLATRVLHLAPPPGERDAGTAWWTDPR 109

Query: 82  IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLA 141
            +++++   +     + + Y S++ +YG+  G  V E   V P +  A +R NAE+    
Sbjct: 110 TVALAR-VLRLRSLPRALVYGSTSGVYGDCGGARVPETRPVAPATPRARRRVNAERAVRH 168

Query: 142 ITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-CV 196
           + +   ++ +VLR+ GIY P R    P  ++R + +  LV+++ V  N I  +D+AR CV
Sbjct: 169 LGRA-GVRASVLRIPGIYAPDREGGTPEARLR-RGTPALVREDDVHTNHIHADDLARACV 226

Query: 197 IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYAD 254
             L       I+++SD       +    AA L  +  P  + +      +SP    F ++
Sbjct: 227 AALWRGRAQRIYHVSDASSLKMGDYFDLAADLYGLPRPRRITRAQAGEELSPMLLSFMSE 286

Query: 255 NKRISNAKI-KSLGFQLLYPNYRISLKQ 281
           ++R+   ++ K L  +L YP     L+ 
Sbjct: 287 SRRLDATRLAKELRVRLRYPTVAEGLRS 314


>gi|107104445|ref|ZP_01368363.1| hypothetical protein PaerPA_01005522 [Pseudomonas aeruginosa PACS2]
          Length = 278

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 120/294 (40%), Gaps = 47/294 (15%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLRE 60
           MI G G  G  + +A L  G    G  RSV  L     +GI P    L A +       E
Sbjct: 1   MIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGILPVAGDLQAPECPAQWPSE 56

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIYG 109
            L +  +     +    G          +   + HV  W+           ++SST +Y 
Sbjct: 57  PLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVYA 110

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-K 168
             +G W+DE S    +S   + R   + E +A+     I    +RL+GIYGP R   + +
Sbjct: 111 QTDGGWIDEESPA--LSQAYSGRIMLDAEQVALDS--GIPATRVRLAGIYGPGREWLLNQ 166

Query: 169 IRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVI 222
           +RQ    R+V +  ++ NRI  +D A  + FL+    GG      +   DD P       
Sbjct: 167 VRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADAGGQALEDCYIGVDDAP------- 217

Query: 223 MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
               ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 218 ---VAMHEVVDYLRQRLGVSQWADEHSVRRAGSKRCSNRRARALGWVPRYPSYR 268


>gi|212275031|ref|NP_001130804.1| hypothetical protein LOC100191908 [Zea mays]
 gi|194690158|gb|ACF79163.1| unknown [Zea mays]
 gi|224031569|gb|ACN34860.1| unknown [Zea mays]
          Length = 142

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 69/123 (56%), Gaps = 7/123 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLR 59
           ++ +FGAG+ G+++++  L  G    GT  +V+    L+  G++  +F   +  + N+  
Sbjct: 22  NMFVFGAGFVGRYVSERLLAQGWQVSGTCTTVTTKRELEMLGMNASVFDGTEDSLENI-- 79

Query: 60  EKLYFTTHIVQCIKP-SSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNREGQWV 116
             L   TH++  I P    GDP +I++ +D  + + H  ++W+ YLSSTS+YG+  G  V
Sbjct: 80  HSLRQATHLLISIPPIPGVGDPLLINLDEDLRRILGHGNLEWLCYLSSTSVYGDCGGVLV 139

Query: 117 DEH 119
           DE 
Sbjct: 140 DEE 142


>gi|239814301|ref|YP_002943211.1| NAD-dependent epimerase/dehydratase [Variovorax paradoxus S110]
 gi|239800878|gb|ACS17945.1| NAD-dependent epimerase/dehydratase [Variovorax paradoxus S110]
          Length = 313

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 129/294 (43%), Gaps = 18/294 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L+I G G  G+ +A + L+  +     T S   +  L+  GI P L  +      LR  
Sbjct: 19  RLLIVGCGDVGQRVARS-LRGRMQLVALTSSGERVPALRAAGIRP-LQGNLDDPATLRRL 76

Query: 62  LYFTTHIVQCIKPSSEG------DPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
               T ++    P+ +G      D    ++++        + ++ Y S++ +YG+  G  
Sbjct: 77  AGVATRVLHVAPPARDGGAAWWRDQRTTALARALRLRSVPLAFV-YGSTSGVYGDCGGAR 135

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN---PFIKIRQK 172
           V E   V P +  A +R +AE+    + +   ++ ++LR+ GIY P R    P  ++ + 
Sbjct: 136 VSETRPVRPDTPRAHRRVDAERAVRWLGRSAGVRASILRIPGIYAPDREGGTPRQRLARG 195

Query: 173 NSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMK 230
             + L +++ VF + I  +D+AR CV  L       I + SDD      + I  AA L  
Sbjct: 196 TPV-LRREDDVFTSHIHADDLARACVAALFRGRPQRIVHASDDTELRMGDYIDLAADLYG 254

Query: 231 ITPPLEQCFDTANIS-PFTRF-FYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
           +  P     + A    P     F  +++R+ N ++K  L  +L +P     L++
Sbjct: 255 MPRPPRVAREEAQRQLPLQLLSFMGESRRLDNTRLKRELRVRLAHPTVHTGLRE 308


>gi|145589903|ref|YP_001156500.1| NAD-dependent epimerase/dehydratase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048309|gb|ABP34936.1| NAD-dependent epimerase/dehydratase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 298

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 3/192 (1%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V+ + Y+S+T +YG+ +G  VDE S V+P S  A +R +AE+          + L +LR+
Sbjct: 105 VRRLIYISTTGVYGDHQGAKVDEASPVNPQSERAKRRVDAERTLRLWAPAHGVSLTILRV 164

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDE 214
            GIY   R P  +++      +  ++   N I  +D+AR V   +       I N  D  
Sbjct: 165 PGIYAADRLPLDRLKSGTPALIPGEDAYSNHIHSDDLARLVCAAVYRGKPQRIINTCDGG 224

Query: 215 PAPPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
                +   E A    +  P  L        +SP    F  +++R++N +++ L   L Y
Sbjct: 225 ETKMGDYFDEVADAFGLQRPSRLPASELQPLVSPMLWSFMRESRRVTNKRLQELKTPLRY 284

Query: 273 PNYRISLKQLWK 284
           P+    LK + K
Sbjct: 285 PSVADFLKTISK 296


>gi|116070770|ref|ZP_01468039.1| hypothetical protein BL107_14030 [Synechococcus sp. BL107]
 gi|116066175|gb|EAU71932.1| hypothetical protein BL107_14030 [Synechococcus sp. BL107]
          Length = 215

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 78/172 (45%), Gaps = 9/172 (5%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           + YLSS  +YGN+ G   DE +     +       +AE+  L++         VLRL GI
Sbjct: 39  VSYLSSAGVYGNQLGAVCDESTPTDRSNTANALLADAEEAVLSL-NGFGTSTCVLRLGGI 97

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIFNLSDDEPAP 217
           YGP ++    IR  +   + K     N  + + D+ + + F     L G+FNL DD    
Sbjct: 98  YGPNKDIASFIRSASGHMVPKNGSHINAWVHLRDIVQGIDFAYQQRLHGVFNLVDDLQVS 157

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQ 269
            +++         + P + +  D ++     R F   N R+SN K+K LGFQ
Sbjct: 158 RRDLSNLLCDDEGLAPVIWENHDRSD----ARIF---NARVSNEKLKQLGFQ 202


>gi|148242471|ref|YP_001227628.1| putative nucleoside-diphosphate-sugar epimerase [Synechococcus sp.
           RCC307]
 gi|147850781|emb|CAK28275.1| Putative nucleoside-diphosphate-sugar epimerase [Synechococcus sp.
           RCC307]
          Length = 313

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 109/289 (37%), Gaps = 29/289 (10%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           H  + G GY G+ +       G     TTR  S L  L+       LF  +  +N L   
Sbjct: 25  HRAVVGCGYVGRRLVSGWSGEGHTVTATTRRDSRLHQLRSHVDQAVLFDSEATSNDL-SF 83

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV------------KWIGYLSSTSIYG 109
           L     +V  + P+ +   C+ +    + + +  +              I +LSS  +YG
Sbjct: 84  LGDVDVLVVSLAPTGQQHVCVEAYESVYRRGIEMLCDGIANRHSNRPLQIIHLSSCGLYG 143

Query: 110 NREGQWVDEH---SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN-P 165
           NR+G    EH      HP++ +        ++ L   +   I +  LRL GIYGP R  P
Sbjct: 144 NRDGALTSEHMGLDLNHPVNAL----LAGAEQQLQSLRSEAINVCTLRLGGIYGPDREIP 199

Query: 166 FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEA 225
              +           + V   + V+DV + V       L    N+ DD     + +  + 
Sbjct: 200 EWLVAAAGQCVERNGDHVPCWVHVDDVVQAVNLAAEQKLNTTLNVVDDIKLSKRAITDQL 259

Query: 226 ASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
              +   P +         S   R  +A    ISN  +K LGFQL +P+
Sbjct: 260 CEAIGCPPVI-----WMGSSQDERILHA---AISNESLKDLGFQLQHPS 300


>gi|78185845|ref|YP_378279.1| hypothetical protein Syncc9902_2278 [Synechococcus sp. CC9902]
 gi|78170139|gb|ABB27236.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 279

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 90/191 (47%), Gaps = 29/191 (15%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P ++ I Y SS S+YG+ +G+WV E +  +P +       ++E    AI +   + + +
Sbjct: 104 LPQLRQIIYTSSCSVYGDAQGEWVSESTPTNPGNGHGAVLVDSESLLQAIHQPSRL-VCI 162

Query: 153 LRLSGIYGPKRNPFIKIRQKN---SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           LRL  ++GP R    K R +N     R  +  Q  N + V+DVA  +   MT    G+ N
Sbjct: 163 LRLGALHGPGRE--FKDRFQNLAGQTRPGRGQQFTNWVHVDDVAGAIKAAMTEMWSGVIN 220

Query: 210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADN-------KRISNAK 262
           + +D+P             ++I   +++   +  + P     + D+       +R+ N +
Sbjct: 221 VVNDQP-------------IRIADLIDRTLSSEGLEPIR---WGDDPKTASSGRRVRNTR 264

Query: 263 IKSLGFQLLYP 273
           + +LG+ L +P
Sbjct: 265 LHALGYVLKHP 275


>gi|220911767|ref|YP_002487076.1| NAD-dependent epimerase/dehydratase [Arthrobacter chlorophenolicus
           A6]
 gi|219858645|gb|ACL38987.1| NAD-dependent epimerase/dehydratase [Arthrobacter chlorophenolicus
           A6]
          Length = 286

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 78/193 (40%), Gaps = 29/193 (15%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST++YG+  G WVDE +   P          AE    +           LRL GIYG
Sbjct: 103 FVSSTAVYGDAGGGWVDEGTAPEPGGFSGRVLVEAEDLLRSRLAGSGTAAVSLRLGGIYG 162

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ- 219
           P R   I   +  +  + +  +  NRI  +D A  V+ L T          D  PAP   
Sbjct: 163 PGRTRLIDQVRSGTAVVPEDVRYTNRIHRDDAAAAVVHLATM---------DSTPAPVYI 213

Query: 220 NVIMEAASL----------MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQ 269
            V  EAA L          +K+  P        +  P       +NKR SNA +++ GF 
Sbjct: 214 GVDNEAADLGLVLRFLATELKLPEPA-----VGDAGP----ARGNNKRCSNALLRASGFT 264

Query: 270 LLYPNYRISLKQL 282
             +P +R   + +
Sbjct: 265 FTFPTFREGYRDV 277


>gi|116071851|ref|ZP_01469119.1| hypothetical protein BL107_06864 [Synechococcus sp. BL107]
 gi|116065474|gb|EAU71232.1| hypothetical protein BL107_06864 [Synechococcus sp. BL107]
          Length = 281

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 25/189 (13%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P ++ I Y SS S+YG+ +G+WV E +  +P +       ++E   L    +   ++ +
Sbjct: 106 LPQLRHIIYTSSCSVYGDAQGEWVSESTPTNPSNGHGAVLVDSEA-LLQTIDQPTRRVCI 164

Query: 153 LRLSGIYGPKRNPFIKIRQKN---SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           LRL  ++GP R    K R +N     R  +  Q  N + V+DVA  +   MT    G+ N
Sbjct: 165 LRLGALHGPGRE--FKDRFQNLAGQTRPGRGQQFTNWVHVDDVAGAIKAAMTEKWSGVIN 222

Query: 210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFF-----YADNKRISNAKIK 264
           + +D+P             ++I   +++   +  + P  R+       +  +R+ N ++ 
Sbjct: 223 IVNDQP-------------IRIAELIDRTLSSEGLEPI-RWVDDPKTASSGRRVRNTRLH 268

Query: 265 SLGFQLLYP 273
           +LG+ L +P
Sbjct: 269 ALGYVLKHP 277


>gi|71905922|ref|YP_283509.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase/isomerase [Dechloromonas aromatica RCB]
 gi|71845543|gb|AAZ45039.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase/isomerase [Dechloromonas aromatica RCB]
          Length = 296

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 93/189 (49%), Gaps = 12/189 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE---KEWLAITKKLNIKLAVLRLSG 157
           Y+S+T +YG+  G  +DE   ++P S  A +R +AE   ++W A T    + +++LR  G
Sbjct: 102 YVSTTGVYGDCGGAQIDETRRLNPESARAGRRVDAERCLRDWGART---GVLVSILRAPG 158

Query: 158 IYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEP- 215
           IY   R P  ++++     L + +   N I   D+A   I  + +  G  ++N+ DD   
Sbjct: 159 IYAADRLPLERLQKGTPALLGEDDGYTNHIHANDLAAACIAALRNGRGNRVYNVVDDSDL 218

Query: 216 --APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLY 272
             A   + + +A +L +  P + +      +SP    F  +++RI N ++ K L  +L Y
Sbjct: 219 KMAEYFDRVADAFALPR-PPRISRREAEKTLSPVQMSFMRESRRIGNQRLKKELKLRLAY 277

Query: 273 PNYRISLKQ 281
           P   + + +
Sbjct: 278 PTVDVGIAE 286


>gi|152998383|ref|YP_001343218.1| NAD-dependent epimerase/dehydratase [Marinomonas sp. MWYL1]
 gi|150839307|gb|ABR73283.1| NAD-dependent epimerase/dehydratase [Marinomonas sp. MWYL1]
          Length = 280

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 87/204 (42%), Gaps = 19/204 (9%)

Query: 90  YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIK 149
           Y+ M     + ++SSTS+YG  +G+W+DE +   PIS  A      E+   A    + + 
Sbjct: 91  YRDMAKQPKVFFVSSTSVYGQSQGEWIDETTPAQPISATAKILIETEQALAAAFSSVAV- 149

Query: 150 LAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
               R SGIYGP R  F  +    S +  + N   NRI  +DV   ++ L         N
Sbjct: 150 ----RCSGIYGPGR--FRLLETVLSGKDWEANSWTNRIHRDDVVSALVLLA--------N 195

Query: 210 LSDDEPAPPQNVIM---EAASLMKITPPLEQCFDT-ANISPFTRFFYADNKRISNAKIKS 265
            +  +   P ++I+      S+ ++   L  C      +S    F     KRI    + S
Sbjct: 196 CALSKKVIPAHIIVTDQTPVSMWEVKLWLATCLAAEVAVSSGEGFVPTSGKRIQGQYLLS 255

Query: 266 LGFQLLYPNYRISLKQLWKEIENL 289
            G++L YP+Y     +L  E   L
Sbjct: 256 QGWRLQYPSYVAGYHELLCEFNAL 279


>gi|293604054|ref|ZP_06686465.1| ActC family protein [Achromobacter piechaudii ATCC 43553]
 gi|292817536|gb|EFF76606.1| ActC family protein [Achromobacter piechaudii ATCC 43553]
          Length = 313

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 90/195 (46%), Gaps = 20/195 (10%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLA--V 152
            +K + ++SS+++YG   G WVDE +   P      Q FN      A        L+   
Sbjct: 133 QLKRVVFVSSSAVYGEHHGDWVDEDTPPAP------QGFNGRVLLEAEAALAARGLSSTS 186

Query: 153 LRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFL-MTHHLGGIFNL 210
           +RL+G+YGP R   I+  +  ++   ++ + + NR+ ++D A  V  L +   +  ++  
Sbjct: 187 IRLAGLYGPGRLQLIERLRSGAVGAPRQPEHWANRMHIDDAASAVFHLALLPEVAPVYVG 246

Query: 211 SDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            DD P P   +  E AS M   P        AN+          +K++SNA++++ GF L
Sbjct: 247 CDDTPLPLHVLYAELAS-MAGAPEPRDAPAPANVG---------SKKLSNARLRASGFTL 296

Query: 271 LYPNYRISLKQLWKE 285
            +P+ R     L  E
Sbjct: 297 QWPDSRQGYAALLNE 311


>gi|221065690|ref|ZP_03541795.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni KF-1]
 gi|220710713|gb|EED66081.1| NAD-dependent epimerase/dehydratase [Comamonas testosteroni KF-1]
          Length = 295

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 86/169 (50%), Gaps = 13/169 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAI--TKKLNIKLAVLRLSGI 158
           Y S++ +YG+ +GQWV E   V P +  A +R NAE   LA+    +  ++ ++LR+ GI
Sbjct: 109 YASTSGVYGDCQGQWVSETRSVAPTTARAQRRVNAE---LAVRFAGRSGLRTSLLRIPGI 165

Query: 159 YGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDD 213
           Y P R    P  ++ Q+ +  L  ++ V+ N I  +D+AR C++ L       I++ SDD
Sbjct: 166 YAPDREGGTPRTRL-QRGTAVLQPEDDVYTNHIHADDLARACLLALWRGKAQRIYHASDD 224

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANIS-PFTRF-FYADNKRISN 260
                 +    AA L  +  P     + A    P +   F ++++R+SN
Sbjct: 225 TQLKMGDYFDLAADLYGLARPPRISREQAQTELPASLLSFMSESRRLSN 273


>gi|115374184|ref|ZP_01461471.1| ActC [Stigmatella aurantiaca DW4/3-1]
 gi|310820906|ref|YP_003953264.1| ActC protein [Stigmatella aurantiaca DW4/3-1]
 gi|115368851|gb|EAU67799.1| ActC [Stigmatella aurantiaca DW4/3-1]
 gi|309393978|gb|ADO71437.1| ActC protein [Stigmatella aurantiaca DW4/3-1]
          Length = 274

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 99/226 (43%), Gaps = 24/226 (10%)

Query: 67  HIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS 126
           H++  I P +  D        + +   P  + + YLSST +YG   G  VDE + V P +
Sbjct: 60  HVISSIPPEAGLD----GRLAEVFARHPPSRCV-YLSSTGVYGATRG-VVDETTPVTPST 113

Query: 127 CVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNR 186
                R  AE    A+ + L      LR++GIYGP R   +++               +R
Sbjct: 114 PAVQGRLEAE----AMFRPLGAM--ALRVAGIYGPGRGMHMRLLSGTHRLPEGGGGRLSR 167

Query: 187 IRVEDVARCV-IFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLM--KITPPLEQCFDTAN 243
           + VED+   + + L     GG++ ++DD  A       E AS +  ++  PL      A 
Sbjct: 168 VHVEDLVEAIRVVLERGEPGGLYCVADDRAA----TQAETASWLCERLALPLPPTVPLAT 223

Query: 244 ISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEIENL 289
           +    R     ++ + NA++K+LG+ L YP++      +  E E L
Sbjct: 224 LHETLR----GDRSVCNARLKALGWTLKYPDFTTGFAAVL-EAEGL 264


>gi|326797346|ref|YP_004315166.1| NAD-dependent epimerase/dehydratase [Marinomonas mediterranea
           MMB-1]
 gi|326548110|gb|ADZ93330.1| NAD-dependent epimerase/dehydratase [Marinomonas mediterranea
           MMB-1]
          Length = 291

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 79/194 (40%), Gaps = 29/194 (14%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SSTS+YG  +G+W+DE S   P    A     AE+    ++       A  R SGIYG
Sbjct: 106 FVSSTSVYGENQGEWIDESSIAKPQKDTAKCLLQAEQ---ILSDAFGACSA--RCSGIYG 160

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN---------- 209
           P R   I K++      +   N   NRI  +DV   ++ L    L G             
Sbjct: 161 PGRYRLIEKVKSATEWGI---NSWTNRIHRDDVVSGLMLLGERLLDGAAQENKTSPLPHI 217

Query: 210 -LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            L+DD P     V +  AS +           T N      F     KRI    +K  G+
Sbjct: 218 ILTDDTPVSMWEVKLWIASRIGA---------TVNAGDGCDFIPQSGKRIQANYLKECGW 268

Query: 269 QLLYPNYRISLKQL 282
            L YP+Y +  +QL
Sbjct: 269 MLTYPSYVLGYEQL 282


>gi|222478626|ref|YP_002564863.1| NAD-dependent epimerase/dehydratase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222451528|gb|ACM55793.1| NAD-dependent epimerase/dehydratase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 309

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 76/182 (41%), Gaps = 11/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SST +YG+ +G WVDE + + P +        AE+  L    +  I   V R +G+YG
Sbjct: 118 YTSSTGVYGDHDGAWVDEETPIEPTTDKTRVLAAAERIALETAAEFGIDGTVARFAGLYG 177

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPP 218
           P R      R +  L         N +  +D A  V +L+      G    + DDEP   
Sbjct: 178 PNR-----YRLERYLDGPVTAGYLNMVHRDDAAGAVRYLLEADCARGDAVLVVDDEPIDK 232

Query: 219 QNVIMEAASLMKITPPLEQC----FDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
                  A    +  P ++         ++S         +KR SN ++++LG++  YP 
Sbjct: 233 HAFADWLADACGVPRPAKRSKADQIANGDLSAAAERRIRTSKRCSNDRLRALGYEFTYPT 292

Query: 275 YR 276
           +R
Sbjct: 293 FR 294


>gi|260435569|ref|ZP_05789539.1| NAD dependent epimerase/dehydratase family protein [Synechococcus
           sp. WH 8109]
 gi|260413443|gb|EEX06739.1| NAD dependent epimerase/dehydratase family protein [Synechococcus
           sp. WH 8109]
          Length = 286

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 108/283 (38%), Gaps = 31/283 (10%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF------ADQKINNLL 58
           I G GY G  +A    + G    GTT S   L  L      P L+      AD    N L
Sbjct: 7   IVGCGYVGSAVATHLRRQGHEVVGTTTSPGRLAALCDLVDHPRLYSAGDPMADSSFLNRL 66

Query: 59  REKLYFTTHIV------QCIKPSSEGDPCIISMSKDFYKFMP-HVKWIGYLSSTSIYGNR 111
              L             Q  K   +  P +I          P HV    YLSS  +YG++
Sbjct: 67  DGVLIAMAPTTATFEEDQYEKVYGQAVPALIEALHQRQGRRPLHVT---YLSSAGVYGDQ 123

Query: 112 EGQWVDEHSFVHPISCVATQR---FNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
            G    E   + P  C         +AE   L++    + +  VLRL GIYGP ++    
Sbjct: 124 AGAICSE---LTPPDCSNNANALLASAETSVLSLNDA-STQSCVLRLGGIYGPGKDIPSY 179

Query: 169 IRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAAS 227
           IR      + K     N  + + D+ R V F     L GI+NL DD     + +      
Sbjct: 180 IRSAAGQPVRKNGNHINAWVHLHDIIRGVDFAFGRRLQGIYNLVDDLQFTRRQLSNALCD 239

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
              + P +    D     P  R F   N R+SNA+++ +GFQL
Sbjct: 240 DFGLPPVIWDNHD----RPGARIF---NARVSNARLREIGFQL 275


>gi|326317982|ref|YP_004235654.1| TrkA-N domain-containing protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374818|gb|ADX47087.1| TrkA-N domain protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 315

 Score = 65.9 bits (159), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 117/269 (43%), Gaps = 22/269 (8%)

Query: 30  TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE--------GDPC 81
           T S   +  L+  GI P L  +      LR      T ++    P  E         DP 
Sbjct: 51  TSSPGRVAALRAAGIVP-LPGNLDDARTLRRLAGLATRVLHLAPPPGERDAGAAWWADPR 109

Query: 82  IISMSKDF-YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWL 140
             ++ +    + MP  + + Y S++ +YG+  G  V E   V P +  A +R +AE+   
Sbjct: 110 TAALVRALRLRSMP--RALVYGSTSGVYGDCAGALVPETRPVAPATPRARRRVDAERSVR 167

Query: 141 AITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKNSLRLVKKNQVF-NRIRVEDVAR-C 195
            + +   ++ +VLR+ GIY P R    P  ++R + +  LV+++ V  N I  +D+AR C
Sbjct: 168 HLGRA-GVRASVLRIPGIYAPDREGGTPEARLR-RGTPALVREDDVHTNHIHADDLARAC 225

Query: 196 VIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYA 253
           V  L       I+++SD       +    AA L  +  P  + +      +SP    F  
Sbjct: 226 VAALWRGRPQRIYHVSDASGLKMGDYFDLAADLYGLPRPRRITRAQAREELSPMLLSFMG 285

Query: 254 DNKRISNAKI-KSLGFQLLYPNYRISLKQ 281
           +++R+   ++ K L  +L YP     L+ 
Sbjct: 286 ESRRLDATRLAKELRVRLRYPTVAEGLRS 314


>gi|58700028|ref|ZP_00374582.1| nucleoside-diphosphate-sugar epimerases [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58533456|gb|EAL57901.1| nucleoside-diphosphate-sugar epimerases [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 113

 Score = 65.9 bits (159), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 7/106 (6%)

Query: 179 KKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           K+   F+RI VED++  +   M +   G I+N +DD P     V++ A  L+ ++PP   
Sbjct: 3   KEGHFFSRIHVEDISNILFSSMQNIKPGEIYNCADDLPTTQSEVVIYATKLLNVSPP--- 59

Query: 238 CFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLKQL 282
             +   +  + + FY  +KR+SN KI K L   L+YPNY++ L+ L
Sbjct: 60  --EPIELPDYAQSFYLGSKRVSNVKIKKDLNVSLIYPNYKVGLESL 103


>gi|119475374|ref|ZP_01615727.1| ActC family protein [marine gamma proteobacterium HTCC2143]
 gi|119451577|gb|EAW32810.1| ActC family protein [marine gamma proteobacterium HTCC2143]
          Length = 283

 Score = 65.5 bits (158), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 86/195 (44%), Gaps = 24/195 (12%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK + ++SSTS+Y     +WVDE+S V P +    +   AE     +     I  +++R 
Sbjct: 101 VKRLLFVSSTSVYHQSGDEWVDENSLVQPENFSGKRLRQAE----LVLANSGINYSIIRF 156

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL--------MTHHLGGI 207
            GIYGP R   I   +             NRI  +D   CV FL            +  +
Sbjct: 157 GGIYGPGRRRLIDQVRAGVGCARTPVSYTNRIHRDD---CVGFLQHLIVLCQQGKEVDSL 213

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           +   D EPA   +V    A  M I P      + AN    TR    ++KR SN ++ + G
Sbjct: 214 YVGVDCEPATMWDVRRWLAEKMNIDPSQ---LEPAN----TR--RGNSKRCSNQRLLATG 264

Query: 268 FQLLYPNYRISLKQL 282
           +QL YPNY++   ++
Sbjct: 265 YQLRYPNYKLGYAEI 279


>gi|227343822|pdb|3GPI|A Chain A, Structure Of Putative Nad-Dependent EpimeraseDEHYDRATASE
           From Methylobacillus Flagellatus
          Length = 286

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 22/179 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +YG    +W+DE +   PI+   + +   E E L       I    LR SGIYG
Sbjct: 106 FVSSTGVYGQEVEEWLDEDT--PPIAKDFSGKRMLEAEALLAAYSSTI----LRFSGIYG 159

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI----FNLSDDEPA 216
           P R   I+  Q    +   +N   NRI  +D A  + +L+      +    + ++D++P 
Sbjct: 160 PGRLRMIRQAQTPE-QWPARNAWTNRIHRDDGAAFIAYLIQQRSHAVPERLYIVTDNQPL 218

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           P  +++   A    I  P       A  +P  +     NK++SNA++ + G+QL+YP+Y
Sbjct: 219 PVHDLLRWLADRQGIAYP-------AGATPPVQ----GNKKLSNARLLASGYQLIYPDY 266


>gi|91776397|ref|YP_546153.1| NAD-dependent epimerase/dehydratase [Methylobacillus flagellatus
           KT]
 gi|91710384|gb|ABE50312.1| NAD-dependent epimerase/dehydratase [Methylobacillus flagellatus
           KT]
          Length = 277

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 22/179 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +YG    +W+DE +   PI+   + +   E E L       I    LR SGIYG
Sbjct: 104 FVSSTGVYGQEVEEWLDEDT--PPIAKDFSGKRMLEAEALLAAYSSTI----LRFSGIYG 157

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI----FNLSDDEPA 216
           P R   I+  Q    +   +N   NRI  +D A  + +L+      +    + ++D++P 
Sbjct: 158 PGRLRMIRQAQTPE-QWPARNAWTNRIHRDDGAAFIAYLIQQRSHAVPERLYIVTDNQPL 216

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
           P  +++   A    I  P       A  +P  +     NK++SNA++ + G+QL+YP+Y
Sbjct: 217 PVHDLLRWLADRQGIAYP-------AGATPPVQ----GNKKLSNARLLASGYQLIYPDY 264


>gi|297538940|ref|YP_003674709.1| NAD-dependent epimerase/dehydratase [Methylotenera sp. 301]
 gi|297258287|gb|ADI30132.1| NAD-dependent epimerase/dehydratase [Methylotenera sp. 301]
          Length = 285

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 91/188 (48%), Gaps = 26/188 (13%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK--EWLAITKKLNIKLAV 152
           ++K + ++SST +YG +    +DE      +  VA   F  E+  E  A+   L+    V
Sbjct: 98  NLKHVIFVSSTRVYGQKTDALLDES-----MPAVAAD-FGGERLLEAEALLNNLSCNTTV 151

Query: 153 LRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM-----THHLGGI 207
           LRLSGIYG  R   I +  K+S     +N   NRI  +D A  ++FL+     +  +G  
Sbjct: 152 LRLSGIYGAGRLRMINL-AKSSQNWPSQNSWTNRIHKDDAAAFIVFLVLKVLASKPIGTC 210

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           + ++D +P+   +V+   A+ M+I   +E         P         KR+SN  + S G
Sbjct: 211 YIVTDSKPSSQYDVLSWIANQMQINSDVE--------IPAVE----GGKRLSNQFMLSTG 258

Query: 268 FQLLYPNY 275
           FQL YP++
Sbjct: 259 FQLQYPDF 266


>gi|259908081|ref|YP_002648437.1| Putative nucleoside-diphosphate-sugar epimerase [Erwinia pyrifoliae
           Ep1/96]
 gi|224963703|emb|CAX55200.1| Putative nucleoside-diphosphate-sugar epimerase [Erwinia pyrifoliae
           Ep1/96]
 gi|283477979|emb|CAY73895.1| dTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae DSM 12163]
          Length = 275

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 81/176 (46%), Gaps = 18/176 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG R G    E + + P+S  A +     + WL      ++   +LRLSG+ G
Sbjct: 109 FTSSTSVYGERPGN-TGESTPLAPVSA-AGRTLQELEHWLHHLPGTSVD--ILRLSGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDV-ARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           PKR+P   +  K    L   +Q  N + ++DV A   + L T   G I+NLS  +     
Sbjct: 165 PKRHPGRFLAGKTD--LANGSQGVNLVHLDDVIAAITLLLQTPEGGHIYNLSAPQHPARN 222

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
               + AS + +TPP     D+ N            K I  +KI + LGF   YP+
Sbjct: 223 QFYPQVASQLGLTPPTFLADDSQN----------QGKLIDGSKICRELGFTYRYPD 268


>gi|116074536|ref|ZP_01471797.1| hypothetical protein RS9916_28419 [Synechococcus sp. RS9916]
 gi|116067758|gb|EAU73511.1| hypothetical protein RS9916_28419 [Synechococcus sp. RS9916]
          Length = 287

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 121/291 (41%), Gaps = 34/291 (11%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL----FADQKINN 56
           M L I G GY G  +A+   ++         ++++  + + + +SP        D     
Sbjct: 1   MDLTIVGCGYVGLALAE---RLQPRRPQLRLTLTSTSSERLEQLSPLADHVQICDATEPT 57

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMS------------KDFYKFMPHVKWIGYLSS 104
            L E L  +   V C+ P  +GD  + +              K     +P ++ I Y  S
Sbjct: 58  QLLEALRQSNSAVFCLGP--KGDRQVDANGYRHTFVDSFRCLKLLLPQLPELRQIVYTGS 115

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
            S+YG+ +G+WVDE +   P          +E+    I  +   ++ +LRL  +YGP R+
Sbjct: 116 CSVYGDAQGEWVDEQTPPEPSRGHGDVLLESERLLSGIGDR---QVCILRLGALYGPGRD 172

Query: 165 PFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIM 223
              ++R    L        F N + V D A  +   +     G+ N+ +DEP   ++++ 
Sbjct: 173 LDRRLRGLAGLERPGSGAAFSNWLHVADAAGALEAALDAEWTGVVNVVNDEPIRLRDLVG 232

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            +     + P      D +          ++ +RI N ++K LG+QL +P+
Sbjct: 233 RSLQRQGLAPVRWLGQDESG---------SEGRRIRNTRLKQLGYQLQHPS 274


>gi|310768009|gb|ADP12959.1| Putative nucleoside-diphosphate-sugar epimerase [Erwinia sp.
           Ejp617]
          Length = 275

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 81/176 (46%), Gaps = 18/176 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG R G    E + + P+S  A +     + WL      ++   +LRLSG+ G
Sbjct: 109 FTSSTSVYGERPGN-TGESTPLAPVSA-AGRTLQELEHWLHHLPGTSVD--ILRLSGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDV-ARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           PKR+P   +  K    L   +Q  N + ++DV A   + L T   G I+NLS  +     
Sbjct: 165 PKRHPGRFLAGKTD--LANGSQGVNLVHLDDVIAAITLLLQTPEGGHIYNLSAPQHPARN 222

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
               + AS + +TPP     D+ N            K I  +KI + LGF   YP+
Sbjct: 223 QFYPQVASQLGLTPPTFLADDSQN----------QGKLIDGSKICRELGFTYRYPD 268


>gi|162450066|ref|YP_001612433.1| hypothetical protein sce1795 [Sorangium cellulosum 'So ce 56']
 gi|161160648|emb|CAN91953.1| hypothetical protein sce1795 [Sorangium cellulosum 'So ce 56']
          Length = 296

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 119/291 (40%), Gaps = 48/291 (16%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS----PFLFADQKINNLL 58
           L++ G G+TG  +A      G     TTRS      L   GI     P L A + ++ L+
Sbjct: 8   LIVLGCGFTGAVVAGLRRASGGRVVATTRSPERAAELAQAGIEVSVLPALTA-EAVDRLV 66

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
            +       ++    P    D  I    +         + I Y+SST++YG+  G+ +DE
Sbjct: 67  TDG----ADVLVAFPPDGATDAAIAPSLR-------RARAIAYVSSTAVYGDARGR-IDE 114

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
            +        A  R  AE  + A          VLR +GIYGP R    ++  +   R+ 
Sbjct: 115 ATPTSADGPRAAARLAAEDVYRARGA------VVLRAAGIYGPGRGLHQRL-LRGDFRMT 167

Query: 179 KKNQ-----VFNRIRVEDVARCVIFLMTHHL----GGIFNLSDDEPAPPQNVIMEAASLM 229
            +       V +RI VED+AR  +  +        G  F ++DD P P   V+    + +
Sbjct: 168 GEGDRQGRNVVSRIHVEDLARLALAALERADRAAPGEAFLVADDAPVPQIEVVRWLCARL 227

Query: 230 KIT----PPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
            +      P E   +T             ++ + NAKIK +LG  LLYP+Y
Sbjct: 228 GLALPAGAPREDLHETLR----------HDRAVDNAKIKRALGMALLYPSY 268


>gi|209517430|ref|ZP_03266271.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. H160]
 gi|209502084|gb|EEA02099.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. H160]
          Length = 359

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 91/182 (50%), Gaps = 8/182 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y S+T +YG+  G W+DE     P +  A +R +AE++  A T + ++  ++ R+ GI
Sbjct: 167 IVYASTTGVYGDCGGAWIDETRAARPANARAKRRVSAERQLRAATARGSVAASIARIPGI 226

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPA 216
           Y   R P  ++ +K +  LV+ + V+ N I  +D+A  ++ L TH       + SDD   
Sbjct: 227 YARNRLPLARL-EKGTPALVEADDVYTNHIHADDLAAILVRLATHGRPARALHASDDSSL 285

Query: 217 PPQ---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLY 272
                 + + +A  L +  P + +      I P    F  +++R+ N ++K  L  +L Y
Sbjct: 286 KMGEYFDAVADAFGLGR-APRITRAQAEQQIDPMLLSFMRESRRLVNRRLKEELRMRLRY 344

Query: 273 PN 274
           P+
Sbjct: 345 PS 346


>gi|300712191|ref|YP_003738005.1| NAD-dependent epimerase/dehydratase [Halalkalicoccus jeotgali B3]
 gi|299125874|gb|ADJ16213.1| NAD-dependent epimerase/dehydratase [Halalkalicoccus jeotgali B3]
          Length = 292

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 82/189 (43%), Gaps = 19/189 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SST +YG+  G WVDE +           R   E E +A+     I+  V+R +G+YG
Sbjct: 107 YTSSTGVYGDHGGDWVDEATPT--EPTTEKTRVLREAEEIALGSP--IEGTVVRFAGLYG 162

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPP 218
           P+R      R +  L         N +  +D A  + +L+   L  G +    DDEP   
Sbjct: 163 PER-----YRLERYLEGPVTEGYLNMLHRDDAAGVIRYLLEEDLARGEVVLAVDDEPVGK 217

Query: 219 ---QNVIMEAASLMKITPPLE---QCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
               + + E   L    PP E   +     N+S   R     +KR SNAK+  LG++  Y
Sbjct: 218 WGFADWLAEQCGLP--APPKETKTERLSEPNLSEPARRRIETSKRCSNAKLGELGYEFSY 275

Query: 273 PNYRISLKQ 281
           P +R   ++
Sbjct: 276 PTFREGYRE 284


>gi|110667156|ref|YP_656967.1| sugar epimerase/dehydratase-like protein [Haloquadratum walsbyi DSM
           16790]
 gi|109624903|emb|CAJ51313.1| sugar epimerase/dehydratase homolog [Haloquadratum walsbyi DSM
           16790]
          Length = 302

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 113/298 (37%), Gaps = 40/298 (13%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           H +I G GY G  +       G    G  RS S L +++  G     F  Q+ +    E 
Sbjct: 3   HAVIIGCGYVGIELGTQLQAAGHTVTGVRRSKSGLNSIEAAG-----FHAQQADVTHPET 57

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDF----------YKFMPHVKWIGYLSSTSIYGNR 111
           L         I  +S G     S  + +          Y        + Y SST +YG+ 
Sbjct: 58  LSTLPDAEWVIFAASSGGRGAESARRIYVDGLRNTIAAYAERESTDRLIYTSSTGVYGDH 117

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
            G++VDE + + P +        AE   L  T  + I   V R +G+YGP R    +   
Sbjct: 118 NGRFVDESTSLDPTTEKTQVLKTAESITLEETGDVGIDGTVARFAGLYGPNRYRLTRYLS 177

Query: 172 ----KNSLRLVKKNQ---VFNRIRVEDVAR--CVIFLMTHHLGGIFNLSDDEPAPPQN-V 221
               +  L ++ ++    V N +   DVAR  CV+ +            DDEPA      
Sbjct: 178 GPVTEGYLNMIHRDDAAGVINHVLTADVAREECVLAV------------DDEPADKWTFA 225

Query: 222 IMEAASLMKITPP---LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
              A +  +  PP   + +    +N+S   +     +KR SN  +  L +   YP YR
Sbjct: 226 DWIATACGRPDPPKQTVSERLAKSNLSETAQRRVRTSKRCSNDYLHELDYTFSYPTYR 283


>gi|302879887|ref|YP_003848451.1| NAD-dependent epimerase/dehydratase [Gallionella capsiferriformans
           ES-2]
 gi|302582676|gb|ADL56687.1| NAD-dependent epimerase/dehydratase [Gallionella capsiferriformans
           ES-2]
          Length = 285

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 4/177 (2%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++ +YG+  G  +DE   V+P S     R +AE++  A  K   +   +LR+ GIY 
Sbjct: 101 YISTSGVYGDCHGAQIDETRAVNPASMRGKLRVDAERQIRAWAKANRVNANILRVPGIYA 160

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQ 219
             R P  +++         ++   N I  ED+AR  V  L+      I++ +DD+     
Sbjct: 161 ADRLPLDRLKAGAPAIANDEDSYSNHIHAEDLARIAVAALLRGKPCRIYHATDDDEMKMG 220

Query: 220 NVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
           +     A    +   P L +      +SP    F  +++R+SN ++K  L   L YP
Sbjct: 221 DYFDAVADGTHLPRAPRLSRAEVKIAVSPMMWSFMNESRRLSNTRMKRELKVVLRYP 277


>gi|83648948|ref|YP_437383.1| nucleoside-diphosphate-sugar epimerase [Hahella chejuensis KCTC
           2396]
 gi|83636991|gb|ABC32958.1| Nucleoside-diphosphate-sugar epimerase [Hahella chejuensis KCTC
           2396]
          Length = 293

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 78/189 (41%), Gaps = 21/189 (11%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           ++ + ++SSTS+YG    +WVDE S   P          AE    ++    +I   V+R 
Sbjct: 97  IRRLLFVSSTSVYGQENDEWVDEDSVTEPSGFSGATLLKAE----SLLADSDIATTVVRF 152

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL----MTHHLGGIFNLS 211
           SGIYG  R   ++      + L   +   NRI  +D    +  L        L   +  S
Sbjct: 153 SGIYGAGRTRLLQQALDGQVALSGPSGYTNRIHEQDAVGVLCHLTELAADKPLQSCYLAS 212

Query: 212 DDEPAPPQNVIM----EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           D EP     V      +A S ++  P           +P  +   A +KR +N ++++ G
Sbjct: 213 DCEPVRMHEVAQWIREQACSRVECAP---------EAAPAQQKRRAGSKRCANQRLRASG 263

Query: 268 FQLLYPNYR 276
           F   YP +R
Sbjct: 264 FHFRYPTFR 272


>gi|289672860|ref|ZP_06493750.1| hypothetical protein PsyrpsF_06424 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 223

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 88/200 (44%), Gaps = 18/200 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G  +A+  L  G    G  R+VS L    H G++  LF   K        L
Sbjct: 6   LLIAGCGDIGSRLANRLLPHGWTVHGLRRTVSELPAGVH-GVAGDLFNKPKPAQWPDAAL 64

Query: 63  YFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHV----KWIGYLSSTSIYGNREGQ 114
            +   +V C  PS   +       +   ++   ++       K + ++SS+ +YG + G+
Sbjct: 65  DY---VVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPKRLIFVSSSGVYGQQNGE 121

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI-KIRQKN 173
           WVDE S   P +   T    AE+    +          +RL+GIYGP R+    ++RQ +
Sbjct: 122 WVDETSATEPGNYTGTVMLEAEQ----VALNSGFPATGVRLTGIYGPGRSDLSNRVRQGH 177

Query: 174 SLRLVKKNQVFNRIRVEDVA 193
           S+R +      NRI  +D A
Sbjct: 178 SVR-IDPPVYANRIHADDAA 196


>gi|78214152|ref|YP_382931.1| hypothetical protein Syncc9605_2651 [Synechococcus sp. CC9605]
 gi|78198611|gb|ABB36376.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 287

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 116/294 (39%), Gaps = 42/294 (14%)

Query: 1   MHLMIFGAGYTGKFIAD------AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M L I G GY G  +A+        LK+ + T  + R +  L  L  +        D   
Sbjct: 1   MDLTIVGCGYVGLALAERLQPKRPQLKLTLTTTSSER-LEQLSPLADR----VELCDATD 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGD--------------PCIISMSKDFYKFMPHVKWIG 100
              L   L  +T+ V C+ P  +                 C+ S+       +P ++ I 
Sbjct: 56  PAQLLNALQQSTNAVFCLGPKGDRQVDANGYRHTFVDSFRCLTSL----LPQLPKLRQIV 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y  S S+YG+ EG WVDE +   P           E+    I+ +   ++ +LRL  +YG
Sbjct: 112 YTGSCSVYGDAEGDWVDEQTSPAPGRGHGNVLLEGEELLSGISDR---RVCILRLGALYG 168

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           P R+   ++R    L        + N + V D A  +   +     G+ N+ +DEP   +
Sbjct: 169 PGRDLDRRLRGLAGLERPGSGATYSNWLHVADAAGALEAALDAEWAGLVNVVNDEPIRLR 228

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           +++  +     + P            P +       +RI N ++K LG+QL +P
Sbjct: 229 DLVGRSLQRQGLAP----VHWLGQNGPGS-----GGRRIRNTRLKQLGYQLQHP 273


>gi|91789634|ref|YP_550586.1| NAD-dependent epimerase/dehydratase [Polaromonas sp. JS666]
 gi|91698859|gb|ABE45688.1| NAD-dependent epimerase/dehydratase [Polaromonas sp. JS666]
          Length = 307

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 118/291 (40%), Gaps = 15/291 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++I G G  G  ++   L+  V     T S   L  L+  G++P L  +   +  LR  
Sbjct: 19  RVLIVGCGDVGLRVS-RQLRGRVGLMALTSSTDRLPELRAHGVTPLL-GNLDDSASLRRL 76

Query: 62  LYFTTHIVQCIKPSSE-----GDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
               T +V    P  +      DP  +++ +           + Y S++ +YG+ +G WV
Sbjct: 77  AGLATRVVHLAPPPGDNPDWRSDPRTLALLRILRLRGRPQSLV-YGSTSGVYGDCQGDWV 135

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKN 173
            E   V+P +  A +R +AE       +       +LR+ GIY P R    P  ++ +  
Sbjct: 136 SETRGVNPNTPRAVRRVHAEALVRLFGRATAAHTHILRIPGIYAPDREGGTPRGRLLKGT 195

Query: 174 SLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
            +   + +   N I  +D+AR CV  L       + N SDD      +    AA L ++ 
Sbjct: 196 PVLRAQDDVYTNHIHADDLARACVAALWRGKPQRVTNASDDTQMKMGDYFDLAADLYQLP 255

Query: 233 PPLEQCFDTANIS-PFTRF-FYADNKRISNAKIK-SLGFQLLYPNYRISLK 280
            P      TA    P     F  +++R+ N ++K  L   L YP     L+
Sbjct: 256 RPARLPRSTAREQLPLMLLSFMGESRRLDNRRMKEELKLVLRYPTVEEGLR 306


>gi|319792082|ref|YP_004153722.1| trka-n domain protein [Variovorax paradoxus EPS]
 gi|315594545|gb|ADU35611.1| TrkA-N domain protein [Variovorax paradoxus EPS]
          Length = 310

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 128/295 (43%), Gaps = 20/295 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            L++ G G  G+ +A   L+  +     T S   +  L+  GI P L  +      LR  
Sbjct: 19  RLLVVGCGDVGQRVARE-LRGRMQLVALTSSAERVAALREAGIRP-LVGNLDEPATLRRL 76

Query: 62  LYFTTHIVQCIKPSSEG------DPCIISMSKDF-YKFMPHVKWIGYLSSTSIYGNREGQ 114
               T ++    P+ +G      D    ++++    + +P    + Y S++ +YG+  G 
Sbjct: 77  AGIATRVLHLAPPARDGGAAWWRDQRTTALARALRLRSVPLA--LVYGSTSGVYGDCGGA 134

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN---PFIKIRQ 171
            V E   V P +  + +R +AE+    + +   ++ ++LR+ GIY P R    P  ++ Q
Sbjct: 135 RVSETRAVRPDTPRSHRRVDAERAVRWLGRSAGVRASILRIPGIYAPDRENGTPRGRL-Q 193

Query: 172 KNSLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLM 229
           + +  L +++ V+ + I   D+AR C+  L       I + SDD      +    AA L 
Sbjct: 194 RGTPVLRQEDDVYTSHIHANDLARACIASLFRGRPQRIVHASDDTELRMGDYFDLAADLY 253

Query: 230 KITPPLEQCFDTANIS-PFTRF-FYADNKRISNAKIK-SLGFQLLYPNYRISLKQ 281
            +  P     + A    P     F  +++R+ N ++K  L  +L +P     L++
Sbjct: 254 GMPRPPRVAREEAERQLPLQLLSFMGESRRLDNTRLKRELRVRLAHPTVHTGLRE 308


>gi|87300584|ref|ZP_01083426.1| hypothetical protein WH5701_04030 [Synechococcus sp. WH 5701]
 gi|87284455|gb|EAQ76407.1| hypothetical protein WH5701_04030 [Synechococcus sp. WH 5701]
          Length = 295

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 111/284 (39%), Gaps = 19/284 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + I G GY G  +A    +   +    T +    L             D    + L +
Sbjct: 1   MRITIVGCGYVGSALASHWHQQARHWLRVTTTREERLGELAPLADAVQLLDAADPDQLHK 60

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM----------PHVKWIGYLSSTSIYGN 110
            L  T   V C+ P              + + M          P ++ + Y SS S+YG 
Sbjct: 61  ALENTEAAVFCLAPGGSRQVDADGYEATYLRTMEAVAAVVPQLPELQQLVYTSSCSVYGE 120

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
            +G  V+E +   P    A    +AE   LA  +  + ++A+ RL  IYGP R    + R
Sbjct: 121 AKG-LVEEDTPPQPREPHAQILRDAEALLLAC-RGSHRRVAIARLGAIYGPGRELEPRFR 178

Query: 171 Q-KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLM 229
               S R    + + + I  +DV   + + +     G+ NL DDEP   + +I  +    
Sbjct: 179 SLAGSRREGDGSSLISWIHRDDVVTALAWAVEQGFDGLINLVDDEPISVRELIDRSCHAA 238

Query: 230 KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
            + P +    +  + +P      A  +RISN +++ LG  L +P
Sbjct: 239 GLEPVIWDGDNGTSANP------AAERRISNRRLRELGLGLQHP 276


>gi|78213029|ref|YP_381808.1| hypothetical protein Syncc9605_1503 [Synechococcus sp. CC9605]
 gi|78197488|gb|ABB35253.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 286

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 113/283 (39%), Gaps = 33/283 (11%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA--DQKINNLLREKL 62
           I G GY G  +A      G    GTT S   L  L      P L++  D   +    ++L
Sbjct: 7   IVGCGYVGSAVAAHLRHQGHEVVGTTTSPGRLAELCDLVDHPRLYSAEDPVADTSFLDRL 66

Query: 63  YFTTHIVQCIKPSSEGD----------PCIISMSKDFYKFMP-HVKWIGYLSSTSIYGNR 111
                 +     + E D          P ++   +      P HV    YLSS  +YG++
Sbjct: 67  DGVLIAMAPTTATFEEDQYEKVYGQAVPALVDAIRQRQGCKPLHVA---YLSSAGVYGDQ 123

Query: 112 EGQWVDEHSFVHPISCVATQR---FNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN--PF 166
            G   +E   + P  C         +AE   LA+    + +  VLRL GIYGP ++   +
Sbjct: 124 SGAICNE---LTPPDCSNGANALLVSAESCVLALNDA-STQACVLRLGGIYGPGKDIPSY 179

Query: 167 IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           I+     S+R    N +   + + D+ R V F     L GI+NL DD     + +     
Sbjct: 180 IRSAAGQSVRK-NGNHINAWVHLHDIIRGVDFAFGRRLQGIYNLVDDLQFTRRQLSNALC 238

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQ 269
               + P +    D     P  R F   N RISNA+++ +GFQ
Sbjct: 239 DDFGLPPVIWDNHD----RPGARVF---NARISNARLREIGFQ 274


>gi|92115358|ref|YP_575286.1| NAD-dependent epimerase/dehydratase [Chromohalobacter salexigens
           DSM 3043]
 gi|91798448|gb|ABE60587.1| NAD-dependent epimerase/dehydratase [Chromohalobacter salexigens
           DSM 3043]
          Length = 292

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 84/190 (44%), Gaps = 18/190 (9%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SSTS+Y  + G+ VDE S   P          AE+  L       +   V+R SGIYG
Sbjct: 106 FVSSTSVYAQQAGEVVDETSETVPSGFSGVLMREAEQALL----DHPLPGTVVRFSGIYG 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEP 215
           P R+  I+  ++  +         NRI  +D A  +  L+     G     ++  SD EP
Sbjct: 162 PGRDRLIRQVKEGRVAAANPPMYSNRIHRDDCAGVLTHLIALAQDGQPLETLYLASDCEP 221

Query: 216 APPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNY 275
            P   V+   A  +K+     +  +T   SP  R     +KR  N +++  G++  YP +
Sbjct: 222 TPLHEVMTWMAGKLKV-----ELTETIQ-SPLRRRA---SKRCDNTRLRDSGYRFQYPTF 272

Query: 276 RISLKQLWKE 285
           R   + + K+
Sbjct: 273 REGYEDVLKQ 282


>gi|188533499|ref|YP_001907296.1| Putative nucleoside-diphosphate-sugar epimerase [Erwinia
           tasmaniensis Et1/99]
 gi|188028541|emb|CAO96403.1| Putative nucleoside-diphosphate-sugar epimerase [Erwinia
           tasmaniensis Et1/99]
          Length = 275

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 120/281 (42%), Gaps = 25/281 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + I G G+ G  +A +    G +  G+  +   +   K  GI  +L       N   E L
Sbjct: 4   VAIVGLGWLGMPLAMSLTAAGYWVTGSKTTQDGVDAAKLSGIDGYLLELTPELNCEAEDL 63

Query: 63  YFTTHIVQCI--KPSSE---GDPCIISMSKDFYK--FMPHVKWIGYLSSTSIYGNREGQW 115
               ++   +   P+S    G+   +S  +         +V  + + SSTS+YG+R G+ 
Sbjct: 64  EALLNVDALVITLPASRTATGEGKYLSAVQQLVDSALAYNVPRMIFTSSTSVYGDRSGKT 123

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
             E + + P+S VA +     + WL      ++   +LRLSG+ GPKR+P   +  K   
Sbjct: 124 C-ESTPLEPVS-VAGRTLQELESWLHNLPGTSVD--ILRLSGLVGPKRHPGRFLAGKTG- 178

Query: 176 RLVKKNQVFNRIRVEDV-ARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP 234
            L    Q  N + ++DV A   + L T   G I+NLS  +         + A+ + +TPP
Sbjct: 179 -LANGCQGVNLVHLDDVIAAITLLLQTPEGGHIYNLSAPQHPARNQFYPQVANQLGLTPP 237

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
                ++ N            K I  +KI + LGF   YP+
Sbjct: 238 TFLADESQN----------QGKLIDGSKICRELGFAYRYPD 268


>gi|257389089|ref|YP_003178862.1| NAD-dependent epimerase/dehydratase [Halomicrobium mukohataei DSM
           12286]
 gi|257171396|gb|ACV49155.1| NAD-dependent epimerase/dehydratase [Halomicrobium mukohataei DSM
           12286]
          Length = 297

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 17/190 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN--IKLAVLRLSGI 158
           Y SST +YG+ +G WVDE + + P +     R  AE E +A  + L+  I   V R +G+
Sbjct: 107 YTSSTGVYGDHDGDWVDETTPLDPQT--DKTRVLAEAERIARERALDRGIDGTVARFAGL 164

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG--GIFNLSDDEPA 216
           YGP R      R +  L         N +   D A  V FL+   +       + DDEP 
Sbjct: 165 YGPDR-----YRLERYLDGPVTEGYLNMVHRADAAGAVAFLLREGVARDETVLVVDDEPV 219

Query: 217 PPQNVIMEAASLMKITPP-----LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
                    A    +  P      E+  D  ++S   R     +KR SN ++ SLG++  
Sbjct: 220 SKWAFADWLADECGVAEPPKRTTAERLADD-DLSETARRRIQTSKRCSNDRLHSLGYEFA 278

Query: 272 YPNYRISLKQ 281
           +P +R   + 
Sbjct: 279 HPTFRSGYRD 288


>gi|313127191|ref|YP_004037461.1| nucleoside-diphosphate-sugar epimerase [Halogeometricum borinquense
           DSM 11551]
 gi|312293556|gb|ADQ68016.1| nucleoside-diphosphate-sugar epimerase [Halogeometricum borinquense
           DSM 11551]
          Length = 308

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 115/312 (36%), Gaps = 57/312 (18%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
            H ++ G GY G  +     + G    G  RS   L  ++  G SP      + +    +
Sbjct: 2   AHALVLGCGYVGLELGRQLAESGHDVTGVRRSDDGLAAVESAGFSP-----ARADVTDPD 56

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--KWIG---------YLSSTSIYG 109
            L         +  +S G     +  + + + + +V  ++ G         Y SST +YG
Sbjct: 57  SLAPLPDADWLVFAASSGGRGAEAARRVYVEGLQNVIDEYGGRASQPDRLVYTSSTGVYG 116

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAI--TKKLNIKLAVLRLSGIYGPKRNPFI 167
           +  G WVDE + + P +     R  AE E +A+       I   V R +G+YGP R    
Sbjct: 117 DHGGGWVDEETSLDPTT--DKTRVLAEAERVAVEDASAAGIDGTVARFAGLYGPDR---- 170

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGI-------------FNLSD-- 212
             R    L         N +  +D A  V FL+                    ++ +D  
Sbjct: 171 -YRLDRYLTGPVTEGYLNMVHRDDAAGAVRFLLEADAARDDVVLVVDDEPVDKWSFADWL 229

Query: 213 -DEPA---PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            DE     PP+                E+  D  ++S   R     +KR SN +++ LG+
Sbjct: 230 ADECGVSHPPKRTK-------------EERLDDPDLSEAARRRILTSKRCSNDRLRELGY 276

Query: 269 QLLYPNYRISLK 280
           +  YP YR   +
Sbjct: 277 EFAYPTYRTGYR 288


>gi|152989210|ref|YP_001351435.1| hypothetical protein PSPA7_6119 [Pseudomonas aeruginosa PA7]
 gi|150964368|gb|ABR86393.1| hypothetical protein PSPA7_6119 [Pseudomonas aeruginosa PA7]
          Length = 283

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           +MI G G  G  + +A L  G    G  RSV  L     +G+ P    L A +       
Sbjct: 5   VMIAGCGDVGGRLGEALLADGWRVHGLRRSVDAL----PQGVLPVAGDLQAPECPAQWPG 60

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-KWIG----------YLSSTSIY 108
           E L +  +     +    G          +   + HV  W+           ++SST +Y
Sbjct: 61  EPLDYLVYSAAASQHDEAG------YRAAYVDGLRHVLGWLQAHGQRPRRLLFVSSTGVY 114

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI- 167
              +G W+DE S    +S   + R   + E +A+     I  + +RL+GIYGP R   + 
Sbjct: 115 AQADGSWIDEDSPA--LSQAYSGRIMLDAERVALDS--GIPASRVRLAGIYGPGREWLLN 170

Query: 168 KIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNV 221
           ++RQ    R+V +  ++ NRI  +D A  + FL+     G      +   DD P      
Sbjct: 171 QVRQ--GYRVVSEPPLYANRIHADDAAGLLAFLLRADARGEALEDCYIGVDDAP------ 222

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                ++ ++   L Q    +  +       A +KR SN + ++LG+   YP+YR
Sbjct: 223 ----VAMHEVVDYLRQRLGVSQWADEHSVRRAGSKRCSNRRARALGWVPRYPSYR 273


>gi|88810459|ref|ZP_01125716.1| NAD-dependent epimerase/dehydratase [Nitrococcus mobilis Nb-231]
 gi|88792089|gb|EAR23199.1| NAD-dependent epimerase/dehydratase [Nitrococcus mobilis Nb-231]
          Length = 291

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 83/190 (43%), Gaps = 26/190 (13%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST++Y  + G+WVDE S   P      +   AE+    + ++      V+R  GIYG
Sbjct: 110 FVSSTAVYAQQSGEWVDEASPTEPTGFSGQRLLEAER----LLQRGRFPGLVVRFGGIYG 165

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG------GIFNLSDDE 214
             RN  ++  Q       + +   NRI  +D   CV  L   HLG       I+   DD 
Sbjct: 166 RGRNAMLRKVQAGEPCHAEPSLYTNRIHEDD---CVGVLC--HLGRLASPKDIYIAVDDA 220

Query: 215 PAPPQNVIME--AASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
           P   Q  +M+  A  L +  P        A  +       A +KR  NA++K+ G+ L +
Sbjct: 221 PC-TQCELMDWLAEQLDRPKP--------ARTTAAKDTPRAGSKRCCNARLKASGYALRF 271

Query: 273 PNYRISLKQL 282
           P YR   + +
Sbjct: 272 PTYREGYRAM 281


>gi|254432106|ref|ZP_05045809.1| NAD-dependent epimerase/dehydratase [Cyanobium sp. PCC 7001]
 gi|197626559|gb|EDY39118.1| NAD-dependent epimerase/dehydratase [Cyanobium sp. PCC 7001]
          Length = 293

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 82/195 (42%), Gaps = 10/195 (5%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P ++ I Y SS  +YG+  G W+DE +   P    A     AE+   A   +L +  AV
Sbjct: 101 LPQLRQIVYTSSCGVYGDAAGGWIDEATPPEPRDAHAAVLLQAEQLLQAAAGQLAV--AV 158

Query: 153 LRLSGIYGPKRNPFIKI-RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
           LRL  ++GP R    ++ R   S R        N I  +D    +  ++     G+ N+ 
Sbjct: 159 LRLGALHGPGRELGPRLARLAGSQRSGDGGTWSNWIHRDDAVAAIDRVVDRGFSGVLNVV 218

Query: 212 DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYAD----NKRISNAKIKSLG 267
           D +P   + ++    +   + P   +  D A+    +    A     N+RI N ++  LG
Sbjct: 219 DGQPVTLRQLVDGVCAARGLEPVTWEADDPASAGSTSSSPAAGTGLPNRRIRNQRLLDLG 278

Query: 268 FQLLYPNYRISLKQL 282
                P     L+QL
Sbjct: 279 VTPASPGV---LEQL 290


>gi|320101932|ref|YP_004177523.1| TrkA-N domain-containing protein [Isosphaera pallida ATCC 43644]
 gi|319749214|gb|ADV60974.1| TrkA-N domain protein [Isosphaera pallida ATCC 43644]
          Length = 322

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 119/272 (43%), Gaps = 21/272 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           ++I G GY G+ IA   ++ G    GTTRS +    L+  GI P +      ++     L
Sbjct: 30  VLIVGCGYLGRRIARQLIRQGRDVFGTTRSPAKAEQLRSLGIHPVVV--DLTDSTTEVVL 87

Query: 63  YFTTHIVQCIK-PSSEGDP----CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
                 + C+    S G P     + ++     +       +   S+T + G   G+WVD
Sbjct: 88  PRVAGAIYCVGYDRSSGMPQRAVVVDALIATLPRLHARADKLAVASTTGVLGGTHGEWVD 147

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR- 176
           E +   P++        AE+  L   ++    ++++RL+G+YGP R     IR+ + L  
Sbjct: 148 ETTTAPPLTESGRLHAEAEQAILEFGQRHVWPVSIVRLAGLYGPGR----LIRRADLLAG 203

Query: 177 ---LVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
                  ++  N I ++D A  +I  + H   G I+  +DD P P ++  + +A L+   
Sbjct: 204 RPLSGDPDKWLNLIHIDDAAAALIASLDHAPPGAIYLAADDRPLPRRDYYLTSARLLGAP 263

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIK 264
              E  F++   +P        N+R+ N ++K
Sbjct: 264 ---EPQFESNPANPDR--PAEPNRRVRNRRLK 290


>gi|254515853|ref|ZP_05127913.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium NOR5-3]
 gi|219675575|gb|EED31941.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium NOR5-3]
          Length = 295

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 15/179 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +Y    G W+DE S              AE+ +L   + ++  + VLR  G+YG
Sbjct: 106 FVSSTRVYSEARGVWIDESSPTADDDPHVMAILRAEQRFL---EAVDTGI-VLRAGGLYG 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL---GGIFNLSDDEPAP 217
               P +K      L   +  +  NRI  +DVA  +   +   L     + NL DD PA 
Sbjct: 162 QGPGPLLKRVAAGKLSPTEPLRYGNRIHRDDVAGFMAAALAGTLTLDARVINLVDDAPAA 221

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            Q   MEA    ++  P    ++    +P +      +KRI NA++ + G+ L YP+YR
Sbjct: 222 LQE--MEAWLCAQLGVP----YEPPGPTPASETVA--HKRIGNARLHASGYVLQYPDYR 272


>gi|309811659|ref|ZP_07705438.1| NAD dependent epimerase/dehydratase family protein [Dermacoccus sp.
           Ellin185]
 gi|308434460|gb|EFP58313.1| NAD dependent epimerase/dehydratase family protein [Dermacoccus sp.
           Ellin185]
          Length = 292

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 87/179 (48%), Gaps = 20/179 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITK-KLNIKLAVLRLSGIY 159
           ++SST++  +  G  VDE++   P     T R  AE E L +     + +  V+R SGIY
Sbjct: 116 FVSSTAVCAS--GGLVDENT--PPAPQTPTARVLAEAEQLFLAAFPASTRGIVVRPSGIY 171

Query: 160 GPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL--MTHHLGGIFNLSDDEPAP 217
           GP R  F+    +  +     ++  +R+  +D+AR V  L  MT     ++ ++DD PA 
Sbjct: 172 GPGREWFVNRVSEGDVG--DPSRTTHRVHRDDLARAVTHLLTMTAEPDALYLVTDDAPA- 228

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
                    S  ++   L +  D AN  P  R  ++ ++R+ N++++  GF   +P YR
Sbjct: 229 ---------SAGEVATYLAERLD-ANADPSWRGEWSASRRLDNSRLRRTGFAFDFPTYR 277


>gi|329897891|ref|ZP_08272241.1| Nucleoside diphosphate sugar epimerase [gamma proteobacterium
           IMCC3088]
 gi|328921017|gb|EGG28436.1| Nucleoside diphosphate sugar epimerase [gamma proteobacterium
           IMCC3088]
          Length = 282

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 20/182 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+SST +Y    G+WV E S + P    A     AE   +    +    L ++R +GIY 
Sbjct: 111 YVSSTRVYAESGGEWVTEESPLAPQGYAALSLVAAEHTMM----QAGFPLTIVRFAGIY- 165

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMT-----HHLGGIFNLSDDE 214
             R  F   R +  L    K +V+ NRI  +D +  +  L++       L  ++N SD  
Sbjct: 166 DGRAQFYLNRMRQGLWSAPKPEVYTNRIHRDDCSGFLAHLISLSQAGEPLASMYNGSDGA 225

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PA    +    A+   + PP +   D           + ++KRI N+++ + G+QL + +
Sbjct: 226 PATRYEIERYLAARAGLYPPEKVSVDGE---------FQEHKRIDNSRLIASGYQLKFAS 276

Query: 275 YR 276
           YR
Sbjct: 277 YR 278


>gi|253996957|ref|YP_003049021.1| NAD-dependent epimerase/dehydratase [Methylotenera mobilis JLW8]
 gi|253983636|gb|ACT48494.1| NAD-dependent epimerase/dehydratase [Methylotenera mobilis JLW8]
          Length = 284

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 86/199 (43%), Gaps = 23/199 (11%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
            +K + ++SST +YG    + +DE +   P+     +   AE    ++   +     VLR
Sbjct: 103 QLKHVFFVSSTRVYGQVTDELLDELTAAAPVDFGGERLLEAE----SLLNSMTCGNTVLR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFN 209
           LSGIYGP R   I +  K   R    N   NRI+ +D A  ++ L+   + G      + 
Sbjct: 159 LSGIYGPGRLRMINL-AKAPERWPIDNSWTNRIQRDDAANFIVHLIQQVIAGRQIRPCYI 217

Query: 210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQ 269
           ++D +P     V+   A  + + P                   +  KR+SN  + + GF 
Sbjct: 218 VTDCKPVSQYEVLNWIAVQLGLKPAAPPAV-------------SGGKRLSNQAMLATGFV 264

Query: 270 LLYPNYRISLKQLWKEIEN 288
           L YP+Y+   + L  E+ N
Sbjct: 265 LQYPDYQAGYQALLAELVN 283


>gi|302036523|ref|YP_003796845.1| putative NAD-dependent epimerase/dehydratase [Candidatus Nitrospira
           defluvii]
 gi|300604587|emb|CBK40919.1| putative NAD-dependent epimerase/dehydratase [Candidatus Nitrospira
           defluvii]
          Length = 272

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 88/190 (46%), Gaps = 34/190 (17%)

Query: 102 LSSTSIYGNREG-------QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           L STS Y +REG        W+DE    HP++     R   E E+L    + + +  +LR
Sbjct: 98  LGSTSAY-DREGGPLDDLPPWIDE---AHPVN-TGLPRVQGE-EYL----RTHHEAIILR 147

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDD 213
           ++GIYGP RNP   IRQ    R+   N+  N I VED+A  C++ L     G  +N+SD 
Sbjct: 148 VAGIYGPNRNPVEWIRQG---RVGPTNKFVNLIHVEDLAHLCLLALQRGQAGDTYNVSDG 204

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
            P    ++  E +    +            +S          KRI N KI + +G+ L +
Sbjct: 205 HPRRWADICAEVSGRWGV------------VSARQADRSESGKRIRNHKILTHVGYTLQH 252

Query: 273 PNYRISLKQL 282
           P +  +L+ +
Sbjct: 253 PEFYDALQSI 262


>gi|91784950|ref|YP_560156.1| hypothetical protein Bxe_A0830 [Burkholderia xenovorans LB400]
 gi|91688904|gb|ABE32104.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 341

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 90/189 (47%), Gaps = 6/189 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE     P +  A +R +AE++    T + ++  ++ R+ GIY 
Sbjct: 153 YASTTGVYGDCGGAWIDETRVTQPANARARRRASAERQLRRATARGSVAASIARIPGIYA 212

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  L   + V+ N I  +D+A  ++ L TH   G + + SDD     
Sbjct: 213 GNRLPLARL-EKGTPALTDADDVYTNHIHADDLAAILVRLATHGRPGRVVHASDDSALKM 271

Query: 219 QNVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
                E A    +   P + +      I P    F  +++R+ N ++K  L  +L YP+ 
Sbjct: 272 GEYFDEVADAFGLPRAPRITRVEAERQIEPTLLSFMRESRRLLNRRLKQELSVRLRYPSV 331

Query: 276 RISLKQLWK 284
              L++  K
Sbjct: 332 EDFLRESVK 340


>gi|88808947|ref|ZP_01124456.1| hypothetical protein WH7805_04626 [Synechococcus sp. WH 7805]
 gi|88786889|gb|EAR18047.1| hypothetical protein WH7805_04626 [Synechococcus sp. WH 7805]
          Length = 280

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 88/182 (48%), Gaps = 10/182 (5%)

Query: 93  MPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAV 152
           +P ++ I Y SS S+YG+    WV+E++   P +        +E+  + +  + N K+ V
Sbjct: 104 LPALQHIVYTSSCSVYGHASDAWVNENTPARPRTARGEVLLESERLVMQLMGE-NRKVCV 162

Query: 153 LRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLS 211
           LRL+ +YGP R    ++R     +L      F N + V+D A   +  +     G+ N+ 
Sbjct: 163 LRLAALYGPGREIKDRLRGLAGKQLPGDGGSFSNWVHVDDAAGAALAAINGCWTGLVNVV 222

Query: 212 DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
           +DEP   ++++        I   LE+   T    P   F    ++ ISN ++K LG++L 
Sbjct: 223 NDEPLRDRDLVDRTL----IQEGLERVQWTGAPGPAPPF----SRCISNHRLKELGYRLQ 274

Query: 272 YP 273
           +P
Sbjct: 275 HP 276


>gi|323446166|gb|EGB02438.1| hypothetical protein AURANDRAFT_68881 [Aureococcus anophagefferens]
          Length = 507

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 98/220 (44%), Gaps = 21/220 (9%)

Query: 66  THIVQCIKPSSEGD--PCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVH 123
           TH+V  + P ++GD  P +          +P   W  YLS+T +YG+  G W+DE + + 
Sbjct: 97  THVVSTMPPIADGDADPLLA------LHGLPDGCWAAYLSTTGVYGDHGGAWIDEAAELR 150

Query: 124 PISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQV 183
                   R  AE  ++A          VLRL GIYGP R+  +   +    R     + 
Sbjct: 151 GAGAREAARVRAEAAYVARGG------VVLRLGGIYGPGRS-LLDASRAAPTRRGAPGKP 203

Query: 184 FNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA 242
            NR+ V+DV   ++ L      G + N+ DD+PAP  +V+  A  L              
Sbjct: 204 VNRVLVDDVCGALVALAAAGARGDVVNVVDDDPAPRADVVAFARELTGAG----DAPPPP 259

Query: 243 NISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
             +P      A  KR  NAK++++ + L+ P YR  L ++
Sbjct: 260 PRAPLRAARSAGAKRCRNAKLRAI-YDLVAPTYREGLARI 298


>gi|167585732|ref|ZP_02378120.1| NAD-dependent epimerase/dehydratase [Burkholderia ubonensis Bu]
          Length = 230

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (45%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   +HP +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 35  YASTTGVYGDCGGARIDETHPLHPANPRALRRVSAERQLRAATVRGGLSARIVRIPGIYA 94

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N I  +D+A   I L     G      + SDD   
Sbjct: 95  ANRLPLARL-ERGTPALAPADDVYTNHIHADDLA--TILLRAAARGRPSRAVHASDDSEL 151

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
                    A +  + PP       A   + P    F  +++R+SNA++K  L   L YP
Sbjct: 152 RMGEYFDRVAQVFGLPPPPRVSRADAERLLEPTLLSFMRESRRLSNARLKRELCVTLRYP 211

Query: 274 N 274
            
Sbjct: 212 T 212


>gi|119899784|ref|YP_934997.1| hypothetical protein azo3495 [Azoarcus sp. BH72]
 gi|119672197|emb|CAL96111.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 292

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 102/213 (47%), Gaps = 8/213 (3%)

Query: 76  SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNA 135
            +GDP    +     K     + + Y+S+T +YG+  G  VDE +     +  A +R +A
Sbjct: 77  GDGDPRTARLLAALAKRRSLPQHLIYISTTGVYGDCAGAEVDETAPCRATTARALRRVDA 136

Query: 136 EKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARC 195
           E+   A  ++    + VLR  GIY   R P  ++R+ + +     +   N I  +D+AR 
Sbjct: 137 ERRLRAFGRRTGAVVGVLRAPGIYAADRLPLERLRRGDPVLAAADDVWTNHIHADDLARL 196

Query: 196 VIFLM-THHLGGIFNLSDDEP---APPQNVIMEAASLMKITPPLEQCFDTAN-ISPFTRF 250
            +  +     G ++N  DD     A   + + +A  L +  PP  +  + A+ +SP T  
Sbjct: 197 ALAALFRGRPGRVYNAVDDSRLKMADYFDAVADACGLPR--PPRCRRAEIASRLSPLTLS 254

Query: 251 FYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
           F ++++R++N +I + L  +L YP    +L+ L
Sbjct: 255 FMSESRRLTNRRIHTELRARLRYPTVADALRAL 287


>gi|82703798|ref|YP_413364.1| NAD-dependent epimerase/dehydratase [Nitrosospira multiformis ATCC
           25196]
 gi|82411863|gb|ABB75972.1| NAD-dependent epimerase/dehydratase [Nitrosospira multiformis ATCC
           25196]
          Length = 302

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 85/178 (47%), Gaps = 4/178 (2%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y+S++ +YG+ +G  V+E   ++P++  A +R +AE+       +  + +++LR+ GIY 
Sbjct: 116 YISTSGVYGDCKGALVNETRAINPLTERAVRRADAERRVRHWGLRNGVNVSILRVPGIYA 175

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPPQ 219
             R P  ++R+   +   + +   N I  +D+ R V+  + +   G +++  DD      
Sbjct: 176 GDRLPLARLREGAPVLASEDDGYTNHIHADDLVRIVVAALRYARPGRVYHACDDSNLKMG 235

Query: 220 NVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
                 A    +  P  + +      I+P    F  +++R++N +IK  L   L YP 
Sbjct: 236 EYFDLVADRFALPRPSRVPRAEAEGRIAPGMLSFMQESRRLTNMRIKQELRVHLRYPT 293


>gi|284097353|ref|ZP_06385478.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
 gi|283831131|gb|EFC35116.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
          Length = 285

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 123/292 (42%), Gaps = 54/292 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I GAGYTG+FI  AA +       T+RS S  L+    G                 ++
Sbjct: 9   LVILGAGYTGRFIYRAARRRRRQVFATSRSPSAHLSFAQAG----------------HRI 52

Query: 63  YFTTH---IVQCIKPSSEGDPCIISMSKDFYK-FMPHV----KWIGYLSSTSIYGNREGQ 114
           +F  H       I P S+   C  ++ +D    F  H       +  L STS Y      
Sbjct: 53  FFDLHQPGTWSQIPPQSDIVWCFPALPQDVASTFAQHAIDRDSRLILLGSTSAYRAGRPG 112

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           ++DE   V+      +    A +E L  T        VLRLSG+YGP+R+ F  IR+   
Sbjct: 113 FIDEGVPVN-----RSMPRVASEECLRTTYGAT----VLRLSGLYGPERHVFDWIRKGK- 162

Query: 175 LRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
              +K +Q + N I +EDVA  C++ L     G  + +SD +P     +   AA   +I 
Sbjct: 163 ---IKNSQKYVNLIHIEDVAELCLLALRYATPGSTYIVSDGQPRTWAEICRLAAECFQIA 219

Query: 233 -PPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNYRISLKQL 282
            PP     +T              KR+S  KI S   ++L +P+   +L +L
Sbjct: 220 IPPATTTRET-------------GKRLSPQKILSDFHYRLKHPDLFTALAEL 258


>gi|327478770|gb|AEA82080.1| epimerase/dehydratase-related protein [Pseudomonas stutzeri DSM
           4166]
          Length = 286

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 21/188 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +Y  R+G+W+DE S   P          AE+    +     +    +R+ G+Y 
Sbjct: 109 FVSSTGVYAQRDGEWIDEDSPTEPTGFTGQVMLEAEQ----LALGCGLPATCVRMGGLYD 164

Query: 161 PKRNPFIKIRQKNSLRLVKK-NQVFNRIRVEDVARCVIFLMTHHLGGI-----FNLSDDE 214
           P R P+++ + +  LR+ +   Q  NRI  +D A  + FL+     G      +   DDE
Sbjct: 165 PSR-PWLQNQVRAGLRVERDPPQYSNRIHRDDAAALLAFLLQADASGTALQPCYLGVDDE 223

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PAP   V+      + +T   EQ          TR   A +KR SNA+ ++LG++  + +
Sbjct: 224 PAPLHEVVDWLRERLGVTHWAEQS--------MTR--RAGSKRCSNARARALGWKPRFAS 273

Query: 275 YRISLKQL 282
           YR     L
Sbjct: 274 YRDGYASL 281


>gi|311104792|ref|YP_003977645.1| NAD dependent epimerase/dehydratase family protein 4 [Achromobacter
           xylosoxidans A8]
 gi|310759481|gb|ADP14930.1| NAD dependent epimerase/dehydratase family protein 4 [Achromobacter
           xylosoxidans A8]
          Length = 288

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 16/190 (8%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
            +K + ++SS+++YG  EG WVDE +   P+         AE           +    LR
Sbjct: 99  QLKRVVFISSSAVYGEHEGGWVDEDTPPAPLGVNGRVLLEAET----ALATYGLPSTALR 154

Query: 155 LSGIYGPKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSD 212
           L+G+YGP R   I ++RQ  +    +     NRI ++D A  V+ L        ++   D
Sbjct: 155 LAGLYGPGRLQLIERLRQGAAGAPTQPAHWANRIHIDDAAAAVVHLALLPEAAPVYVGCD 214

Query: 213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
           D P P   +  + A L+       +    AN+          +K++SNA++++ GF L +
Sbjct: 215 DTPLPLHELYADLARLIGAP-APREAPAPANVG---------SKKLSNARLRASGFTLQW 264

Query: 273 PNYRISLKQL 282
           P+ R+    L
Sbjct: 265 PDSRLGYAAL 274


>gi|254283604|ref|ZP_04958572.1| ActC family protein [gamma proteobacterium NOR51-B]
 gi|219679807|gb|EED36156.1| ActC family protein [gamma proteobacterium NOR51-B]
          Length = 286

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 101 YLSSTSIYGNREGQWVDEHSFV---HPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSG 157
           ++SST +YG+ +G WVDE S +    P S    +  NA +   A T        V+R SG
Sbjct: 106 FVSSTRVYGDADGGWVDEQSPIDTSDPRSAAIIEGENAARALGACT--------VIRPSG 157

Query: 158 IYGPKRNPFIKIRQKNSLRLVKKN--QVFNRIRVEDVARCVIFLM-----THHLGGIFNL 210
           +YG   +P  ++ Q+ +   V  N  Q  NRI  ED+A  +  L+        L      
Sbjct: 158 LYG---SPPGRLLQQVAQGAVSNNTTQFSNRIHREDLAGVLSSLLRQSAANQELPETLIA 214

Query: 211 SDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
           SDD P           S  +I   L       N +  T      N+R SN ++   G++L
Sbjct: 215 SDDAP----------CSAAEIQGWLADQLGVKNPTLSTPTAPRKNRRCSNRRLHETGYRL 264

Query: 271 LYPNYRISLKQL 282
            YP+YR   ++L
Sbjct: 265 RYPSYREGYREL 276


>gi|187477649|ref|YP_785673.1| hypothetical protein BAV1151 [Bordetella avium 197N]
 gi|115422235|emb|CAJ48759.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 277

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 87/190 (45%), Gaps = 23/190 (12%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL---AVL 153
           +W+ ++SS+++YG   GQW+DE S   P      Q FN  +  L   + L   L     L
Sbjct: 101 RWV-FVSSSAVYGEHSGQWIDEDSPTSP------QGFNG-RILLEAEQALQTALPGAVSL 152

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDD 213
           RL+G+YGP R   ++  ++   R    +   NR+ ++D A  +  L+  H+        D
Sbjct: 153 RLAGLYGPGRTQLLQRLRQGQAR-AAADHWANRMHIDDAAAALDHLL--HI--------D 201

Query: 214 EPAPPQNVIMEAASLM-KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
            P P    + +   L+ ++   L +  +              +KR+SN ++KS GF L +
Sbjct: 202 APLPCYLGVDDTPMLLDQLYGELARMLNAPPPEAGPPPADVGSKRLSNQRLKSSGFALRW 261

Query: 273 PNYRISLKQL 282
           P+     ++L
Sbjct: 262 PDTIAGYREL 271


>gi|238753426|ref|ZP_04614789.1| hypothetical protein yruck0001_19540 [Yersinia ruckeri ATCC 29473]
 gi|238708379|gb|EEQ00734.1| hypothetical protein yruck0001_19540 [Yersinia ruckeri ATCC 29473]
          Length = 275

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 127/280 (45%), Gaps = 23/280 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           + I G G+ G  +A A ++ G+   G+  +   +   +  G+  +   L  D   +    
Sbjct: 4   VAIIGLGWLGMPLAQALIRRGIQVVGSKTTPDGVDAARMSGVECYQLELTPDLMCDPEDL 63

Query: 60  EKLYFTTHIVQCIKPS---SEGDPCIISMSKDFYKFMPH-VKWIGYLSSTSIYGNREGQW 115
            +L+    +V  +  S    +GD   +++ +     + + V  I + SSTS+YG+  GQ 
Sbjct: 64  PRLFDVDALVITLPASRTAEDGDGYFLAVREVVDSALVYGVPRIIFTSSTSVYGDTVGQ- 122

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           V E S + P+S  A +   A ++WL      ++   +LRL+G+ G +R+P   +  K ++
Sbjct: 123 VKEDSPLRPVSG-AGKTLVALEQWLHQLPHTSVD--ILRLAGLVGNERHPGRFLAGKTAV 179

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPP 234
           +    +Q  N +  +DV   +  L+    GG I+NL   +    ++   E A  +++TPP
Sbjct: 180 K--GASQGVNLVHQDDVIAAIELLLNLPKGGHIYNLCAPKHPAKKDFYPECARALQLTPP 237

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
                D    S        D  RI +     LGF+ +YP+
Sbjct: 238 KFAPEDGVQPSRLV-----DGSRICS----ELGFEYIYPD 268


>gi|88705446|ref|ZP_01103157.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700536|gb|EAQ97644.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 295

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 74/179 (41%), Gaps = 15/179 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SST +Y   +G WVDE S              AE+ +L   +       VLR  G+YG
Sbjct: 106 FVSSTRVYSEADGGWVDEDSATAEDDPHVAAILAAERAFLDGVE----NSVVLRAGGLYG 161

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL---GGIFNLSDDEPAP 217
               P +K      L      +  NRI  +DVA  +  ++         + NL DD P P
Sbjct: 162 HGPGPLLKRVTSGRLTPASPPRYGNRIHRDDVAGFMAAVLQGQATVDATVINLVDDAPVP 221

Query: 218 PQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            Q+V  EA    ++  P       A   P        +KRI N ++   G+ L +P+YR
Sbjct: 222 LQDV--EAWLCRELGVPY------APPGPANYGEAPGHKRIRNGRLHRSGYSLQFPDYR 272


>gi|183219532|ref|YP_001837528.1| hypothetical protein LEPBI_I0105 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189909674|ref|YP_001961229.1| nucleoside-diphosphate-sugar epimerase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167774350|gb|ABZ92651.1| Nucleoside-diphosphate-sugar epimerase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167777954|gb|ABZ96252.1| Hypothetical protein LEPBI_I0105 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 322

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 98/216 (45%), Gaps = 34/216 (15%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKL--NIKLAVL 153
           VK   + SS+S+YG   G    E    +P    A  ++  E+    +T+++   +K  +L
Sbjct: 109 VKAYVHFSSSSVYGTYNGNPFKETDVCNPKDSYAKSKYAGEQ---IVTERIKNGLKAIIL 165

Query: 154 RLSGIYGPKRNP-----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH--LGG 206
           R   +YGP  N      F +  Q   +    K ++ N +RVEDVAR  I+L       G 
Sbjct: 166 RPCTVYGPGCNDGAGKVFSRPGQIAGIPGDGKKKLAN-VRVEDVARAAIYLSEKENTFGQ 224

Query: 207 IFNLSDDEPAPPQNVIMEAAS------LMKI-TPPLEQCFDTANISPFTRF--------- 250
           I+N++DD+  P     +E AS      + KI  P L     +   SP  +          
Sbjct: 225 IYNIADDD-HPSLEEALELASKTFGSKINKIHIPLLLLKIISKLESPIAKLQGRIPDLEY 283

Query: 251 ----FYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
               +  D+  + N K+KS G++LLYPN+  S++ +
Sbjct: 284 EAIKYLYDDYYMDNEKLKSTGYKLLYPNFVSSMESM 319


>gi|90415471|ref|ZP_01223405.1| hypothetical protein GB2207_09146 [marine gamma proteobacterium
           HTCC2207]
 gi|90332794|gb|EAS47964.1| hypothetical protein GB2207_09146 [marine gamma proteobacterium
           HTCC2207]
          Length = 280

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 21/191 (10%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           K + ++SSTS+YGN +G WVDE S    +S        AE++       L     ++R S
Sbjct: 100 KLVIWVSSTSVYGNCDGDWVDEQSPTTALSFSGKLLLEAEQQ----ITDLPCPTVIVRFS 155

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM-----THHLGGIFNLS 211
           GIYGP R   +        R  +  Q  NRI  ED A  +  L+        L  ++  +
Sbjct: 156 GIYGPGRTRMLDQIIAGKGRPAQPEQWSNRIYSEDCAGVLAHLVRAFDAGKELESLYIAT 215

Query: 212 DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
           D  P    ++ +  A  ++     E     A             +R SN ++   G++ L
Sbjct: 216 DCAPVTQHDLRIWLAQQLEAELEDEIVEQKA------------IRRCSNQRLLDSGYEFL 263

Query: 272 YPNYRISLKQL 282
           YP+Y+   + L
Sbjct: 264 YPSYKEGYQSL 274


>gi|156327906|ref|XP_001618925.1| hypothetical protein NEMVEDRAFT_v1g224686 [Nematostella vectensis]
 gi|156200923|gb|EDO26825.1| predicted protein [Nematostella vectensis]
          Length = 278

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 21/195 (10%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           K + + SSTS+YG    +WV E S   P          AE++   +         V+R S
Sbjct: 98  KHLFFTSSTSVYGQNAHEWVTEDSPTQPQDAYGQIMCEAEQQIFDLGNG-----CVVRFS 152

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLS 211
           GIYGP R+  I   +             NRI  +D A  +  L+   L        + +S
Sbjct: 153 GIYGPGRHHLINRVKAGVGAPQTPVHYSNRIHRDDCAGALAHLVQRALSHRPLERCYLVS 212

Query: 212 DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
           D EP P   +    A  + +T           ++  T      +KR  + +++  G+QL 
Sbjct: 213 DLEPTPIHTITDWLAEQLNVT-----------VNTRTPIQRGGSKRCDSQRLQDSGYQLR 261

Query: 272 YPNYRISLKQLWKEI 286
           YPNY+     +  ++
Sbjct: 262 YPNYQAGFNAILADL 276


>gi|258593089|emb|CBE69400.1| NAD-dependent epimerase/dehydratase [NC10 bacterium 'Dutch
           sediment']
          Length = 287

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 111/289 (38%), Gaps = 32/289 (11%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           +++I G GY G  +       G    G  R  + L +     I P+  AD    + L+  
Sbjct: 3   NILIAGCGYIGTALGSLLAAEGQTVWGLRRDPATLPSE----IRPWA-ADLTSPDTLQTL 57

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--------PHVKWIGYLSSTSIYGNREG 113
                 +V    P +  D    S+  D    +         H + +   SST +YG   G
Sbjct: 58  PPAIDWVVYSAAPDTHDDTAYRSVYVDGLNNLLHALTVQQAHPRRVFLTSSTGVYGESSG 117

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLN--IKLAVLRLSGIYGPKRNPFIKIRQ 171
            WVDE S   P      + F   +        L+      VLRL G+YGP R   I+  +
Sbjct: 118 AWVDETSPTEP------REFGGIRLLEGERLLLDGPFPATVLRLGGLYGPGRASLIEQVR 171

Query: 172 KNSLRLVKKNQV-FNRIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAPPQNVIMEAASLM 229
           +  +    ++ V FNRI  +D A  +  LMT      ++   D EP     ++   A  +
Sbjct: 172 RGEIAWDNESPVYFNRIHRDDAAGALRHLMTLPRPDPVYVGVDHEPTTLAVLLDWLADAL 231

Query: 230 KITP--PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            ++P  P E         P        NKR  NAK+ + G+   YP +R
Sbjct: 232 GVSPTRPGESSKTRTARHPA-------NKRCRNAKLVTSGYTFHYPTFR 273


>gi|171464040|ref|YP_001798153.1| NAD-dependent epimerase/dehydratase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193578|gb|ACB44539.1| NAD-dependent epimerase/dehydratase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 295

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 81/180 (45%), Gaps = 3/180 (1%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V+ + Y+S+T +YG  +G  V E + V+P S  A +R +AE+          + L +LR+
Sbjct: 102 VRRLIYISTTGVYGGHQGVKVSEITPVNPQSERAKRRVDAERALRLWAPAHGVALTILRV 161

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSDDE 214
            GIY   R P  +++ +    + + +   N I  +D+AR V   + H     I N+ D  
Sbjct: 162 PGIYAADRLPIDRLQAQTPALVSEDDAYSNHIHSDDLARLVSAAVYHGKPQRIINVCDGG 221

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTAN--ISPFTRFFYADNKRISNAKIKSLGFQLLY 272
                +   E A    +  P     +     +SP    F  +++R++N ++  L   L Y
Sbjct: 222 ETKMGDYFDEVADAYGLARPKRLPREELQRIVSPMLWSFMCESRRVTNTRLSELKTPLRY 281


>gi|212709666|ref|ZP_03317794.1| hypothetical protein PROVALCAL_00713 [Providencia alcalifaciens DSM
           30120]
 gi|212687477|gb|EEB47005.1| hypothetical protein PROVALCAL_00713 [Providencia alcalifaciens DSM
           30120]
          Length = 274

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 112/243 (46%), Gaps = 21/243 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A+  +  G+   GT  S+  +   +  GI       +P L  D  ++
Sbjct: 4   ITIIGLGWLGVPLANRLMAHGMNVAGTKTSIDGVEAARGVGIDCYQLQLTPELRCD--VD 61

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPC--IISMSKDFYKFMPH-VKWIGYLSSTSIYGNRE 112
           +L  ++L   T ++  + P S+      I+++ +     + + V  + + SSTS+YG  E
Sbjct: 62  DL--DQLMEGTEVLVILLPPSKVSLSGYIVAIEQLVDSAISYRVPRVIFTSSTSVYGEVE 119

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G   ++   +      + +   A ++WL      NI++ VLRL+G+ G  R+    +  K
Sbjct: 120 GVITEDAPLLG--ETASAKALIAVEQWLHGLP--NIRVDVLRLAGLVGENRHAGRFLAGK 175

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKI 231
             ++    NQ  N +  +DV   ++ L+    GG ++NL   E    Q    EAA  + +
Sbjct: 176 EQVK--GANQPVNMVHQDDVIAAILLLIQRSEGGHVYNLCAPEHPTRQQFYTEAAESLNL 233

Query: 232 TPP 234
           TPP
Sbjct: 234 TPP 236


>gi|167582949|ref|ZP_02375823.1| hypothetical protein BthaT_32693 [Burkholderia thailandensis TXDOH]
 gi|167618199|ref|ZP_02386830.1| hypothetical protein BthaB_17971 [Burkholderia thailandensis Bt4]
          Length = 358

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 88/188 (46%), Gaps = 10/188 (5%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL 153
           P    + Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++
Sbjct: 159 PSRPVVVYASTSGVYGDCGGARVDETRPVRPANPRAQRRVSAERQLRRATARGALSARIV 218

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFN 209
           R+ GIY   R P  ++ +K +  L++ + V+ N I  +D+A   I L     G    + +
Sbjct: 219 RIPGIYAANRLPLARL-EKGTPALIEADDVYTNHIHADDLA--SILLRAAARGKPARVVH 275

Query: 210 LSDDEPAPPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SL 266
            SDD      +     A    ++  P + +      + P    F  +++R++NA++K  L
Sbjct: 276 ASDDTELKMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKREL 335

Query: 267 GFQLLYPN 274
              L YP+
Sbjct: 336 RIALRYPS 343


>gi|83720686|ref|YP_441349.1| hypothetical protein BTH_I0793 [Burkholderia thailandensis E264]
 gi|83654511|gb|ABC38574.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 361

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 88/188 (46%), Gaps = 10/188 (5%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL 153
           P    + Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++
Sbjct: 162 PSRPVVVYASTSGVYGDCGGARVDETRPVRPANPRAQRRVSAERQLRRATARGALSARIV 221

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFN 209
           R+ GIY   R P  ++ +K +  L++ + V+ N I  +D+A   I L     G    + +
Sbjct: 222 RIPGIYAANRLPLARL-EKGTPALIEADDVYTNHIHADDLA--SILLRAAARGKPARVVH 278

Query: 210 LSDDEPAPPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SL 266
            SDD      +     A    ++  P + +      + P    F  +++R++NA++K  L
Sbjct: 279 ASDDTELKMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKREL 338

Query: 267 GFQLLYPN 274
              L YP+
Sbjct: 339 RIALRYPS 346


>gi|33867001|ref|NP_898560.1| hypothetical protein SYNW2471 [Synechococcus sp. WH 8102]
 gi|33639602|emb|CAE08986.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 287

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 117/297 (39%), Gaps = 48/297 (16%)

Query: 1   MHLMIFGAGYTGKFIAD------AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKI 54
           M L I G GY G  +A+        LK+ + T  + R +  L  L  +        D   
Sbjct: 1   MDLTIVGCGYVGLALAERLQPRRPQLKLTLTTTNSER-LEQLDPLADR----VEVCDATN 55

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCI---------ISMSKDFYKFMPHVK---WIGYL 102
              L   L  ++  V C+ P  +GD  +         +   +     +P ++    I Y 
Sbjct: 56  PMQLLAALRQSSSAVFCLGP--KGDRQVDANGYRHTFVDSFRCLTSLLPQLRELRQIVYT 113

Query: 103 SSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPK 162
            S SIYG+ EG WVDE +   P          +E     I+ +   ++ +LRL  +YGP 
Sbjct: 114 GSCSIYGDAEGDWVDEQTPPAPSRGHGDVLLESEHLLSGISDR---RVCILRLGALYGPG 170

Query: 163 RNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNV 221
           R+   ++R    L        + N + V D A  +   +     G+ N+ +DEP   +++
Sbjct: 171 RDLDRRLRGLAGLERPGNGATYSNWLHVADAAGALEAALNAEWAGLVNVVNDEPIQLRDL 230

Query: 222 IMEAASLMKITPPLEQCFDTANISPFTRFFYAD-----NKRISNAKIKSLGFQLLYP 273
           +  +     + P               R+   D      +RI N ++K LG+QL +P
Sbjct: 231 VGRSLQRQGLAP--------------VRWLGQDEPGSGGRRIRNTRLKQLGYQLQHP 273


>gi|257139977|ref|ZP_05588239.1| hypothetical protein BthaA_12365 [Burkholderia thailandensis E264]
          Length = 358

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 88/188 (46%), Gaps = 10/188 (5%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL 153
           P    + Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++
Sbjct: 159 PSRPVVVYASTSGVYGDCGGARVDETRPVRPANPRAQRRVSAERQLRRATARGALSARIV 218

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFN 209
           R+ GIY   R P  ++ +K +  L++ + V+ N I  +D+A   I L     G    + +
Sbjct: 219 RIPGIYAANRLPLARL-EKGTPALIEADDVYTNHIHADDLA--SILLRAAARGKPARVVH 275

Query: 210 LSDDEPAPPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SL 266
            SDD      +     A    ++  P + +      + P    F  +++R++NA++K  L
Sbjct: 276 ASDDTELKMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKREL 335

Query: 267 GFQLLYPN 274
              L YP+
Sbjct: 336 RIALRYPS 343


>gi|227329026|ref|ZP_03833050.1| hypothetical protein PcarcW_17500 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 278

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 129/285 (45%), Gaps = 37/285 (12%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKINN 56
           I G G+ G  +A A    G +  GT  +   +   +  GI       +P L  D  +++ 
Sbjct: 6   IVGLGWLGMPLALALNGHGYHVTGTKTTQDGVEAARMSGIECYQLALTPELECDADELSA 65

Query: 57  LLREKLYFTTHIVQCIKPSSEGD------PCIISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
           LL+  +   T  +   + +  GD        +++M++ F     HV  I + SSTS+YG+
Sbjct: 66  LLQVDVLIVT--LPASRTAEGGDGYAQAVQQLVNMARVF-----HVPRIIFTSSTSVYGD 118

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
             G    E+S + P + VA +   + ++WL      ++   +LRL+G+ G +R+P   + 
Sbjct: 119 SSGT-AKENSSLQP-TTVAGKTLVSLEQWLQHLPDTSVD--ILRLAGLVGGERHPGRFLA 174

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLM 229
            K +L   + N   N +  EDV   ++ L+    GG I+NL   E    Q+   E A  +
Sbjct: 175 GKTNLP--RGNHGVNLVHQEDVLAAILLLLKLPNGGHIYNLCAPEHPARQDFYPEQARRL 232

Query: 230 KITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            ++PP       A ++   +    D +RI +     LGF+  YPN
Sbjct: 233 HLSPP-----QFAPVTDSDQGKIVDGQRICH----ELGFEYQYPN 268


>gi|325108542|ref|YP_004269610.1| saccharopine dehydrogenase [Planctomyces brasiliensis DSM 5305]
 gi|324968810|gb|ADY59588.1| Saccharopine dehydrogenase [Planctomyces brasiliensis DSM 5305]
          Length = 284

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 119/283 (42%), Gaps = 17/283 (6%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           ++ G GY G+  A+     G+    TTRS      L+  G+ PF+     + +L      
Sbjct: 6   LVVGCGYVGQRAAEFWRDAGLQVAVTTRSPERAQKLEAAGLHPFVCNVLDLPSLRPLPAA 65

Query: 64  FTT-HIVQCIKPS--SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
            T  H V   + S  S+ +  +  +S              ++SSTS+YG  +G  V+E +
Sbjct: 66  RTVLHAVGFDRESGQSQREVYVDGLSNLLEGLDGRFDQFIHISSTSVYGQTDGSAVNEEA 125

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKK 180
              P         +AE   L +  +      +LRL+GIYGP R    ++ Q+   + +  
Sbjct: 126 DTIPSRDNGRVVLDAE---LLLRDRFE-DAVILRLAGIYGPDRL-LARVLQRKDNQPIPG 180

Query: 181 NQV--FNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPLEQ 237
           N     N I + D+ R +  ++   L   +F ++DDEP   ++     ASL+    P   
Sbjct: 181 NPDAWLNLIHLTDIVRTIDAVVEKQLQNEMFLVADDEPIRRRDFYTLLASLIGAAEP--- 237

Query: 238 CFDTANISPFTRFFYADNKRISNAKIKSLGF-QLLYPNYRISL 279
            F+ +   P  +     NKR  N K+  L   +L +P  R  L
Sbjct: 238 TFEPSLSDP--KGDRGANKRCDNTKLHQLLLPELTFPTVREGL 278


>gi|149376199|ref|ZP_01893964.1| Nucleoside-diphosphate-sugar epimerase [Marinobacter algicola
           DG893]
 gi|149359604|gb|EDM48063.1| Nucleoside-diphosphate-sugar epimerase [Marinobacter algicola
           DG893]
          Length = 290

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 76/193 (39%), Gaps = 24/193 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK--EWLAITKKLNIKLAVLRLSGI 158
           ++ S+S+Y   +  WVDE S   P       R++ +   E   I  +      V+R SGI
Sbjct: 111 FIGSSSVYAQDDDSWVDESSPTDP------DRYSGQAILEGERIALESGSPATVIRFSGI 164

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDD 213
           YGP R  F+       +         NRI   D A     ++   L G      +  SD 
Sbjct: 165 YGPSRARFLDAVMNGDMDPASPGPYSNRIHEADAAAATCHIVERALVGQPLEDCYLASDC 224

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTR-FFYADNKRISNAKIKSLGFQLLY 272
           EP            L ++   + +    A   P  R    A +KR +N ++   GF   Y
Sbjct: 225 EP----------VRLDEVVAWVREQLPCAKPGPNARQGGRAGSKRCNNRRLLDSGFHFRY 274

Query: 273 PNYRISLKQLWKE 285
           P++R+  +++  E
Sbjct: 275 PDFRVGYREMIAE 287


>gi|239993878|ref|ZP_04714402.1| hypothetical enzyme of sugar metabolism [Alteromonas macleodii ATCC
           27126]
          Length = 270

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 95/204 (46%), Gaps = 13/204 (6%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           +++I G G+   ++ +A L   V   GTTRS    L L+ +GI+   +A  +  + L   
Sbjct: 4   NVVISGYGWLASYVGNA-LSGKVNIVGTTRSQQKRLALQDQGITAIEYALGEDTSALCNH 62

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMP-----HVKWIGYLSSTSIYGNREGQWV 116
           L   T ++    P    +  + S + +  + +       V  I ++S+TS+YG+   + V
Sbjct: 63  LPNATLLLNI--PPGRRNTDLASYTNNMLQLIDAAISVKVAHIVFISTTSVYGDATNEVV 120

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
            E S   P +  A      E   L  +K+  + ++++RL+G+ GP R+P   +  K   +
Sbjct: 121 SEVSTTQPQTASAKAHVTIEDYLL--SKRGKVDISIVRLAGLVGPDRHPARSLSGK---Q 175

Query: 177 LVKKNQVFNRIRVEDVARCVIFLM 200
           L   N+  N + V D+   +  ++
Sbjct: 176 LDAGNKRINLVHVYDIVSALTTII 199


>gi|167835758|ref|ZP_02462641.1| hypothetical protein Bpse38_04643 [Burkholderia thailandensis
           MSMB43]
          Length = 279

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 86/188 (45%), Gaps = 10/188 (5%)

Query: 94  PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVL 153
           P    + Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++
Sbjct: 80  PSRPVVVYASTSGVYGDCGGARVDETRPVRPANLRAQRRVSAERQLRRATARGALSARIV 139

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFN 209
           R+ GIY   R P  ++ +K +  L + + V+ N I  +D+A   I L     G    + +
Sbjct: 140 RIPGIYAANRLPLARL-EKGTPALAEADDVYTNHIHADDLA--SILLRAAARGKPARVVH 196

Query: 210 LSDDEPAPPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SL 266
            SDD      +     A    M+  P + +      + P    F  +++R++NA++K  L
Sbjct: 197 ASDDTELKMGDYFERIARAFGMRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKREL 256

Query: 267 GFQLLYPN 274
              L YP 
Sbjct: 257 RIALRYPT 264


>gi|292654918|ref|YP_003534815.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein
           [Haloferax volcanii DS2]
 gi|291372037|gb|ADE04264.1| 3-beta hydroxysteroid dehydrogenase/isomerase family superfamily
           [Haloferax volcanii DS2]
          Length = 298

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 108/291 (37%), Gaps = 23/291 (7%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + + G GY G  +A   +  G    G  RS   L  ++  G +  + AD    + L  
Sbjct: 1   MRVAVLGCGYVGLELARTLVADGHDVWGVRRSDDGLDAVEATG-AEAVRADVTDADSL-G 58

Query: 61  KLYFTTHIVQCIKPSSEGDPCI---------ISMSKDFYKFMPHVKWIGYLSSTSIYGNR 111
            +    H+V        G              ++ +   +  P  + + Y SST +YG+ 
Sbjct: 59  AVPDVDHVVFAASSGGRGADAARAVFVEGLRTAIDQFAARDSPPERLV-YTSSTGVYGDH 117

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
            G +VDE + + P +        AE+       +  ++  V R +G+YGP R      R 
Sbjct: 118 GGDFVDESTPLDPTTDKTRVLAEAERVAREYAAERGVEGTVTRFAGLYGPDR-----YRL 172

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG--GIFNLSDDEPAPPQNVIMEAASLM 229
           +  L         N +  +D A  V  L+           + DDEP          A   
Sbjct: 173 ERYLNGPVTAGYLNMVHRDDAAGVVASLLETDRARDDTVLVVDDEPVSKHEFADWLADEC 232

Query: 230 KITPPL----EQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            +  P     E+  D  ++S   R     +KR SN  ++ LG+   YP YR
Sbjct: 233 GVPRPEKRTKEERLDAGDLSAAARRRILTSKRCSNDYLRELGYSFAYPTYR 283


>gi|318605032|emb|CBY26530.1| nucleoside-diphosphate-sugar epimerases [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 275

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 129/289 (44%), Gaps = 41/289 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A + ++ GV   G+  +   +  ++  GI       +P L  D   +
Sbjct: 4   VAIIGLGWLGMPLAQSLVRRGVQVVGSKTTPDGVEAVRMSGINCYQLQLTPELICDP--D 61

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPC-----IISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
           +L  E+L     +V  +  S   D        + M  D       V  I + SSTS+YG 
Sbjct: 62  DL--EQLMTVDALVITLPASRTADGGEQYFQAVQMVVD-SALAFGVPRIIFTSSTSVYGE 118

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
             G+ + E S + P++     +  AE E WL   K  N  + +LRL+G+ G +R+P   +
Sbjct: 119 TRGR-IKESSPLQPVTTAG--KTLAELELWL--HKLPNTSVDILRLAGLVGAERHPGRFL 173

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPP--QNVIMEAA 226
             K +++    +Q  N +  EDV   +  L+    GG I+NL    PA P  ++   E A
Sbjct: 174 AGKTNVK--GGSQGVNLVHQEDVISAIELLLNLPRGGHIYNLC--APAHPRKRDFYPECA 229

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
             +++TPP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 230 RALQLTPPE---FAPEDIEEALR-------EIDGSKICSELGFEYQYPD 268


>gi|325981149|ref|YP_004293551.1| NAD-dependent epimerase/dehydratase [Nitrosomonas sp. AL212]
 gi|325530668|gb|ADZ25389.1| NAD-dependent epimerase/dehydratase [Nitrosomonas sp. AL212]
          Length = 298

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 97/223 (43%), Gaps = 22/223 (9%)

Query: 65  TTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHP 124
           T H++  +   ++ +P I+             + + Y+S++ +YG+  G  ++E   V P
Sbjct: 84  TLHLLSALTKKTKTNPIILP------------QRLIYISTSGVYGDCRGDLINETHPVQP 131

Query: 125 ISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF 184
            +  A +R  AEK+     K+ +I   ++R+ GIY   R P  ++R  +   L  ++   
Sbjct: 132 ENDRAIRRVFAEKQIRNWGKRNHISTCIVRVPGIYAANRLPLQRLRDGHPTLLDAEDNYT 191

Query: 185 NRIRVEDVARCVI----FLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFD 240
           N I  +D+A+ +     F  T+    I++  DD            A    +  P     +
Sbjct: 192 NHIHADDLAQIIFAAIRFAKTNR---IYHACDDSHLKMGEYFDLVADYFGLPHPRRITRN 248

Query: 241 TA--NISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISLK 280
            A   I+P    F  +++R+ N +I K L   LLYP     +K
Sbjct: 249 QAQEQITPTMLSFMKESRRLRNVRIKKELHISLLYPTVHDGVK 291


>gi|257095150|ref|YP_003168791.1| NAD-dependent epimerase/dehydratase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047674|gb|ACV36862.1| NAD-dependent epimerase/dehydratase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 301

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 93/193 (48%), Gaps = 9/193 (4%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S++ +YG+  G  +DE     P +  A +R +AE +  A+ ++  + +++LR+ GI
Sbjct: 107 IVYISTSGVYGDCAGACIDETRAPQPGTARARRRLDAEYQLRALGRR-GVVVSILRVPGI 165

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA 216
           Y   R P  ++ Q+ S  L  ++ V+ N I  ED+A      + +      +N +DD   
Sbjct: 166 YAADRLPIERL-QRASPALRNEDDVYTNHIHAEDLAMLTCAALRYGRSNRTYNATDDSQI 224

Query: 217 PPQ---NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                 +++ +   L ++ P L +      +S     F  +++R+ N ++K+ L  +L Y
Sbjct: 225 KMGDYFDLVADRFGLPRV-PRLSRHQAQERLSALQLSFMGESRRLLNQRVKTELRAKLNY 283

Query: 273 PNYRISLKQLWKE 285
           P     +   W E
Sbjct: 284 PRVEDGVAAAWAE 296


>gi|304309929|ref|YP_003809527.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium HdN1]
 gi|301795662|emb|CBL43861.1| NAD-dependent epimerase/dehydratase [gamma proteobacterium HdN1]
          Length = 298

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 84/183 (45%), Gaps = 24/183 (13%)

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL--AVLRLSGIY 159
           +SSTS+Y  + G+WVDE       S VA   F A          LN  L  +V+RLSGIY
Sbjct: 104 VSSTSVYPQQNGEWVDEQ------SPVAHSGFAARALLAGEQHALNGALPASVIRLSGIY 157

Query: 160 GPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG-----IFNLSDD 213
           GP R+  ++ R K    +VK+   + NRI  +D    ++ L+     G     ++  +D 
Sbjct: 158 GPGRDWLVR-RAKADTPVVKEPPKWTNRIHRDDAVGFLVHLLERVEQGQEVEPLYLATDS 216

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
            PA    V+      + +  P      TA   P        NKR+ N ++ + G+ L YP
Sbjct: 217 HPATEWEVMSFLHQQLGLPDPR---IATAEADPKM------NKRLRNTQMLASGYTLRYP 267

Query: 274 NYR 276
           +++
Sbjct: 268 SFQ 270


>gi|227111978|ref|ZP_03825634.1| hypothetical protein PcarbP_03383 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 278

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 121/279 (43%), Gaps = 25/279 (8%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKINN 56
           I G G+ G  +A A    G    GT  +   +   +  GI       +P L  D  +++ 
Sbjct: 6   IVGLGWLGMPLALALNGHGYRVTGTKTTQDGVEAARMSGIECYQLALTPELECDADELSA 65

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
           LL+  +   T          EG    +    +  +   HV  I + SSTS+YG+  G   
Sbjct: 66  LLQADVLIVTLPASRTAEGGEGYAQAVQQLVNMARVF-HVPRIIFTSSTSVYGDSSGT-A 123

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
            E+S + P + VA +   + ++WL      ++   +LRL+G+ G +R+P   +  K +L 
Sbjct: 124 RENSPLQPTT-VAGKTLVSLEQWLQHLPDTSVD--ILRLAGLVGGERHPGRFLAGKANLP 180

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPL 235
             + N   N +  EDV   ++ L+    GG I+NL   E    Q+   E A  + ++PP 
Sbjct: 181 --RGNHGVNLVHQEDVLAAILLLLKLPNGGHIYNLCAPEHPARQDFYPEQARRLHLSPP- 237

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
                 A ++   +    D +RI +     LGF+  YPN
Sbjct: 238 ----QFAPVTDSDQGKIVDGQRICH----ELGFEYQYPN 268


>gi|33865894|ref|NP_897453.1| hypothetical protein SYNW1360 [Synechococcus sp. WH 8102]
 gi|33633064|emb|CAE07875.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 341

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           + YLSS  +YG++ G    E S     +        AE   LA+    +I+  VLRL GI
Sbjct: 111 VSYLSSAGVYGDQSGAVTTELSSPDLSNTTNELLVQAENAVLALNTP-SIQTCVLRLGGI 169

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIFNLSDD 213
           YGP ++    IR  +  ++ K     N  + ++D+ R V F +   L GI+NL DD
Sbjct: 170 YGPGKDIPSFIRSASGQQVAKNGNHINAWVHLDDIVRGVEFALQRRLQGIYNLVDD 225


>gi|268590225|ref|ZP_06124446.1| NAD dependent epimerase/dehydratase family protein [Providencia
           rettgeri DSM 1131]
 gi|291314508|gb|EFE54961.1| NAD dependent epimerase/dehydratase family protein [Providencia
           rettgeri DSM 1131]
          Length = 275

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 124/293 (42%), Gaps = 50/293 (17%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + + G G+ G  +A A L  G++  GT  +   +   +  GI       +P L  D   +
Sbjct: 4   VTVIGLGWVGLPLAQALLSQGIHVVGTKTTPDGIEAAQAVGIECYALKLTPELECD---D 60

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDP----CIISMSKDFYKFMPHVKWIGYLSSTSIYGNR 111
           + L + +  +  IV  + PS          I ++      F   V  + + SST++YG +
Sbjct: 61  DDLAQLMEQSDAIVILLPPSKINTEYYVMAIETLVNSAIAF--QVPKVIFTSSTAVYGEQ 118

Query: 112 EGQWVDEHSFVHPISCV--ATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
            G+  +      P+  V  + +   A ++WL   +  NI + +LRL+G+ G KR+    +
Sbjct: 119 NGEMTEN----SPLDGVTESAKALVATEQWLH--QLPNISVDILRLAGLVGEKRHAGRFL 172

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNV--IMEAA 226
             K  ++    NQ  N +  +DV   ++ L+    GG I+NL    P  P        AA
Sbjct: 173 AGKTGVK--GANQPVNMVHQDDVIAAILLLLQQPQGGHIYNLC--APVHPTRAEFYTHAA 228

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADN----KRISNAKI-KSLGFQLLYPN 274
             + +TPP              +F    N    K I+  +I + LGF+  YPN
Sbjct: 229 QSIGLTPP--------------QFIEEKNTLVGKTINGNRICQELGFEYQYPN 267


>gi|238028393|ref|YP_002912624.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           glumae BGR1]
 gi|237877587|gb|ACR29920.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           glumae BGR1]
          Length = 358

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 94/192 (48%), Gaps = 6/192 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    + +  +   ++R+ GIY 
Sbjct: 163 YASTSGVYGDCGGAHVDETRPVRPANARAVRRVSAERQLRRASARGALDARIVRIPGIYA 222

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDD-EPAP 217
             R P  ++ ++ +  LV+ + V+ N I  +D+A  ++       +G + + SDD E   
Sbjct: 223 ANRLPIARL-ERGTPALVEADDVYTNHIHADDLAGILLAAARRGRIGRVVHASDDTEMKM 281

Query: 218 PQNVIMEAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
            +     A +  + +PP + +      + P    F  +++R+ N ++K  L F L YP+ 
Sbjct: 282 GEYFERVARASGRASPPRITREEAEQRLEPVLLSFMRESRRLVNRRLKRELRFVLRYPSV 341

Query: 276 RISLKQLWKEIE 287
              L+ +  + E
Sbjct: 342 EDFLRTVSADSE 353


>gi|172061449|ref|YP_001809101.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria MC40-6]
 gi|171993966|gb|ACB64885.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria MC40-6]
          Length = 345

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 85/182 (46%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   V P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPVRPANPRAFRRVSAERQLRAATVRGALSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  LV  + V+ N I  +D+A     L    + G      + SDD  
Sbjct: 210 VNRLPLARL-ERGTPALVAADDVYTNHIHADDLA---TILRRAAVRGKPARAVHASDDSE 265

Query: 216 APPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A +  + PP  + +      + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVARVFGLPPPPRISRANAEHQLEPTLLSFMRESRRLSNARLKTELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|261821293|ref|YP_003259399.1| NAD-dependent epimerase/dehydratase [Pectobacterium wasabiae
           WPP163]
 gi|261605306|gb|ACX87792.1| NAD-dependent epimerase/dehydratase [Pectobacterium wasabiae
           WPP163]
          Length = 280

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 120/279 (43%), Gaps = 25/279 (8%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKINN 56
           I G G+ G  +A A    G +  GT  +   +   +  GI       +P L  D  ++  
Sbjct: 6   IVGLGWLGMPLALALNGHGYHVVGTKTTSDGVEAARMSGIECYQLTLTPELECDADELRA 65

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
           LL+  +   T          EG    +    +  +   H+  I + SSTS+YG+  G  V
Sbjct: 66  LLQVDVLIVTLPASRTVEGGEGYAQAVQQLVNMARVY-HIPRIIFTSSTSVYGDGSGT-V 123

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
            E S + P + VA +   + ++WL      +I + +LRL+G+ G  R+P   +  K +L 
Sbjct: 124 RETSPLQP-TTVAGKTLVSLEQWLQHLP--DISVDILRLAGLVGGDRHPGRFLAGKTNLP 180

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPL 235
             + N   N +  EDV   ++ L+    GG ++NL   E    Q    E A  ++++PP 
Sbjct: 181 --RGNHGVNLVHQEDVLSAILLLLKLPNGGHVYNLCAPEHPARQVFYPEQARRLQVSPPQ 238

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
              F  A  S   R    D +RI +     LGF   YPN
Sbjct: 239 ---FAPAIDSVQGRIV--DGQRICH----ELGFDYQYPN 268


>gi|50121505|ref|YP_050672.1| hypothetical protein ECA2581 [Pectobacterium atrosepticum SCRI1043]
 gi|49612031|emb|CAG75480.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 280

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 121/279 (43%), Gaps = 25/279 (8%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKINN 56
           I G G+ G  +A A    G +  GT  +   +   +  GI       +P L  D  +++ 
Sbjct: 6   IVGLGWLGMPLALALNGHGYHVTGTKTTQDGVEAARMSGIECYQLVLTPELECDADELSA 65

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
           LL+  +   T          EG    +    +  +   HV  I + SSTS+YG+  G  V
Sbjct: 66  LLQVDVLIVTLPASRTAEGGEGYAQAVQQLVNMARVF-HVPRIIFTSSTSVYGDGSGT-V 123

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
            E S + P + VA +   + ++WL      +I + +LRL+G+ G  R+P   +  K +L 
Sbjct: 124 RETSPLQP-TTVAGKTLVSLEQWLQHLP--DISVDILRLAGLVGGDRHPGRFLAGKTNLP 180

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPL 235
             + N   N +  EDV   ++ L+    GG I+NL   E    Q+   E A  + ++ P 
Sbjct: 181 --RGNHGVNLVHQEDVLAAILLLLKLPNGGHIYNLCATEHPARQDFYPEQARRLHVSTP- 237

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
                 A ++  ++    D +RI +     LGF   YPN
Sbjct: 238 ----QFAPVTDSSQGRIVDGQRICH----ELGFDYQYPN 268


>gi|300717483|ref|YP_003742286.1| NAD-dependent epimerase/dehydratase [Erwinia billingiae Eb661]
 gi|299063319|emb|CAX60439.1| NAD-dependent epimerase/dehydratase [Erwinia billingiae Eb661]
          Length = 275

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 20/177 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+  G  + E S + P   VA +     ++WL      N  + +LRLSG+ G
Sbjct: 109 FTSSTSVYGSGSGV-MKESSPLEP-QTVAGKTLKELEDWLHHLP--NTSVDILRLSGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQ 219
           P+R+P   +  K    L   +   N + +EDV   +  L+    GG I+NLS  +  P +
Sbjct: 165 PERHPGRFLAGKTD--LTDGSHGVNLVHLEDVVAAISLLLKTPKGGHIYNLSAPK-HPAR 221

Query: 220 NVIMEA-ASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           NV   A A  + +TPP  +  +  +            K I  +KI S LGF+  YP+
Sbjct: 222 NVFYPAVARQLGLTPPTFRQQEGGDA----------GKLIDGSKICSELGFEYSYPD 268


>gi|284029629|ref|YP_003379560.1| NAD-dependent epimerase/dehydratase [Kribbella flavida DSM 17836]
 gi|283808922|gb|ADB30761.1| NAD-dependent epimerase/dehydratase [Kribbella flavida DSM 17836]
          Length = 304

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 58/138 (42%), Gaps = 19/138 (13%)

Query: 151 AVLRLSGIYGPKRNPFIKIRQKNSLRLVKK---------NQVFNRIRVEDVARCVIFLMT 201
           AVLR  G YGP  N        + L LV+K            F+ + V+D A   +  + 
Sbjct: 166 AVLRYGGFYGPGAN-------DDQLELVRKRLFPLVGTGTGFFSWVHVDDAASATVLAVE 218

Query: 202 HHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRIS 259
             + G+FN+ DDEPAP    +   A      PP  L                  + +  S
Sbjct: 219 QKVTGVFNIVDDEPAPVSAWLPYLAECAGAKPPRRLPAWLARLLAGEMVVGMMTEGRAFS 278

Query: 260 NAKIK-SLGFQLLYPNYR 276
           NAK K  LG++L YP++R
Sbjct: 279 NAKAKRELGWELRYPSWR 296


>gi|296112742|ref|YP_003626680.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis RH4]
 gi|295920436|gb|ADG60787.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis RH4]
          Length = 282

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 115/291 (39%), Gaps = 42/291 (14%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           ++ G G  GK      L + +    T ++V+  L      +    F  +    L  + + 
Sbjct: 5   LVIGQGNIGK-----PLAIRLAKAHTVKTVARRLHEYGTLVEDIHFLQKDAKTLTLDDVK 59

Query: 64  FTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--------------KWIGYLSSTSIYG 109
            TTH+   I PS+ G    +   K +     H+              K + ++SSTS+Y 
Sbjct: 60  DTTHLAIIITPSNMGRASALDYQKSYLAVCQHIVDLANQSCEWQQKLKQVLFVSSTSVYS 119

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEK-EWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
             +G+W+DE +   PI+  A    +AE   W    K    +  ++R  GIY       I+
Sbjct: 120 QNQGEWIDETTLALPITDTAQILKDAEDLLWYTFGK----RAIIVRAGGIYHKNSTRLIE 175

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAAS 227
             ++  L  + ++   NRI   D+  C+   L++     ++  +D+ P     V+   A 
Sbjct: 176 QARQAHLVGIPRHYYTNRIMDSDLVNCLYQILVSDCPKSLYLATDNTPVTSFEVLEYIAK 235

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL-YPNYRI 277
            +   P +   FD  +            KRI    I ++    L YPNY+I
Sbjct: 236 SLNY-PSVTPIFDPPS-----------GKRI----IANINTNWLSYPNYQI 270


>gi|221211503|ref|ZP_03584482.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans CGD1]
 gi|221168864|gb|EEE01332.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans CGD1]
          Length = 343

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +  +++R+ GIY 
Sbjct: 148 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVLIASIVRIPGIYA 207

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N +  +D+A   I   T   G    + + SDD   
Sbjct: 208 ANRLPLARL-ERGTPALAPADDVYTNHVHADDLA--AILRRTAERGRPARVVHASDDSEL 264

Query: 217 PPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A    + PP  + +      + P    F  +++R+SNA++K+ L   L YP
Sbjct: 265 RMGEYFDRVAHAFGLPPPPRISRADAERQLEPTLLSFMRESRRLSNARLKAELCVSLRYP 324

Query: 274 N 274
            
Sbjct: 325 T 325


>gi|94499882|ref|ZP_01306418.1| ActC family protein [Oceanobacter sp. RED65]
 gi|94428083|gb|EAT13057.1| ActC family protein [Oceanobacter sp. RED65]
          Length = 285

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 122/300 (40%), Gaps = 36/300 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
            +I G+G  G  +A +  + G    G  RS  ++    H  IS  +   + +  +L E++
Sbjct: 4   FLIVGSGDIGGGLARSLKQQGHDVWGMRRSEKSIGEGIHT-ISADVSDMETLIGILPERI 62

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV-----------KWIGYLSSTSIYGNR 111
            +  + V   + S EG        K +   + H+           K I ++SSTS+Y + 
Sbjct: 63  DYVVYCVASPEFSEEG------YDKYYVMGLRHILALLKQNHESPKRIFFVSSTSVYPHH 116

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
           +G  V+E + + P +    +   AE   L      +    V+R SGIYGP R   I   +
Sbjct: 117 DGAVVNEETELEPTAFAGRKMLEAESTLL----HSDFTGTVVRFSGIYGPGRTRLINQAK 172

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-----LGGIFNLSDDEPAPPQNVIMEAA 226
           K +    + +   NRI  +D    + FL+        L  ++  SD  P P    I E  
Sbjct: 173 KGAHCDPEPDVWTNRIHRDDCIGVLSFLIEQDEKGTALDSVYLASDPTPTP----IFEVF 228

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKEI 286
             +K     ++  D              +KR  ++++  LG++  Y +Y+    ++  E+
Sbjct: 229 EWLK-----DRIGDVEPDHDVPEVTRRGSKRCDSSRLVKLGYRFKYKDYQQGYDEILTEM 283


>gi|238749977|ref|ZP_04611481.1| hypothetical protein yrohd0001_37490 [Yersinia rohdei ATCC 43380]
 gi|238711906|gb|EEQ04120.1| hypothetical protein yrohd0001_37490 [Yersinia rohdei ATCC 43380]
          Length = 290

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 122/281 (43%), Gaps = 29/281 (10%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFA--DQKIN 55
           I G G+ G  +A + ++ G+   G+  +   +  ++  GI       +P L    D    
Sbjct: 21  IIGLGWLGLPLAQSLIRRGIQVVGSKTTPDGVEAVRMSGIDCYQLQLTPELICEPDDLAQ 80

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
            +  + L  T    +  +  ++    +  +      F   V  I + SSTS+YG   G+ 
Sbjct: 81  LMAADVLVITLPASRTTEGGAQYLQAVQMLVDSALAF--GVARIIFTSSTSVYGEARGR- 137

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           + E++ + P++  A +     + WL   K  NI + +LRL+G+ GP R+P   +  K ++
Sbjct: 138 IKENTPLQPVT-TAGKTLEELELWL--HKLPNISVDILRLAGLVGPDRHPGRFLAGKTNV 194

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPP 234
           +    +Q  N +  EDV   +  L+    GG I+NL        ++     A ++++TPP
Sbjct: 195 K--GGSQGVNLVHQEDVIAAIELLLKLPKGGHIYNLCAPMHPLKRDFYPACARILQLTPP 252

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
               F         R        I  +KI S LGF+ LYP+
Sbjct: 253 E---FAPEESEELIR-------EIDGSKICSELGFEYLYPD 283


>gi|29827449|ref|NP_822083.1| dehydrogenase [Streptomyces avermitilis MA-4680]
 gi|29604548|dbj|BAC68618.1| putative dehydrogenase [Streptomyces avermitilis MA-4680]
          Length = 312

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 109 GNREGQWV-------DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
           G REG WV       D H      + +A  R   +         L    AV+R    YGP
Sbjct: 132 GIREGGWVKTEEDALDLHEGTAAYTAMAALRHVEDA-------VLKADGAVMRYGAFYGP 184

Query: 162 KR--NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
               +  + +R++    +       + + ++D A   +  +     G+FN+ DDEPAP  
Sbjct: 185 GATDDQLVLVRKRQFPLVGDGTGYASWVHLDDAASATVLAVEQKTRGVFNIVDDEPAPES 244

Query: 220 NVIMEAASLMKITPPLEQCFDTANI--SPFTRFFYADNKRISNAKIK-SLGFQLLYPNYR 276
             +   A+     PP+      A +           + +  SNAK K  LG++L YP++R
Sbjct: 245 EWLPWLAACAGAKPPMRVPRWLARLLAGDVVVTMMTEGRGFSNAKAKRELGWELRYPSWR 304

Query: 277 ISLKQ 281
              K+
Sbjct: 305 QGFKE 309


>gi|297190107|ref|ZP_06907505.1| dehydrogenase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721182|gb|EDY65090.1| dehydrogenase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 309

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 5/136 (3%)

Query: 151 AVLRLSGIYGP-KRNPFIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIF 208
           A LR  G YGP   +  +++ +K    LV      +  I ++D A   +  +     G+F
Sbjct: 171 AALRYGGFYGPGATDDQVELVRKRQFPLVGDGAGHSSWIHLDDAASATVLAVEQQAKGVF 230

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANI--SPFTRFFYADNKRISNAKIK-S 265
           +++DDEPAP    +   A+     PP+      A +           + +  SNAK K  
Sbjct: 231 DIADDEPAPASAWLPHLAACAGAKPPMRIPKSLARLLAGEVAVVMMTEGRGFSNAKAKRE 290

Query: 266 LGFQLLYPNYRISLKQ 281
           LG++L +P++R   K+
Sbjct: 291 LGWELRHPSWREGFKE 306


>gi|221199284|ref|ZP_03572328.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans
           CGD2M]
 gi|221205814|ref|ZP_03578829.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans CGD2]
 gi|221174652|gb|EEE07084.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans CGD2]
 gi|221180569|gb|EEE12972.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans
           CGD2M]
          Length = 343

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +  +++R+ GIY 
Sbjct: 148 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVLLASIVRIPGIYA 207

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N +  +D+A   I   T   G    + + SDD   
Sbjct: 208 ANRLPLARL-ERGTPALEPADDVYTNHVHADDLA--AILRRTAQRGRPARVVHASDDSEL 264

Query: 217 PPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A    + PP  + +      + P    F  +++R+SNA++K+ L   L YP
Sbjct: 265 RMGEYFDRVAHAFGLPPPPRISRADAERQLEPTLLSFMRESRRLSNARLKAELCVSLRYP 324

Query: 274 N 274
            
Sbjct: 325 T 325


>gi|171057358|ref|YP_001789707.1| NAD-dependent epimerase/dehydratase [Leptothrix cholodnii SP-6]
 gi|170774803|gb|ACB32942.1| NAD-dependent epimerase/dehydratase [Leptothrix cholodnii SP-6]
          Length = 322

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 124/286 (43%), Gaps = 12/286 (4%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G  G+ +   AL   +     T     L  L+  G++P L  D      LR   
Sbjct: 38  LLIIGCGDVGQRVV-RALGGRLRVRALTSQAERLPALRALGVTPLL-GDLDDAASLRRLS 95

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSK-DFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSF 121
             +  ++    P   G+    + +    +    +V+ + Y S++ +YG+  G   DE   
Sbjct: 96  ALSGWVLHLAPPPGAGEHDTRTRALLHAWAMGGNVRRLVYASTSGVYGDAAGARFDETRP 155

Query: 122 VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG---PKRNPFIKIRQKNSLRLV 178
             P +  A +R +AE++     ++  +  ++LR+ GIY    P  +P  ++ Q+ +  L 
Sbjct: 156 TAPATARARRRVDAEQQIRRWARRQGVAASILRIPGIYAGDRPGGHPRERL-QRGTPVLR 214

Query: 179 KKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP-- 234
            ++ V+ N I  +D+AR C+  LM       ++ SD       +    AA L  +  P  
Sbjct: 215 SEDDVYTNHIHADDLARICLAALMRGRPLRAYHASDTSDLRMGDYFDLAADLCGLPRPRR 274

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAK-IKSLGFQLLYPNYRISL 279
           + +      + P    F ++++R+ NA+ +  L   L +P+ R  L
Sbjct: 275 ISRTDAQRELGPMLLSFMSESRRLDNARLLNELRVHLRHPHVRTGL 320


>gi|332161143|ref|YP_004297720.1| hypothetical protein YE105_C1521 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665373|gb|ADZ42017.1| hypothetical protein YE105_C1521 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 289

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 128/289 (44%), Gaps = 41/289 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A + ++ GV   G+  +   +  ++  GI       +P L  D   +
Sbjct: 18  VAIIGLGWLGMPLAQSLVRRGVQVVGSKTTPDGVEAVRMSGINCYQLQLTPELICDP--D 75

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPC-----IISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
           +L  E+L     +V  +  S   D        + M  D       V  I + SS S+YG 
Sbjct: 76  DL--EQLMTVDALVITLPASRTADGGEQYFQAVQMVVD-SALAFGVPRIIFTSSISVYGE 132

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
             G+ + E S + P++     +  AE E WL   K  N  + +LRL+G+ G +R+P   +
Sbjct: 133 TRGR-IKESSPLQPVTTAG--KTLAELELWL--HKLPNTSVDILRLAGLVGAERHPGRFL 187

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPP--QNVIMEAA 226
             K +++    +Q  N +  EDV   +  L+    GG I+NL    PA P  ++   E A
Sbjct: 188 AGKTNVK--GGSQGVNLVHQEDVISAIELLLNLPRGGHIYNLC--APAHPRKRDFYPECA 243

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
             +++TPP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 244 RALQLTPPE---FAPEDIEEALR-------EIDGSKICSELGFEYQYPD 282


>gi|332991634|gb|AEF01689.1| sugar metabolism protein [Alteromonas sp. SN2]
          Length = 281

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 87/207 (42%), Gaps = 19/207 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+I G G+ G+++   A+        TTRS    L +  K I   +F+       L E L
Sbjct: 5   LVICGYGWLGRYLG-KAMSATHTIIATTRSEEKALKISDKHIKGLVFSLGDDTTTLCEAL 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFM---------PHVKWIGYLSSTSIYGNREG 113
              T +V  I P         +   DF   M           V  I ++S+TS+YG+   
Sbjct: 64  GNAT-LVLNIPPGRRN-----TQLDDFTDNMLTLIDNAVAARVARIIFISTTSVYGDNRT 117

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
             ++EH+   P +  A      E+  L +     + + ++RL+G+ GP R+P   +  ++
Sbjct: 118 DVLNEHASTQPETASAKAHVAIEQHLLDLKTNDKVDVKIVRLAGLTGPDRHPVNSLSGRS 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLM 200
              L   N+  N + + DV   +  L+
Sbjct: 178 ---LNAGNKRINLVHIHDVVAALKTLI 201


>gi|161523986|ref|YP_001578998.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans ATCC
           17616]
 gi|189351253|ref|YP_001946881.1| putative nucleoside-diphosphate-sugar epimerase [Burkholderia
           multivorans ATCC 17616]
 gi|160341415|gb|ABX14501.1| NAD-dependent epimerase/dehydratase [Burkholderia multivorans ATCC
           17616]
 gi|189335275|dbj|BAG44345.1| putative nucleoside-diphosphate-sugar epimerase [Burkholderia
           multivorans ATCC 17616]
          Length = 343

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +  +++R+ GIY 
Sbjct: 148 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVLVASIVRIPGIYA 207

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N +  +D+A   I   T   G    + + SDD   
Sbjct: 208 ANRLPLARL-ERGTPALEPADDVYTNHVHADDLA--AILRRTAERGRPARVVHASDDSEL 264

Query: 217 PPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A    + PP  + +      + P    F  +++R+SNA++K+ L   L YP
Sbjct: 265 RMGEYFDRVAHAFGLPPPPRISRADAERQLEPTLLSFMRESRRLSNARLKAELCVSLRYP 324

Query: 274 N 274
            
Sbjct: 325 T 325


>gi|33602695|ref|NP_890255.1| hypothetical protein BB3720 [Bordetella bronchiseptica RB50]
 gi|33577137|emb|CAE35694.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 294

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 79/184 (42%), Gaps = 16/184 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+++YG  +GQWVDEH+   P+         AE+   A       +  VLRL+G+YG
Sbjct: 105 FVSSSAVYGEHDGQWVDEHTPPGPLGFNGRSLLEAERSLGAWPG----QAVVLRLAGLYG 160

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-DDEPAPP 218
           P R   + ++R   +   V      NRI ++D A  +  L+         L  DD P P 
Sbjct: 161 PGRLQLLERLRAGQARAPVDPPHWANRIHIDDAAAAIAHLLRLPAPEPLYLGCDDTPLPL 220

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRIS 278
             +    A+L                          +KR+ NA++++ G QL +P+ R  
Sbjct: 221 HELYAALATLAGAP----------PPGEGPAPAQVGSKRLCNARLRASGLQLQWPDSRAG 270

Query: 279 LKQL 282
              L
Sbjct: 271 YAAL 274


>gi|188025779|ref|ZP_02997665.1| hypothetical protein PROSTU_01684 [Providencia stuartii ATCC 25827]
 gi|188020469|gb|EDU58509.1| hypothetical protein PROSTU_01684 [Providencia stuartii ATCC 25827]
          Length = 276

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 120/285 (42%), Gaps = 34/285 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A A L  G+   GT  +   +   +  GI       +P L  D    
Sbjct: 5   VAIVGLGWLGLPLARALLAEGIEVSGTKTTTDGIAAARAVGIDCYHLQLTPELVCD---G 61

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYK--FMPHVKWIGYLSSTSIYGNREG 113
           + L++ +     ++  + PS       ++  +          +  + + SSTS+YGN  G
Sbjct: 62  DDLQQLMEEAQALIILLPPSKVNVSAYVNAIEQLVDTAITFQIPRVIFTSSTSVYGNAIG 121

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
           + +DE+S  H  +         E  WL      NI + +LRL+G+ G  R+    +  K 
Sbjct: 122 E-IDENSQRHAETASGQALIEVEN-WLHALP--NISVDILRLAGLVGENRHAGRFLAGKK 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQ--NVIMEAASLMK 230
           SL+     Q  N +  +DV   ++ L+    GG I+NL    P  PQ  +   +A+  + 
Sbjct: 178 SLK--GATQPVNLVHQDDVIAAILLLLRQPKGGHIYNLC--APQHPQRADFYRQASQSLN 233

Query: 231 ITPPLEQCFDTA-NISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +  P E C + A N     +      +RI     + LGF+  YPN
Sbjct: 234 LEAP-EFCTEPAVNAGKIVK-----GERIC----QELGFEYQYPN 268


>gi|297620889|ref|YP_003709026.1| putative nucleoside-diphosphate-sugar epimerase [Waddlia
           chondrophila WSU 86-1044]
 gi|297376190|gb|ADI38020.1| putative nucleoside-diphosphate-sugar epimerase [Waddlia
           chondrophila WSU 86-1044]
          Length = 260

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 113/269 (42%), Gaps = 31/269 (11%)

Query: 1   MHLMIFGAGYTG-KFIADAALKVGVYTCGTTRS--VSNLLTLKHKGISPFLFAD-QKINN 56
           M+ +IFGAGY G   I +   K       TT+   V+ L  L  + +     +D +K+  
Sbjct: 1   MNGIIFGAGYVGCACIKEWPNKQDSLIATTTKEEKVAELRKLTPR-VEVVKGSDRKKVAE 59

Query: 57  LLREKLYFTTHIVQCIKP------------SSEGDPCIIS-MSKDFYKFMPHVKWIGYLS 103
           L++E  +     + C  P            ++EG    +S  S+ FY          Y S
Sbjct: 60  LIKEADF----AIICAAPNHWNQYTETYLETAEGITQALSDRSRSFYLL--------YTS 107

Query: 104 STSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR 163
           STS+ GN  G  +DE S +   S         E  +L     + + + +LRL GIYGP R
Sbjct: 108 STSVCGNHNGATIDESSPLLADSENGKILIATENCYLRAASPM-VSICILRLGGIYGPGR 166

Query: 164 NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIM 223
               + R+ +   +  ++   N   +  + + +I+ + H L GI++L +D       +  
Sbjct: 167 KIIDRARRFSGKTMTGRDSPTNHSSLPLITKGIIWSVHHRLTGIYHLVEDAHPTKNELYG 226

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFY 252
                +K+ PP+ +   T   +   R F+
Sbjct: 227 NLLETLKLPPPVWEQPHTGGAAVSNRKFF 255


>gi|134296662|ref|YP_001120397.1| NAD-dependent epimerase/dehydratase [Burkholderia vietnamiensis G4]
 gi|134139819|gb|ABO55562.1| NAD-dependent epimerase/dehydratase [Burkholderia vietnamiensis G4]
          Length = 345

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVVSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  L+  + V+ N I  +D+A     L    + G      + SDD  
Sbjct: 210 ANRLPLARL-ERGTPALLPADDVYTNHIHADDLA---AILRRAAVRGRPARAVHASDDSE 265

Query: 216 APPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A    + PP  + +      + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVAQAFGLPPPPRISRADAEGRLEPTLLSFMRESRRLSNARLKAELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|33597793|ref|NP_885436.1| hypothetical protein BPP3269 [Bordetella parapertussis 12822]
 gi|33574222|emb|CAE38554.1| conserved hypothetical protein [Bordetella parapertussis]
          Length = 294

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 79/184 (42%), Gaps = 16/184 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+++YG  +GQWVDEH+   P+         AE+   A       +  VLRL+G+YG
Sbjct: 105 FVSSSAVYGEHDGQWVDEHTPPGPLGFNGRSLLEAERSLDAWPG----QAVVLRLAGLYG 160

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS-DDEPAPP 218
           P R   + ++R   +   V      NRI ++D A  +  L+         L  DD P P 
Sbjct: 161 PGRLQLLERLRAGQARAPVDPPHWANRIHIDDAAAAIAHLLRLPAPEKLYLGCDDTPLPL 220

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRIS 278
             +    A+L                          +KR+ NA++++ G QL +P+ R  
Sbjct: 221 HELYAALATLAGAP----------PPGEGPAPAQVGSKRLCNARLRASGLQLQWPDSRAG 270

Query: 279 LKQL 282
              L
Sbjct: 271 YAAL 274


>gi|157737111|ref|YP_001489794.1| hypothetical protein Abu_0865 [Arcobacter butzleri RM4018]
 gi|157698965|gb|ABV67125.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 251

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 116/276 (42%), Gaps = 34/276 (12%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQK---INNL 57
           M L I GAG+ G F    +LK       ++R    L   + +G S ++  +Q    I  L
Sbjct: 1   MKLTILGAGWLG-FELAKSLKNEYKIVVSSRDEEKLKIYEDEGFSSYILNEQNFDYIEEL 59

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFY-KFMPHVKWIGYLSSTSIYGNREGQWV 116
           L     F         P S+ +  ++ + K +  K + ++K I ++SSTSIY N  G + 
Sbjct: 60  LNTDFLFINF------PPSKFENYLLFLEKIYSSKNISNIKKIIFISSTSIYPNINGIFT 113

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           +     +P S +    F AE     I ++ NI   + R+SG+ G  R  +   R  N   
Sbjct: 114 EISEINNPSSQIV---FEAEN---LIKERSNI---IFRVSGLVGDNR--YFGKRSANKEV 162

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
                 + N +  EDV R   F++ +++ GIFNL  +E    + +    A   +   P+ 
Sbjct: 163 EFPLTPI-NFVHREDVIRATKFVLENNISGIFNLCSNEHPTKKEIYSFNAKKYRFKMPIF 221

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
               T             N+ I  +KI+ LGF   Y
Sbjct: 222 NSNQT-----------FVNRIIDGSKIEKLGFVYKY 246


>gi|253688133|ref|YP_003017323.1| NAD-dependent epimerase/dehydratase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251754711|gb|ACT12787.1| NAD-dependent epimerase/dehydratase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 281

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 92/196 (46%), Gaps = 25/196 (12%)

Query: 82  IISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLA 141
           +++M++ F     HV  I + SSTS+YG+  G  V E S + P + VA +   + ++WL 
Sbjct: 96  LVNMARVF-----HVPRIIFTSSTSVYGDGSG-IVRETSPLQP-TTVAGKTLVSLEQWLQ 148

Query: 142 ITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT 201
                ++   +LRL+G+ G  R+P   +  K +L   + N   N +  EDV   ++ L+ 
Sbjct: 149 HLPDTSVD--ILRLAGLVGGDRHPGRFLAGKTNLP--RGNHGVNLVHQEDVLAAILLLLK 204

Query: 202 HHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISN 260
              GG I+NL   E    Q+   E A  + ++PP            F+    +D  RI +
Sbjct: 205 LPNGGHIYNLCAPEHPARQDFYPEQARRLHVSPPQ-----------FSPVPESDRGRIVD 253

Query: 261 AK--IKSLGFQLLYPN 274
            +     LGF   YPN
Sbjct: 254 GQRICHELGFDYQYPN 269


>gi|169794581|ref|YP_001712374.1| hypothetical protein ABAYE0395 [Acinetobacter baumannii AYE]
 gi|213158848|ref|YP_002320846.1| NAD dependent epimerase/dehydratase family [Acinetobacter baumannii
           AB0057]
 gi|215482170|ref|YP_002324352.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347850|ref|ZP_07228591.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii AB056]
 gi|301511998|ref|ZP_07237235.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii AB058]
 gi|301597380|ref|ZP_07242388.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii AB059]
 gi|332853126|ref|ZP_08434563.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6013150]
 gi|332868628|ref|ZP_08438284.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6013113]
 gi|169147508|emb|CAM85369.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|213058008|gb|ACJ42910.1| NAD dependent epimerase/dehydratase family [Acinetobacter baumannii
           AB0057]
 gi|213987114|gb|ACJ57413.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332728795|gb|EGJ60154.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6013150]
 gi|332733305|gb|EGJ64499.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6013113]
          Length = 271

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 85/185 (45%), Gaps = 30/185 (16%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK +  +SST +YG   G+ +D+HS +HP         N E  W    K    +  ++R 
Sbjct: 94  VKRLIVVSSTRVYGENSGETIDDHSEIHPNDAQGHILHNMELLW---QKYFPSQCVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVF------NRIRVEDVARCVIFLMT-HHLGGIF 208
           +GIYG   +     R K   R+ +  Q +      NRI ++D+AR ++FL         +
Sbjct: 151 TGIYGASID-----RLK---RMAEHTQTYPNIHYSNRIHIDDLARFLVFLADFEKPHKSY 202

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            ++++ P P   V++   S + +  PL    D+A++S          K+I    +   GF
Sbjct: 203 LVANNAPVPLHEVLLWFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGF 250

Query: 269 QLLYP 273
           QL +P
Sbjct: 251 QLEHP 255


>gi|83815054|ref|YP_446112.1| NAD-dependent epimerase/dehydratase family protein [Salinibacter
           ruber DSM 13855]
 gi|294508035|ref|YP_003572093.1| NAD dependent epimerase/dehydratase family [Salinibacter ruber M8]
 gi|83756448|gb|ABC44561.1| NAD dependent epimerase/dehydratase family [Salinibacter ruber DSM
           13855]
 gi|294344363|emb|CBH25141.1| NAD dependent epimerase/dehydratase family [Salinibacter ruber M8]
          Length = 283

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 114/289 (39%), Gaps = 35/289 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + I G G+ G+ +A   +   V   G+T +   +  L+  G+ P+L           E  
Sbjct: 6   VSILGCGWLGRPLAQHLVAQDVRVRGSTTTPEKVDALREDGVEPYLLTLTPELTGEDESA 65

Query: 63  YFTTHI-VQCIKPSSEGDPCIISMSKDF---YKFMPH--VKWIGYLSSTSIYGNREGQWV 116
           +F + I V  + PS   D       +      +   H  V+W+ + SST +Y   E    
Sbjct: 66  FFASPILVLNVPPSRTADDAKAHYRRQIDAVREAAAHGAVEWVLFASSTGVYPTVERTVT 125

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKL----NIKLAVLRLSGIYGPKRNP--FIKIR 170
           +          +   R +  +  LA  ++L    +    ++R  G+YG  R+P  F+  R
Sbjct: 126 EADQPPGRPDALPGTRRSTGRAVLAAEERLMRDSSFATTIVRFGGLYGGDRHPGRFLAGR 185

Query: 171 QKNSLRLVKKNQVFNRIRVEDVARCVIFLMT----HHLGGIFNLSDDEPAPPQNVIMEAA 226
                 + +     N I  +D   CV  L T    +  G +FN   D     Q +   AA
Sbjct: 186 SD----IGRPEAPVNLIHQDD---CVALLATLLDQNAQGEVFNACADAHPTRQALYTRAA 238

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
            ++ + PP    FD ++  P T       KR+ N K+K    +Q  +P+
Sbjct: 239 EVLGLEPP---TFDESD--PTT------GKRVDNQKVKDRCDYQFRHPD 276


>gi|78067290|ref|YP_370059.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. 383]
 gi|77968035|gb|ABB09415.1| NAD-dependent epimerase/dehydratase [Burkholderia sp. 383]
          Length = 345

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETHPLRPANPRAFRRVSAERQLRAATVRGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N I  +D+A  VI   T   G      + SDD   
Sbjct: 210 ANRLPIARL-ERGTPALEPADDVYTNHIHADDLA--VILRRTAERGKPARAVHASDDSEL 266

Query: 217 PPQNVIMEAASLMKI-TPPLEQCFDTA-NISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A ++ +  PP     D    + P    F  +++R+SNA++K+ L   L YP
Sbjct: 267 RMGEYFDRVAQVLGLPRPPRVSRADAERQLEPTLLSFMRESRRLSNARLKAELCVTLRYP 326

Query: 274 N 274
            
Sbjct: 327 T 327


>gi|90409226|ref|ZP_01217334.1| dTDP-glucose 4,6-dehydratase [Psychromonas sp. CNPT3]
 gi|90309663|gb|EAS37840.1| dTDP-glucose 4,6-dehydratase [Psychromonas sp. CNPT3]
          Length = 257

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 122/280 (43%), Gaps = 41/280 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + + G+G+ G  +A+  +  G    G+TRS +    L+ KG+  FL       ++ +EK 
Sbjct: 5   ISVLGSGWLGLPLAECLISRGYDVKGSTRSSARFDLLQQKGVPAFLL------DISQEKY 58

Query: 63  ----YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDE 118
               +F   I+    P  +G    ++++    K   ++K + ++S+TS+Y N+EG  V E
Sbjct: 59  DADEFFNADILIVNIP-YKGIEAFVTLTSAIQK--ANIKHVIFISATSVYANKEGM-VSE 114

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
           +  + P + V  +           T   +    ++R SG+ G  R+P +       ++  
Sbjct: 115 NDALVPCALVDIENL--------FTTNQSFDTTIIRFSGLLGYGRDPALFFTGDRCIK-- 164

Query: 179 KKNQVFNRIRVEDVARCVIFLM-THHLGGIFNLSDDEPAPPQNVIMEAASLMKITPP--L 235
                 N I  +D  + +  ++ ++  G I+N   D     +     AA  + +  P  L
Sbjct: 165 NPASSVNMIHRDDCIKIIYSVIESNAWGEIYNACSDTHPSRKLFYCAAAKTLAMPAPKFL 224

Query: 236 EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
           EQ   T N           +K ISN KIK  L ++ L+PN
Sbjct: 225 EQ---TDN----------HDKVISNQKIKVDLNYRFLHPN 251


>gi|123442980|ref|YP_001006955.1| hypothetical protein YE2764 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089941|emb|CAL12798.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 275

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 130/289 (44%), Gaps = 41/289 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A + ++ GV   G+  +   +  ++  GI       +P L  D   +
Sbjct: 4   VAIIGLGWLGMPLAQSLVRRGVQVVGSKTTPDGVEAVRMSGINCYQLQLTPELICDP--D 61

Query: 56  NLLREKLYFTTHIVQCIKPS--SEGDPC---IISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
           +L  E+L     +V  +  S  +EG       + M  D       V  I + SSTS+YG 
Sbjct: 62  DL--EQLMTVDALVITLPASRTAEGGEQYFQAVQMVVD-SALAFGVPRIIFTSSTSVYGE 118

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
             G+ + E S + P++     +  AE E WL   K  N  + +LRL+G+ G +R+P   +
Sbjct: 119 TRGR-IKESSPLQPVTTAG--KTLAELELWL--HKLPNTSVDILRLAGLVGAERHPGRFL 173

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPP--QNVIMEAA 226
             K +++    +Q  N +  EDV   +  L+    GG I+NL    PA P  ++   E A
Sbjct: 174 AGKTNVK--GGSQGVNLVHQEDVISAIELLLNLPRGGHIYNLC--APAHPRKRDFYPECA 229

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
             +++ PP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 230 RALQLPPPQ---FAPEDIEEAPR-------EIDGSKICSELGFEYQYPD 268


>gi|115352587|ref|YP_774426.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria AMMD]
 gi|115282575|gb|ABI88092.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria AMMD]
          Length = 345

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGALSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  L   + V+ N I  +D+A     L    + G      + SDD  
Sbjct: 210 ANRLPLARL-ERGTPALDAADDVYTNHIHADDLA---TILRRAAVRGKPARAVHASDDSE 265

Query: 216 APPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A +  + PP  + +      + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVARVFGLPPPPRISRADAEHQLEPTLLSFMRESRRLSNARLKTELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|292488690|ref|YP_003531577.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
 gi|292899846|ref|YP_003539215.1| NAD-dependent epimerase/dehydratase [Erwinia amylovora ATCC 49946]
 gi|291199694|emb|CBJ46814.1| putative NAD-dependent epimerase/dehydratase [Erwinia amylovora
           ATCC 49946]
 gi|291554124|emb|CBA21291.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
 gi|312172836|emb|CBX81092.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora ATCC BAA-2158]
          Length = 275

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 82/177 (46%), Gaps = 20/177 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIY 159
           + SSTS+YG R G    E + + P+S  A  R   E E WL      ++   +LRLSG+ 
Sbjct: 109 FTSSTSVYGERPGTTC-ESTPLAPVS--AAGRTLKELECWLHHLPGTSVD--ILRLSGLV 163

Query: 160 GPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPP 218
           GP+R+P   +  K +  L   +Q  N + ++DV   +  L+    GG I+NLS       
Sbjct: 164 GPERHPGRFLAGKTN--LANGSQGVNLVHLDDVIAAITLLLQAPEGGHIYNLSAPLHPAR 221

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
                + A+ + +TPP     D+ N            K I  +KI + LGF   +P+
Sbjct: 222 NQFYPQVANQLGLTPPTFLADDSQN----------QGKLIDGSKICRELGFAYRHPD 268


>gi|146296609|ref|YP_001180380.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410185|gb|ABP67189.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 305

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 101/234 (43%), Gaps = 29/234 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKIN--NL 57
           L+  GAG+ G  I D  ++     C     V NL     K I+P   F   D + N  ++
Sbjct: 4   LVTGGAGFIGSHIVDKLIEKNYDVC----VVDNLSAGNLKNINPKAKFYKLDIRDNLEDI 59

Query: 58  LRE-KLYFTTH-IVQCIKPSSEGDP---CIISM--SKDFYKFMP--HVKWIGYLSSTSIY 108
            +E K+ +  H   Q     S  DP   C +++  + +   F     +K   Y SS ++Y
Sbjct: 60  FKENKIEYCIHQAAQVSVTKSMEDPILDCSVNILGTLNLLSFCAKYEIKKFIYASSAAVY 119

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF-- 166
           G  +   +DE    +P+S     +  AEK      +    +  + R S +YGP+++PF  
Sbjct: 120 GEPQYLPIDESHPKNPMSFYGISKLTAEKYIERFAQSHGFEYVIFRYSNVYGPRQDPFGE 179

Query: 167 ---IKI---RQKNSLRLV---KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
              I I   R +N+  +      NQ  + I VEDVA      + + + G FNLS
Sbjct: 180 GGVISIFCERMQNNKDVTIFGDGNQTRDFIFVEDVAEANYLALQNPIKGTFNLS 233


>gi|312877249|ref|ZP_07737217.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795963|gb|EFR12324.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 305

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 96/242 (39%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----IVDNLLSGNVCNINPKAKFYQLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           EK++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EKVFEENKIEYCIHQAAQ-----VSVAKSMEDAYLDCSINVLGTVNLLDYCAKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  E   +DE+  + P S     +  +E+         N +  + R S +YG
Sbjct: 112 FASSAAVYGEPEYIPIDENHPLRPESFYGLSKLTSEEYIKMFAHNFNFEYIIFRCSNVYG 171

Query: 161 PKRNPF-----IKI------RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++PF     + I        KN +      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPFGEGGVVSIFCERMQSSKNVIIFGDGTQTRDFIYVEDVAEANCVALETSVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|170697676|ref|ZP_02888764.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria
           IOP40-10]
 gi|170137424|gb|EDT05664.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria
           IOP40-10]
          Length = 345

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGALSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  L   + V+ N I  +D+A     L    + G      + SDD  
Sbjct: 210 ANRLPLARL-ERGTPALDAADDVYTNHIHADDLA---TILRRAAVRGKPARAVHASDDSE 265

Query: 216 APPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A +  + PP  + +      + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVARVFGLPPPPRISRANAEHQLEPTLLSFMRESRRLSNARLKTELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|186475364|ref|YP_001856834.1| NAD-dependent epimerase/dehydratase [Burkholderia phymatum STM815]
 gi|184191823|gb|ACC69788.1| NAD-dependent epimerase/dehydratase [Burkholderia phymatum STM815]
          Length = 362

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 88/194 (45%), Gaps = 6/194 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G W+DE   V P +  A +R +AE++      +  +  ++ R+ GIY 
Sbjct: 164 YASTTGVYGDCNGAWLDETRPVAPANERAKRRVSAERQLRRAAARRVLTASIARIPGIYA 223

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  L+ ++ V+ N I  +D+A  ++ + TH     + + SDD     
Sbjct: 224 SNRLPLARL-EKRTPALIDEDDVYTNHIHADDLAAILLRMATHGRPSRVLHASDDTTLKM 282

Query: 219 QNVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPNY 275
                  A    +   P + +      +      F  +++R+ N ++K  L  QL YP+ 
Sbjct: 283 GEYFDRVADAFGVERAPRISRDEAEQQLGEMMLSFMRESRRLINTRLKRELQMQLRYPHV 342

Query: 276 RISLKQLWKEIENL 289
              L+      E L
Sbjct: 343 DDFLRTATARPETL 356


>gi|312793329|ref|YP_004026252.1| nad-dependent epimerase/dehydratase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180469|gb|ADQ40639.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 305

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 96/242 (39%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----IVDNLLSGNVCNINPKAKFYQLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           EK++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EKVFEENKIEYCIHQAAQ-----VSVAKSMEDAYLDCSINVLGTVNLLDYCAKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  E   +DE+  + P S     +  +E+         N +  + R S +YG
Sbjct: 112 FASSAAVYGEPEYIPIDENHPLRPESFYGLSKLTSEEYIKMFAHNFNFEYIIFRYSNVYG 171

Query: 161 PKRNPF-----IKI------RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++PF     + I        KN +      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPFGEGGVVSIFCERMQSSKNVIIFGDGTQTRDFIYVEDVAEANCVALETSVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|119503538|ref|ZP_01625621.1| ActC family protein [marine gamma proteobacterium HTCC2080]
 gi|119460600|gb|EAW41692.1| ActC family protein [marine gamma proteobacterium HTCC2080]
          Length = 293

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 81/189 (42%), Gaps = 27/189 (14%)

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
           +SST ++   +G WVDE S +     +A     AE+ +LA          VLR SGIYG 
Sbjct: 107 VSSTRVFAQADGGWVDESSPLSQSDPLAAPIIEAERRFLAACTGAT----VLRASGIYGD 162

Query: 162 KRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN-----LSDDEPA 216
                I+  QK  L      ++ NRI  ED+A  + F +     G  N      SD  P+
Sbjct: 163 WPGMLIQRLQKG-LCSPDPERISNRIHREDLAGIMAFCLRRLESGTTNDPVYIASDHLPS 221

Query: 217 PPQNV---IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
               +   ++   SL   T           ++P +R     N+R S+ +++  G++  YP
Sbjct: 222 RVGEIETWLINGLSLATKT----------GVAP-SRLA---NRRCSSQRLRDAGYRFRYP 267

Query: 274 NYRISLKQL 282
           +YR     L
Sbjct: 268 DYRAGFSAL 276


>gi|118595090|ref|ZP_01552437.1| ActC family protein [Methylophilales bacterium HTCC2181]
 gi|118440868|gb|EAV47495.1| ActC family protein [Methylophilales bacterium HTCC2181]
          Length = 267

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 94/202 (46%), Gaps = 25/202 (12%)

Query: 81  CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWL 140
           C+ S+S+      P +K + ++SST +YG R  Q + E +   P     +     E    
Sbjct: 76  CLRSVSR----HCPSLKHVFFVSSTRVYGQRNQQVMSESTLPEPHDFGGSALLEGE---- 127

Query: 141 AITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM 200
            +  K ++   VLRLSGIYG +R   +++ +  + R  + N+  NRI  +D    + FL+
Sbjct: 128 TLVNKSSVPSTVLRLSGIYGDQRTYLLRMAEDET-RWPENNRWTNRIHEDDAVGFISFLI 186

Query: 201 THHLGG-----IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADN 255
              + G     ++ ++D+  A    ++ +  + ++    L+     +++ PF      + 
Sbjct: 187 HQLISGLPVESLYLVTDNSSA----LLFDVLNHIREAQGLDMIIRKSSL-PF------EG 235

Query: 256 KRISNAKIKSLGFQLLYPNYRI 277
           K++ +  I    F   YP+Y+I
Sbjct: 236 KKLQSEIIPKTDFIYRYPDYKI 257


>gi|296120666|ref|YP_003628444.1| NAD-dependent epimerase/dehydratase [Planctomyces limnophilus DSM
           3776]
 gi|296013006|gb|ADG66245.1| NAD-dependent epimerase/dehydratase [Planctomyces limnophilus DSM
           3776]
          Length = 290

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 117/288 (40%), Gaps = 19/288 (6%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           + ++IFG GY G  +A   +  G+     TRS      LK + I P L       +L  E
Sbjct: 7   VDVLIFGCGYVGLQVACQFVSAGLSCAAVTRSQEKAAFLKSQSIEPVLAEITTAQSL--E 64

Query: 61  KLYFTTHIVQCI-----KPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
            L     I+  +       +S+ +  +  +        P  + +  +SSTS++G  +G+W
Sbjct: 65  VLPAAKRILWAVGYDRNSTASKREVYVDGLRNALIATAPAAESVVSISSTSVWGFDDGRW 124

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ-KNS 174
           VDE + V P +        A  E +  T     K  +LRL+GIYGP R    K+   K+ 
Sbjct: 125 VDETTPVSPTT--EGGEICATAEEVVRTHCPAGKSTILRLAGIYGPGRL-LAKVEALKHQ 181

Query: 175 LRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITP 233
             +    + + N I   D A     L+      +    D EP    +   E A  +   P
Sbjct: 182 QPIAGSGEAWLNLIHQADAAALAYRLLCEGGPEVVVGVDREPVRRIDYYSELARRIGSAP 241

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQ 281
           P+   FD A++    R     NKR+ +       F+  Y +YR  L Q
Sbjct: 242 PV---FDEASLP--KRGSGGLNKRVRSQFPDQ--FEFRYESYRSGLAQ 282


>gi|326564359|gb|EGE14587.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis 12P80B1]
 gi|326569893|gb|EGE19943.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis BC8]
          Length = 282

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 119/291 (40%), Gaps = 42/291 (14%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-FADQKINNLLREKL 62
           ++ G G  GK      L + +    T ++V+  L  ++  ++ ++ F  +    L  + +
Sbjct: 5   LMIGQGNIGK-----PLAIRLAKAHTVKTVARRLH-EYGTLAKYIHFLQKDAKTLTLDDV 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--------------KWIGYLSSTSIY 108
             TTH+   I PS+ G    +   K +     H+              K + ++SSTS+Y
Sbjct: 59  KDTTHLAIIITPSNIGRASTLDYQKSYLAVCQHIVGLANQSCEWQQKLKQVLFVSSTSVY 118

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEK-EWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           G  +G+W+DE +   PI+  A    +AE   W    K    +  ++R  GIY       I
Sbjct: 119 GQNQGEWIDETAPALPITDTAQILKDAEDLLWQTFGK----RAIIVRAGGIYHKNSIRLI 174

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           +  ++  L  + ++   NRI   D+  C+   L++     ++  +D+ P     V+   A
Sbjct: 175 EQARQAHLVGIPRHHYTNRIMDSDLVNCLYQILVSDCPKSLYLATDNTPVTSFEVLEYIA 234

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
             +   P +   FD            +  + I+N     L     YPNY+I
Sbjct: 235 KSLNY-PSVTPIFDPP----------SGKRIIANINTNWLS----YPNYQI 270


>gi|33593391|ref|NP_881035.1| hypothetical protein BP2404 [Bordetella pertussis Tohama I]
 gi|33572747|emb|CAE42675.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382800|gb|AEE67647.1| hypothetical protein BPTD_2361 [Bordetella pertussis CS]
          Length = 294

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 84/183 (45%), Gaps = 14/183 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+++YG  +GQWVDEH+   P+         AE+   A       +  VLRL+G+YG
Sbjct: 105 FVSSSAVYGEHDGQWVDEHTPPGPLGFNGRSLLEAERSLDAWPG----QAVVLRLAGLYG 160

Query: 161 PKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQ 219
           P R   + ++R   +   V      NRI ++D A  +  L+         L  D+   P 
Sbjct: 161 PGRLQLLERLRAGQARAPVDPPHWANRIHIDDAAAAIAHLLRLPAPEKLYLGCDDTTLPL 220

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISL 279
           + +  A + +   PP  +    A +          +KR+ NA++++ G QL +P+ R   
Sbjct: 221 HELYAALATLAGAPPPGEGPAPAQVG---------SKRLCNARLRASGLQLQWPDSRAGY 271

Query: 280 KQL 282
             L
Sbjct: 272 AAL 274


>gi|22126497|ref|NP_669920.1| hypothetical protein y2617 [Yersinia pestis KIM 10]
 gi|45441265|ref|NP_992804.1| hypothetical protein YP_1440 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595900|ref|YP_070091.1| hypothetical protein YPTB1563 [Yersinia pseudotuberculosis IP
           32953]
 gi|108806843|ref|YP_650759.1| hypothetical protein YPA_0846 [Yersinia pestis Antiqua]
 gi|108812590|ref|YP_648357.1| hypothetical protein YPN_2429 [Yersinia pestis Nepal516]
 gi|145598710|ref|YP_001162786.1| hypothetical protein YPDSF_1426 [Yersinia pestis Pestoides F]
 gi|149366472|ref|ZP_01888506.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|153948850|ref|YP_001401395.1| NAD dependent epimerase/dehydratase family protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419913|ref|YP_001607442.1| hypothetical protein YpAngola_A3076 [Yersinia pestis Angola]
 gi|165924680|ref|ZP_02220512.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165939566|ref|ZP_02228111.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166009164|ref|ZP_02230062.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211811|ref|ZP_02237846.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167400152|ref|ZP_02305665.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421875|ref|ZP_02313628.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423947|ref|ZP_02315700.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167469415|ref|ZP_02334119.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           FV-1]
 gi|170024749|ref|YP_001721254.1| NAD-dependent epimerase/dehydratase [Yersinia pseudotuberculosis
           YPIII]
 gi|186894986|ref|YP_001872098.1| NAD-dependent epimerase/dehydratase [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928692|ref|YP_002346567.1| hypothetical protein YPO1551 [Yersinia pestis CO92]
 gi|229841533|ref|ZP_04461692.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843644|ref|ZP_04463787.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229894254|ref|ZP_04509437.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis Pestoides A]
 gi|229902984|ref|ZP_04518100.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis Nepal516]
 gi|270486769|ref|ZP_06203843.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           KIM D27]
 gi|294503525|ref|YP_003567587.1| hypothetical protein YPZ3_1415 [Yersinia pestis Z176003]
 gi|21959493|gb|AAM86171.1|AE013863_5 putative enzyme of sugar metabolism [Yersinia pestis KIM 10]
 gi|45436125|gb|AAS61681.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589182|emb|CAH20802.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|108776238|gb|ABG18757.1| hypothetical protein YPN_2429 [Yersinia pestis Nepal516]
 gi|108778756|gb|ABG12814.1| hypothetical protein YPA_0846 [Yersinia pestis Antiqua]
 gi|115347303|emb|CAL20197.1| putative exported protein [Yersinia pestis CO92]
 gi|145210406|gb|ABP39813.1| hypothetical protein YPDSF_1426 [Yersinia pestis Pestoides F]
 gi|149290846|gb|EDM40921.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|152960345|gb|ABS47806.1| NAD dependent epimerase/dehydratase family protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352728|gb|ABX86676.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           Angola]
 gi|165912482|gb|EDR31114.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923740|gb|EDR40872.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165991719|gb|EDR44020.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207582|gb|EDR52062.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960360|gb|EDR56381.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050101|gb|EDR61509.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167056796|gb|EDR66559.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169751283|gb|ACA68801.1| NAD-dependent epimerase/dehydratase [Yersinia pseudotuberculosis
           YPIII]
 gi|186698012|gb|ACC88641.1| NAD-dependent epimerase/dehydratase [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679894|gb|EEO75994.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis Nepal516]
 gi|229689252|gb|EEO81315.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697899|gb|EEO87946.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229703652|gb|EEO90668.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis Pestoides A]
 gi|262361568|gb|ACY58289.1| hypothetical protein YPD4_1381 [Yersinia pestis D106004]
 gi|262365692|gb|ACY62249.1| hypothetical protein YPD8_1566 [Yersinia pestis D182038]
 gi|270335273|gb|EFA46050.1| NAD dependent epimerase/dehydratase family protein [Yersinia pestis
           KIM D27]
 gi|294353984|gb|ADE64325.1| hypothetical protein YPZ3_1415 [Yersinia pestis Z176003]
 gi|320015581|gb|ADV99152.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 275

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 18/181 (9%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V  I + SSTS+YG   G+ + E S + P++ VA +   A ++WL      ++   +LRL
Sbjct: 104 VPRIIFTSSTSVYGETRGR-IKESSPLQPVT-VAGKTLMALEQWLHQLPHTSVD--ILRL 159

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDE 214
           +G+ G  R+P   +  K  ++    +Q  N +  EDV   +  L+    GG ++NL    
Sbjct: 160 AGLVGTDRHPGRFLAGKTGVK--GGSQGVNLVHQEDVIAAIELLLNRPKGGHLYNLCAPI 217

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
               ++     A  +++TPP E   +              N+ I  +KI S LGF+ LYP
Sbjct: 218 HPRKRDFYPACARALQLTPP-EFAVEEQE---------GANREIDGSKICSELGFEYLYP 267

Query: 274 N 274
           +
Sbjct: 268 D 268


>gi|326801495|ref|YP_004319314.1| epimerase [Sphingobacterium sp. 21]
 gi|326552259|gb|ADZ80644.1| epimerase [Sphingobacterium sp. 21]
          Length = 269

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 113/282 (40%), Gaps = 35/282 (12%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-----ADQKINNLL 58
           +I G G+ G   A   L +      TT S   +  L+ +GISP L       D +   ++
Sbjct: 8   LIIGCGWVGFRFAQKLLTLNFEVTATTTSEHKINALEAEGISPLLLDFNFETDSETVAVI 67

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--KWIGYLSSTSIYGNREGQWV 116
               Y    +    K       C++   +   KF+  +  K I YLSS  IY +     +
Sbjct: 68  SSLHYDLVLVSVPAKKREHQQTCLMKFER-LAKFLQKIQAKSIIYLSSVGIYPSAP-YLI 125

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
           +E +   P S +  + F  E+       KLNI    LRL GI+G  R P     +  S +
Sbjct: 126 NETNI--PNSSLDPKLFQTEQTLAMRVNKLNI----LRLGGIFGDNRIP----GKHFSAK 175

Query: 177 LVK-KNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           + +  NQ  N I ++D+   +I  M H    G +FN         + + ++ A      P
Sbjct: 176 VCEVGNQFANYIHLDDIM-AIILCMCHQRIEGQLFNAVSPLHPSKKEITLQMAEKYGFAP 234

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAK-IKSLGFQLLYPN 274
           P          S F    + D K IS AK I  L +Q +Y N
Sbjct: 235 P----------SSFENVSF-DKKVISPAKLISDLNYQFIYEN 265


>gi|302872024|ref|YP_003840660.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574883|gb|ADL42674.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 305

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 99/242 (40%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----IVDNLLSGNAHNINPKAKFYKLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           E+++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EQVFEKNKIEYCIHQAAQ-----VSVAKSMEDVWLDCSINVLGTVNLLEYCVKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  +   +DE+  + P S     +  +E+         N +  + R S +YG
Sbjct: 112 FASSAAVYGEPKYIPIDENHPLRPESFYGLSKLTSEEYVRMFAHNFNFEYVIFRYSNVYG 171

Query: 161 PKRNPF-----IKI---RQKNSLRLV---KKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++PF     + I   R +N+  +V      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPFGEGGVVSIFCKRMQNNKDVVIFGDGTQTRDFIYVEDVAEANCIALESSVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|260557014|ref|ZP_05829231.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           ATCC 19606]
 gi|260409620|gb|EEX02921.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           ATCC 19606]
          Length = 271

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 30/185 (16%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK +  +SST +YG   G+ +D+HS +HP         N E  W    K    +  ++R 
Sbjct: 94  VKRLIVVSSTRVYGENSGEAIDDHSEIHPNDAQGHILHNMELLW---QKYFPSQCVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVF------NRIRVEDVARCVIFLMT-HHLGGIF 208
           +GIYG   +     R K   R+ +  Q +      NRI ++D+AR + FL         +
Sbjct: 151 TGIYGASID-----RLK---RMAEHTQTYPNIHYSNRIHIDDLARFLAFLADFEKPHKSY 202

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            ++++ P P   V++   S + +  PL    D+A++S          K+I    +   GF
Sbjct: 203 LVANNAPVPLHEVLLWFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGF 250

Query: 269 QLLYP 273
           QL +P
Sbjct: 251 QLEHP 255


>gi|184159611|ref|YP_001847950.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           ACICU]
 gi|332876096|ref|ZP_08443880.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6014059]
 gi|183211205|gb|ACC58603.1| Nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           ACICU]
 gi|322509521|gb|ADX04975.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           1656-2]
 gi|323519541|gb|ADX93922.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735714|gb|EGJ66757.1| NAD dependent epimerase/dehydratase family protein [Acinetobacter
           baumannii 6014059]
          Length = 271

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 30/185 (16%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK +  +SST +YG   G+ +D+HS +HP         N E  W    K    +  ++R 
Sbjct: 94  VKRLIVVSSTRVYGENSGETIDDHSEIHPNDAQGHILHNMELLW---QKYFPSQCVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVF------NRIRVEDVARCVIFLMT-HHLGGIF 208
           +GIYG   +     R K   R+ +  Q +      NRI ++D+AR + FL         +
Sbjct: 151 TGIYGASID-----RLK---RMAEHTQTYPNIHYSNRIHIDDLARFLAFLADFEKPHKSY 202

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            ++++ P P   V++   S + +  PL    D+A++S          K+I    +   GF
Sbjct: 203 LVANNAPVPLHEVLLWFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGF 250

Query: 269 QLLYP 273
           QL +P
Sbjct: 251 QLEHP 255


>gi|332142779|ref|YP_004428517.1| hypothetical enzyme of sugar metabolism [Alteromonas macleodii str.
           'Deep ecotype']
 gi|332142798|ref|YP_004428536.1| hypothetical enzyme of sugar metabolism [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552801|gb|AEA99519.1| hypothetical enzyme of sugar metabolism [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552820|gb|AEA99538.1| hypothetical enzyme of sugar metabolism [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 270

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 107/247 (43%), Gaps = 28/247 (11%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           ++L+I G G+   ++ +A L       GT+RS      L+ +GI    +A       L  
Sbjct: 3   LNLVITGYGWLAGYVGEA-LNDDFNIVGTSRSRDKCHALQAQGIEALEYALGDNTKPLER 61

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH-----VKWIGYLSSTSIYGNREGQW 115
            L   T ++    P       + + +K     +       V  I ++S+TS+YG+   + 
Sbjct: 62  YLPNATLLLNV--PPGRRSTNLDAFTKHMLSLIDSAIRAGVGHIVFISTTSVYGDNTDET 119

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           +   +  +P +  A      E+  L++ +++N+  +++RL+G+ GP R+P    R  +  
Sbjct: 120 LTAQAPTNPQTASAKAHVAIEQYLLSLREQINV--SIVRLAGLVGPDRHP---ARSLSGR 174

Query: 176 RLVKKNQVFNRIRVEDVA-------RCVIFLMTHHLGGIFNLSDDEPAPPQNV-IMEAAS 227
           +L   N+  N + V D+        RC     T HL  + +       P + +  +EAA 
Sbjct: 175 QLEAGNKRINLVHVFDIVKALGEIIRCTPLNDTIHLCSLSH-------PKRGLYYVEAAK 227

Query: 228 LMKITPP 234
            M I PP
Sbjct: 228 AMGIEPP 234


>gi|239503247|ref|ZP_04662557.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter baumannii
           AB900]
          Length = 271

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 30/185 (16%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK +  +SST +YG   G+ +D+HS +HP         N E  W    K    +  ++R 
Sbjct: 94  VKRLIVVSSTRVYGENSGETIDDHSEIHPNDAQGHILHNMELLW---QKYFPSQCVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVF------NRIRVEDVARCVIFLMT-HHLGGIF 208
           +GIYG   +     R K   R+ +  Q +      NRI ++D+AR + FL         +
Sbjct: 151 TGIYGASID-----RLK---RMAEHTQTYPNIHYSNRIHIDDLARFLAFLADFEKPHKSY 202

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
            ++++ P P   V++   S + +  PL    D+A++S          K+I    +   GF
Sbjct: 203 LVANNAPVPLHEVLLWFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGF 250

Query: 269 QLLYP 273
           QL +P
Sbjct: 251 QLEHP 255


>gi|326566783|gb|EGE16922.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis 103P14B1]
 gi|326575218|gb|EGE25146.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis CO72]
 gi|326576696|gb|EGE26603.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis 101P30B1]
 gi|326577630|gb|EGE27507.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis O35E]
          Length = 282

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 121/292 (41%), Gaps = 44/292 (15%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-FADQKINNLLREKL 62
           ++ G G  GK      L + +    T ++V+  L  ++  ++ ++ F  +    L  + +
Sbjct: 5   LMIGQGNIGK-----PLAIRLAKAHTVKTVARRLH-EYGTLAKYIHFLQKDAKTLTLDDV 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--------------KWIGYLSSTSIY 108
             TTH+   I PS+ G    +   K +     H+              K + ++SSTS+Y
Sbjct: 59  KDTTHLAIIITPSNIGRASALDYQKSYLAVCQHIVDLANQSCEWQQKLKQVLFVSSTSVY 118

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEK-EWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           G  +G+W+DE +   PI+  A    +AE   W    K    +  ++R  GIY       I
Sbjct: 119 GQNQGEWIDETAPALPITDTAQILKDAEDLLWQTFGK----RAIIVRAGGIYHKNSIRLI 174

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           +  ++  L  + ++   NRI   D+  C+   L++     ++  +D+ P     V+   A
Sbjct: 175 EQARQAHLVGIPRHHYTNRIMDSDLVNCLYQILVSDCPKSLYLATDNTPVTSFEVLEYIA 234

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL-YPNYRI 277
             +   P +   FD  +            KRI    I ++    L YPNY+I
Sbjct: 235 KSLNY-PSVTPIFDPPS-----------GKRI----IANINTNWLSYPNYQI 270


>gi|238793482|ref|ZP_04637107.1| hypothetical protein yinte0001_23890 [Yersinia intermedia ATCC
           29909]
 gi|238727255|gb|EEQ18784.1| hypothetical protein yinte0001_23890 [Yersinia intermedia ATCC
           29909]
          Length = 291

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 117/284 (41%), Gaps = 35/284 (12%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF--------LFADQKINN 56
           I G G+ G  +A + ++ GV   G+  +   +   +  GI  F        + +   +  
Sbjct: 22  IIGLGWLGMPLAQSLIRRGVQVVGSKTTPDGVEAARMSGIDCFQLQLTPQLICSPDDLEQ 81

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCI--ISMSKD--FYKFMPHVKWIGYLSSTSIYGNRE 112
           L+       T  +   + +  GD  +  + M  D      MP +    + SSTS+YG   
Sbjct: 82  LMTADALVIT--LPASRTAERGDQYLQAVQMVVDSALAFGMPRII---FTSSTSVYGETR 136

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           G+ + E S + P++         E   L + K  N  + +LRL+G+ G  R+P   +  K
Sbjct: 137 GR-IKESSPLQPVTTAGKTLMELE---LWLHKLPNTSVDILRLAGLVGTDRHPGRFLAGK 192

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKI 231
             ++    +   N +  EDV   +  L+    GG I+NL        ++   E A  +++
Sbjct: 193 TGVK--GGSLGVNLVHQEDVISAIELLLNLPRGGHIYNLCASHHPAKRDFYPECARALQL 250

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           TPP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 251 TPPE---FAPEDIEEAPR-------EIDGSKICSELGFEYQYPD 284


>gi|170733850|ref|YP_001765797.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia
           MC0-3]
 gi|169817092|gb|ACA91675.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia
           MC0-3]
          Length = 345

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 84/179 (46%), Gaps = 6/179 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+ +G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCDGARIDETHPLRPANPRAFRRVSAERQLRAATVRGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ ++ +  L   + V+ N I  +D+A  +     H     + + SDD     
Sbjct: 210 ANRLPVARL-ERGTPALEPADDVYTNHIHADDLAAILRRAAEHGKPARVVHASDDTELRM 268

Query: 219 QNVIMEAASLMKIT-PPLEQCFDTAN-ISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
                  A ++ +  PP     D    + P    F  +++R+SN ++K+ L   L YP 
Sbjct: 269 GEYFDRVAQVLGLPRPPRVSRADAERLLEPTLLSFMRESRRLSNTRLKAELCVTLRYPT 327


>gi|159042036|ref|YP_001541288.1| NAD-dependent epimerase/dehydratase [Caldivirga maquilingensis
           IC-167]
 gi|157920871|gb|ABW02298.1| NAD-dependent epimerase/dehydratase [Caldivirga maquilingensis
           IC-167]
          Length = 322

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 93/199 (46%), Gaps = 30/199 (15%)

Query: 103 SSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPK 162
           SS S+YG + G  VDE +  +P++  A     AE+E L +          LR S +YGP 
Sbjct: 116 SSASVYGRQSGT-VDETATPNPLTVYAKANLQAEREVLPLNGN-GFTSTALRFSTVYGPS 173

Query: 163 RNPFIKIRQKNSLRL---------VKKNQVFNR--IRVEDVARCVIFLMT---HHLGG-I 207
           R   + +   N++ L         V+ + +  R  + V DVAR V F++      +GG +
Sbjct: 174 RRMRLDL-VVNAMTLSAFNEGKIWVEGDGMQERPLVHVVDVARAVAFILETPPEEIGGQV 232

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
           FN+  D+    QN       +++I   ++Q   T     F       + R+S AKI+ LG
Sbjct: 233 FNVGSDD----QNY-----KIIEIAKEVQQV--TGAEIKFRGEVDRRSYRLSFAKIRKLG 281

Query: 268 FQLLYPNYRISLKQLWKEI 286
           F  +Y   R  ++Q++ E+
Sbjct: 282 FNTVY-QVRDGVRQVYHEL 299


>gi|281421529|ref|ZP_06252528.1| NAD dependent epimerase/reductase-related protein [Prevotella copri
           DSM 18205]
 gi|281404601|gb|EFB35281.1| NAD dependent epimerase/reductase-related protein [Prevotella copri
           DSM 18205]
          Length = 331

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 34/240 (14%)

Query: 1   MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M +++ GA G+ G +I + AL+ G+ T    R  S+   L+ + I    F +  +++   
Sbjct: 1   MKILVTGASGFIGSYIVEEALRQGMETWAAVRPTSSRKYLQDERIH---FINLNLSSEEE 57

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKF----------------MPHVKWIGYLS 103
            +     H    I  ++    C+   ++DFYK                 MP  +++ ++S
Sbjct: 58  LEKELAPHEFDYIVHAAGATKCL--HAEDFYKVNTEGTKHLVNVLLRLQMPIRRFV-FVS 114

Query: 104 STSIYGN-REGQ---WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIY 159
           S SI+G  RE Q    + EH    P +     +  AE+   +I    N    +LR +G+Y
Sbjct: 115 SLSIFGAIREEQPYQEISEHDTPKPNTAYGKSKLEAERYLDSIGN--NFPYIILRPTGVY 172

Query: 160 GPKRNPFI----KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDE 214
           GP+   +      I+Q     +  K Q    + V+DV + V   + H + G  + LSD E
Sbjct: 173 GPREKDYFLMAQSIKQHVDFAVGFKRQDITFVYVQDVVQAVFLALDHGMNGRKYFLSDGE 232


>gi|171316752|ref|ZP_02905964.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria MEX-5]
 gi|171098102|gb|EDT42917.1| NAD-dependent epimerase/dehydratase [Burkholderia ambifaria MEX-5]
          Length = 345

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE     P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETRPPRPANPRAFRRVSAERQLRAATVRGALSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  L   + V+ N I  +D+A     L    + G      + SDD  
Sbjct: 210 ANRLPLARL-ERGTPALDAADDVYTNHIHADDLA---TILRRAAVRGKPARAVHASDDSE 265

Query: 216 APPQNVIMEAASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A +  + PP  + +      + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVARVFGLPPPPRISRANAEHQLEPTLLSFMRESRRLSNARLKTELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|312134989|ref|YP_004002327.1| nad-dependent epimerase/dehydratase [Caldicellulosiruptor
           owensensis OL]
 gi|311775040|gb|ADQ04527.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           owensensis OL]
          Length = 305

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 101/242 (41%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     + NL++   + I+P   F   D + NNL  
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----IIDNLISGNVRNINPKAKFYKLDIR-NNL-- 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           E+++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EEVFEKNEIEYCIHQAAQ-----VSVAKSMEDVYLDCSINVLGTVNLLEYCVKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  +   +DE+  + P S     +  +E+         N    + R S +YG
Sbjct: 112 FASSAAVYGEPKYIPIDENHPLRPESFYGLSKLTSEEYIRMFAHNFNFGYVIFRYSNVYG 171

Query: 161 PKRNPF-----IKI---RQKNSLRLV---KKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++PF     + I   R +N+  ++      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPFGEGGVVSIFCDRMQNNKDVIIFGDGTQTRDFIYVEDVAEANCIALESFVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|317048769|ref|YP_004116417.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Pantoea sp.
           At-9b]
 gi|316950386|gb|ADU69861.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Pantoea sp.
           At-9b]
          Length = 275

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V  I + SSTS+YG   G  + EHS +HP   VA +   A + WL      ++   ++RL
Sbjct: 104 VPRIIFTSSTSVYGPGPGV-MKEHSPLHP-ETVAGKTLVALENWLHDLPGTSVD--IVRL 159

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL 210
           +G+ GP R+P   +  K  LR      V N + ++DV   ++ L+    GG ++NL
Sbjct: 160 AGLVGPNRHPGRFLAGKTDLR--DGAHVVNLVHLDDVVDAIVLLLQTPKGGRVYNL 213


>gi|157145037|ref|YP_001452356.1| hypothetical protein CKO_00768 [Citrobacter koseri ATCC BAA-895]
 gi|157082242|gb|ABV11920.1| hypothetical protein CKO_00768 [Citrobacter koseri ATCC BAA-895]
          Length = 274

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 88/186 (47%), Gaps = 27/186 (14%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE-KEWLAITKKLNIKLAVL 153
           HV  I + SSTS+YG+  G  V E++  +P++  A+ R   E ++WL      ++   +L
Sbjct: 103 HVPRIIFTSSTSVYGDVHG-IVKENTPRNPVT--ASGRILKELEDWLHNLPGTSVD--IL 157

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSD 212
           RLSG+ GP R+P      K +       Q  N + +EDV   +  L+    GG I+N+  
Sbjct: 158 RLSGLVGPGRHPGRFFAGKTA---PDGQQGVNLVHLEDVIAAITLLLQAPKGGHIYNICA 214

Query: 213 DEPAPPQNVIM-EAASLMKITPP--LE-QCFDTANISPFTRFFYADNKRISNAKIKSLGF 268
               P +NV   + A L+ + PP  LE Q  D   I         D  RI N     LGF
Sbjct: 215 PS-HPARNVFYPQMARLLGMEPPHFLESQSNDKGKI--------IDGSRICN----ELGF 261

Query: 269 QLLYPN 274
           +  YP+
Sbjct: 262 EYQYPD 267


>gi|299065971|emb|CBJ37152.1| putative epimerase [Ralstonia solanacearum CMR15]
          Length = 313

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 85/196 (43%), Gaps = 40/196 (20%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVAT--QRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +   T          W  +      + ++LR+ GI
Sbjct: 127 YASTSGVYGDCGGAWVDETRPVRPATPRGTRRVAAERRVRWFGVGG--GWRTSILRIPGI 184

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH------- 202
           Y   R P  ++ Q+ +  L +++ VF N I  +D+AR +I  +         H       
Sbjct: 185 YAGDRLPEARL-QRGTPALQREDDVFTNHIHADDLARALIAALFRGRPQRVVHVSDATEL 243

Query: 203 HLGGIFNLSDDE---PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRIS 259
            +G  F+   D    P PP+  I  A ++ ++ P L               F ++++R+ 
Sbjct: 244 RMGDYFDAVADARGLPRPPR--IARAEAVRQLEPALLS-------------FMSESRRLR 288

Query: 260 NAKI-KSLGFQLLYPN 274
           + ++ + LG  L YP 
Sbjct: 289 SVRLARELGLALRYPT 304


>gi|121606093|ref|YP_983422.1| NAD-dependent epimerase/dehydratase [Polaromonas naphthalenivorans
           CJ2]
 gi|120595062|gb|ABM38501.1| NAD-dependent epimerase/dehydratase [Polaromonas naphthalenivorans
           CJ2]
          Length = 310

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 119/286 (41%), Gaps = 17/286 (5%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            ++I G G  G  +A   L   +     T S   L  L+   I+P L  +      LR  
Sbjct: 19  RVLIVGCGDVGLRVA-RQLPPRLKVIALTSSAERLPALRRDRITPLL-GNLDDAATLRRL 76

Query: 62  LYFTTHIVQCIKPSS-----EGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
               T +V    P S       DP  +++ +           + Y S++ +YG+  G+ V
Sbjct: 77  AGLATRVVHLAPPPSHDPNWRDDPRTLALLRALRLRSLPQSLV-YGSTSGVYGDCGGERV 135

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR---NPFIKIRQKN 173
           DE   + P +  + +R +AE +     +     + VLR+ GIY   R    P  ++ +  
Sbjct: 136 DETWRLSPNTPRSQRRVHAEGQVRLFGRASATPVHVLRIPGIYATDREGGTPRARLLRGT 195

Query: 174 SLRLVKKNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
            + L +++ V+ + I  +D+AR C+  L       I N+ DD      +    AA L  +
Sbjct: 196 PV-LRREDDVYTSHIHADDLARACLAALWRGKPQRISNVCDDTQLLMGDYFDLAADLYHL 254

Query: 232 TPPLEQCFDTANIS-PFTRF-FYADNKRISNAKI-KSLGFQLLYPN 274
             P      TAN   P     F ++++R+ N ++ K LG  L YP 
Sbjct: 255 PRPPRVGRSTANEQLPLMLLSFMSESRRLDNQRMKKELGLALRYPT 300


>gi|238761106|ref|ZP_04622083.1| hypothetical protein ykris0001_34520 [Yersinia kristensenii ATCC
           33638]
 gi|238761359|ref|ZP_04622335.1| hypothetical protein ykris0001_20930 [Yersinia kristensenii ATCC
           33638]
 gi|238700333|gb|EEP93074.1| hypothetical protein ykris0001_20930 [Yersinia kristensenii ATCC
           33638]
 gi|238700586|gb|EEP93326.1| hypothetical protein ykris0001_34520 [Yersinia kristensenii ATCC
           33638]
          Length = 275

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 123/284 (43%), Gaps = 31/284 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKI 54
           + I G G+ G  +A + ++ G+   G+  +   +   +  GI       +P L  D   +
Sbjct: 4   IAIIGLGWLGMPLAQSLVRRGIEVVGSKTTPDGVEAARMSGINCFQLQLTPELLCDPDDL 63

Query: 55  NNLLR-EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREG 113
             L+  + L  T    +     ++    +  +      F   V  I + SSTS+YG   G
Sbjct: 64  AQLMTVDALVITLPASRTTGGGAQYFQAVQMVVDSALAF--GVPRIIFTSSTSVYGETRG 121

Query: 114 QWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           + + E S + P++     +  AE E WL   K  N  + +LRL+G+ G +R+P   +  K
Sbjct: 122 R-IKESSPLQPVTTAG--KTLAELELWLH--KLPNTSVDILRLAGLVGAERHPGRFLAGK 176

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKI 231
             ++    +Q  N +  EDV   +  L+    GG I+NL        ++   E A  +++
Sbjct: 177 TDVK--GGSQGVNLVHQEDVISAIELLLNLPRGGHIYNLCAPIHPRKRDFYPECARALEL 234

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           TPP    F + +I    R        I  +KI S LGF+  YP+
Sbjct: 235 TPPE---FASEDIEEPIR-------EIDGSKICSELGFEYQYPD 268


>gi|257084754|ref|ZP_05579115.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis Fly1]
 gi|256992784|gb|EEU80086.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis Fly1]
          Length = 319

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANEEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L++H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LDLVSHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|325286427|ref|YP_004262217.1| NAD-dependent epimerase/dehydratase [Cellulophaga lytica DSM 7489]
 gi|324321881|gb|ADY29346.1| NAD-dependent epimerase/dehydratase [Cellulophaga lytica DSM 7489]
          Length = 267

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + +FG G+ G  +A    K G    G+T +   L  L+ + I+ FL  D   N+   +  
Sbjct: 5   IAVFGCGWLGLPLATTLQKQGYKINGSTTTKDKLTLLEQQSINSFL-VDLNDNDFTTQLD 63

Query: 63  YFTTHI---VQCIKPSSE-GD-PCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQW 115
            F +++   +  I P  + GD    ++  K  +K   + +VK + ++SSTS+YG+  G+ 
Sbjct: 64  AFLSNVDVLIINIPPRMKTGDTSSYLTKMKLVHKHSKLANVKKVIFVSSTSVYGDLNGE- 122

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           + E +   P++  A Q    E+ +L  T    +K A++R  G+ G  R+P          
Sbjct: 123 ITEKTTPKPLTSAAKQLVAIEQLFLNDT---GLKTAIIRFGGLIGNGRHPI--------F 171

Query: 176 RLVKKNQVFNR---IRVEDVARCV 196
            L KK++V N    I + D+  C+
Sbjct: 172 HLAKKDEVNNGNYPINLIDITDCI 195


>gi|300871909|ref|YP_003786782.1| ADP-L-glycero-D-mannoheptose 6-epimerase [Brachyspira pilosicoli
           95/1000]
 gi|300689610|gb|ADK32281.1| ADP-L-glycero-D-mannoheptose 6-epimerase [Brachyspira pilosicoli
           95/1000]
          Length = 315

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 133/323 (41%), Gaps = 51/323 (15%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M ++  GAG+ G  I      +G+       ++ N    KHK ++  +F D         
Sbjct: 1   MIIVTGGAGFIGSNIVRGLNNLGISDILIVDNLKN--ASKHKNLNRVVFGDYIDKEDFDV 58

Query: 61  KLYFTTHIVQCI------KPSSEGDPCIISMSKDFYKFMPH---------VKWIGYLSST 105
             +   + V  I        + E D     M K+ Y++  H         V++  Y SS 
Sbjct: 59  YSFVENNKVDAIFHQGACSDTMETDGKY--MMKNNYEYSQHILHACLENKVRFF-YASSA 115

Query: 106 SIYGNREGQWVDEHSFVHPISCVATQRFNAEK--EWLAITKKLNIKLAVLRLSGIYGPKR 163
           S+YGN E  +V++    +P++  A  ++  ++    L   KK+N ++  LR   +YGP+ 
Sbjct: 116 SVYGNGENGFVEDEKNEYPLNVYAFSKYQFDRYVNILFRNKKINSQVVGLRYFNVYGPQE 175

Query: 164 NP-----------FIKIRQKNSLRLVKKNQVFNR--IRVEDVARC-VIFLMTHHLGGIFN 209
           N            F +I+    +++ + ++ F R  I V+DV      F    ++ GIFN
Sbjct: 176 NHKGRMASVAFHLFNQIKAGEKMKIFEGSENFLRDFIHVDDVVSVNNFFFENENISGIFN 235

Query: 210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANIS--PFTRFFYADNKRISNA---KIK 264
                         +A S ++I   L++ + ++ I   PF        ++ + A    +K
Sbjct: 236 CG----------TGKAESFVEIAKALKEMYSSSEIEYIPFPDALKGKYQKYTQADLTNLK 285

Query: 265 SLGFQLLYPNYRISLKQLWKEIE 287
            +G+   + N    +K+  K +E
Sbjct: 286 KVGYTKEFMNVNTGVKKYAKVLE 308


>gi|297182585|gb|ADI18744.1| nucleoside-diphosphate-sugar epimerases [uncultured gamma
           proteobacterium HF4000_36I10]
          Length = 277

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 108/284 (38%), Gaps = 29/284 (10%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           M+ G G  G  +    L  G    G  R+V+ L     KG  P     +  N+L   +  
Sbjct: 1   MLIGCGQLGCALGSDFLSRGWRVVGARRNVARL----PKGFEPLALDFRDTNSLTALREI 56

Query: 64  FTTHIVQCIKPSSEGDPCIISM-SKDFYKFMPHV-----KWIGYLSSTSIYGNREGQWVD 117
              ++V  + P    +    ++  + F   + ++     + + + SSTS+Y   +G  VD
Sbjct: 57  KADYVVVTLTPGERSEQAYRAVFEQGFADLLKNLNVDRMQRLLFASSTSVYHQNDGSVVD 116

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S   P S        AE     +  +  +   ++R  GIYG +     +  ++     
Sbjct: 117 ETSPTQPDSFSGRSVLAAEN----LLYQSALPATIVRFGGIYGGESLRLAERVRRGQCAP 172

Query: 178 VKKNQVFNRIRVEDVARCVIFLMT-----HHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
           +      NRI  +D    +  L+        L   +   D++PAP   V    A+ + + 
Sbjct: 173 LSPEHFSNRIHRDDCVAVLRHLIDCVESGAALSDCYLAVDNDPAPIAEVHQWLAAQLGVP 232

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
              +  +             A +KR  N +++  GF+  YP+YR
Sbjct: 233 YQCDAGYR----------HMAGSKRGDNRRLRETGFEFRYPDYR 266


>gi|304316399|ref|YP_003851544.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777901|gb|ADL68460.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 319

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 99/237 (41%), Gaps = 34/237 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  +  G         V N+ T K + I+    F   D   N+L +
Sbjct: 4   LVTGGAGFIGSNIVDLLIDNGYDVI----VVDNMSTGKKENINKKARFYNVDITDNDLYK 59

Query: 60  ----EKL-YFTTHIVQCIKPSSEGDPCI---------ISMSKDFYKFMPHVKWIGYLSST 105
               EK+ Y   H  Q     S  DP           I++ +   KF   VK I Y SS 
Sbjct: 60  VFEDEKIDYVIHHAAQIDIQRSINDPVFDAKVNIIGTINLLECCRKF--DVKKIVYASSA 117

Query: 106 SIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP 165
           ++YG+ E   VDE   V+PIS     +   E       +   +K  +LR + +YG +++P
Sbjct: 118 AVYGDPEYLGVDEKHRVNPISYYGISKHTPEHYIKVYNELYGLKYTILRYANVYGIRQDP 177

Query: 166 ---------FIK--IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
                    FI   +  KN +     NQ  + I V+DVA+  +  + +    I N+S
Sbjct: 178 KGEGGVISIFIDKMLSGKNPVIFGDGNQTRDFIYVKDVAKANLLALENGDNEIINIS 234


>gi|254251644|ref|ZP_04944962.1| Nucleoside-diphosphate-sugar epimerase [Burkholderia dolosa AUO158]
 gi|124894253|gb|EAY68133.1| Nucleoside-diphosphate-sugar epimerase [Burkholderia dolosa AUO158]
          Length = 345

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETHPLQPANPRAFRRVSAERQLRAATARGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N I  +D+A   I       G    + + SDD   
Sbjct: 210 ENRLPLARL-ERGTPALDAADDVYTNHIHADDLA--AILRRVAQRGRPARVVHASDDSEL 266

Query: 217 PPQNVIMEAASLMKI-TPPLEQCFDTA-NISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A    + TPP     D    + P    F  +++R+SNA++K  L   L YP
Sbjct: 267 RMGEYFDRVAHAFGLPTPPRVSRADAERQLEPTLLSFMRESRRLSNARLKDELCVTLRYP 326

Query: 274 N 274
            
Sbjct: 327 T 327


>gi|326560990|gb|EGE11355.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis 7169]
 gi|326563769|gb|EGE14020.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis 46P47B1]
 gi|326567374|gb|EGE17489.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis BC1]
 gi|326571499|gb|EGE21514.1| putative nucleoside-diphosphate-sugar epimerase [Moraxella
           catarrhalis BC7]
          Length = 282

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 119/291 (40%), Gaps = 42/291 (14%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-FADQKINNLLREKL 62
           ++ G G  GK      L + +    T ++V+  L  ++  ++ ++ F  +    L  + +
Sbjct: 5   LMIGQGNIGK-----PLAIRLAKAHTVKTVARRLH-EYGTLAKYIHFLQKDAKTLTLDDV 58

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV--------------KWIGYLSSTSIY 108
             TTH+   I PS+ G    +   K +     H+              K + ++SSTS+Y
Sbjct: 59  KDTTHLAIIITPSNIGRASALDYQKSYLAVCQHIVGLANQSCEWQQKLKQVLFVSSTSVY 118

Query: 109 GNREGQWVDEHSFVHPISCVATQRFNAEK-EWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           G  +G+W+DE +   PI+  A    +AE   W    K    +  ++R  GIY       I
Sbjct: 119 GQNQGEWIDETAPALPITDTAQILKDAEDLLWQTFGK----RAIIVRAGGIYHKNSIRLI 174

Query: 168 KIRQKNSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
           +  ++  L  + ++   NRI   D+  C+   L++     ++  +D+ P     V+   A
Sbjct: 175 EQARQAHLVGIPRHYYTNRIMDSDLVNCLYQILVSDCPKSLYLATDNTPVTSFEVLEYIA 234

Query: 227 SLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
             +   P +   FD            +  + I+N     L     YPNY+I
Sbjct: 235 KSLNY-PSVTPIFDPP----------SGKRIIANINTNWLS----YPNYQI 270


>gi|312795322|ref|YP_004028244.1| Nucleoside-diphosphate-sugar epimerases [Burkholderia rhizoxinica
           HKI 454]
 gi|312167097|emb|CBW74100.1| Nucleoside-diphosphate-sugar epimerases [Burkholderia rhizoxinica
           HKI 454]
          Length = 382

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 46/73 (63%)

Query: 99  IGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           I Y+S+T +YG+ +G  VDE   V P++  A +R +AE++      +  +++++LR+ GI
Sbjct: 186 IVYMSTTGVYGDCDGALVDETRPVRPVNARAVRRASAERQLRRAGSRGVVRVSILRVPGI 245

Query: 159 YGPKRNPFIKIRQ 171
           Y  +R P  ++R+
Sbjct: 246 YALERLPVERLRR 258


>gi|169632338|ref|YP_001706074.1| hypothetical protein ABSDF0403 [Acinetobacter baumannii SDF]
 gi|169151130|emb|CAO99796.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 271

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK +  +SST +YG   G+ +D+HS +HP         N E  W    K    +  ++R 
Sbjct: 94  VKRLIVVSSTRVYGENSGETIDDHSEIHPNDAQGHILHNMELLW---QKYFPSQCVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT-HHLGGIFNLSDDE 214
           +GIYG   +   ++ +    +        NRI ++D+AR + FL         + ++++ 
Sbjct: 151 TGIYGASIDCLKRMAEHT--QTYPNIHYSNRIHIDDLARFLAFLADFEKPHKSYLVANNA 208

Query: 215 PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
           P P   V++   S + +  PL    D+A++S          K+I    +   GFQL +P
Sbjct: 209 PVPLHEVLLWFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGFQLEHP 255


>gi|229008630|ref|ZP_04166042.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus mycoides Rock1-4]
 gi|228752635|gb|EEM02251.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus mycoides Rock1-4]
          Length = 304

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 109/258 (42%), Gaps = 36/258 (13%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP-------FLFADQKIN 55
           L+  GAG+ G  I +  L+  +     T  V NL+T  HK   P       F   D  I+
Sbjct: 4   LVTGGAGFIGSHIVEFLLENNI----DTVVVDNLVT-GHKYNIPSKVAFYHFDIRDPNID 58

Query: 56  NL-LREKLYFTTH----------IVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSS 104
            + + EK  F  H          + Q     SE     +++ +   K+  +VK I Y S+
Sbjct: 59  KIFMVEKPDFVIHQAAQVSVQESVKQPFYDCSENVMATVNILQACIKY--NVKKIIYAST 116

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
            ++YGN +   +DE+  ++P+S     +  +E       K   +K  +LR S +YG ++N
Sbjct: 117 AAVYGNPQYLPIDENHDLNPVSFYGLSKLTSEAYIQLFAKLYGLKYTILRYSNVYGARQN 176

Query: 165 P---------FIKIRQKNSLRLV--KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDD 213
           P         F+    KN   +V    NQ  + I V+DVA        +    I N+S +
Sbjct: 177 PDGEAGVISIFMDRLFKNDSPIVYGDGNQTRDFIFVKDVAHANFLAFRNADNQICNISSN 236

Query: 214 EPAPPQNVIMEAASLMKI 231
           +      ++    +LMKI
Sbjct: 237 QQISVNELLDTICNLMKI 254


>gi|315167523|gb|EFU11540.1| NAD-binding domain 4 [Enterococcus faecalis TX1341]
          Length = 322

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|257079479|ref|ZP_05573840.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis JH1]
 gi|294780381|ref|ZP_06745750.1| NAD-binding protein [Enterococcus faecalis PC1.1]
 gi|307270207|ref|ZP_07551520.1| NAD-binding domain 4 [Enterococcus faecalis TX4248]
 gi|307287359|ref|ZP_07567420.1| NAD-binding domain 4 [Enterococcus faecalis TX0109]
 gi|256987509|gb|EEU74811.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis JH1]
 gi|294452645|gb|EFG21078.1| NAD-binding protein [Enterococcus faecalis PC1.1]
 gi|306501600|gb|EFM70895.1| NAD-binding domain 4 [Enterococcus faecalis TX0109]
 gi|306513423|gb|EFM82042.1| NAD-binding domain 4 [Enterococcus faecalis TX4248]
 gi|315146213|gb|EFT90229.1| NAD-binding domain 4 [Enterococcus faecalis TX4244]
 gi|315164694|gb|EFU08711.1| NAD-binding domain 4 [Enterococcus faecalis TX1302]
          Length = 316

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|255975365|ref|ZP_05425951.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T2]
 gi|307277769|ref|ZP_07558855.1| NAD-binding domain 4 [Enterococcus faecalis TX0860]
 gi|255968237|gb|EET98859.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T2]
 gi|306505648|gb|EFM74832.1| NAD-binding domain 4 [Enterococcus faecalis TX0860]
          Length = 316

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|229549557|ref|ZP_04438282.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis ATCC 29200]
 gi|255972255|ref|ZP_05422841.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T1]
 gi|256956554|ref|ZP_05560725.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis DS5]
 gi|312951159|ref|ZP_07770062.1| NAD-binding domain 4 [Enterococcus faecalis TX0102]
 gi|229305222|gb|EEN71218.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis ATCC 29200]
 gi|255963273|gb|EET95749.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T1]
 gi|256947050|gb|EEU63682.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis DS5]
 gi|310630824|gb|EFQ14107.1| NAD-binding domain 4 [Enterococcus faecalis TX0102]
 gi|315034732|gb|EFT46664.1| NAD-binding domain 4 [Enterococcus faecalis TX0027]
 gi|315152645|gb|EFT96661.1| NAD-binding domain 4 [Enterococcus faecalis TX0031]
 gi|315159508|gb|EFU03525.1| NAD-binding domain 4 [Enterococcus faecalis TX0312]
 gi|327535560|gb|AEA94394.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis OG1RF]
          Length = 316

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|315143372|gb|EFT87388.1| NAD-binding domain 4 [Enterococcus faecalis TX2141]
          Length = 316

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|257082139|ref|ZP_05576500.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis E1Sol]
 gi|256990169|gb|EEU77471.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis E1Sol]
          Length = 319

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|315171585|gb|EFU15602.1| NAD-binding domain 4 [Enterococcus faecalis TX1342]
          Length = 319

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|257422118|ref|ZP_05599108.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis X98]
 gi|257163942|gb|EEU93902.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis X98]
          Length = 319

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|315636793|ref|ZP_07892019.1| GDP-L-fucose synthase [Arcobacter butzleri JV22]
 gi|315478919|gb|EFU69626.1| GDP-L-fucose synthase [Arcobacter butzleri JV22]
          Length = 251

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 96/216 (44%), Gaps = 19/216 (8%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M L I GAG+ G F    +LK       ++R    L   + +G S ++  +Q  + +  E
Sbjct: 1   MKLTILGAGWLG-FELAKSLKNEYKIVVSSRDEEKLKIYEDEGFSSYILNEQNFDYI--E 57

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDE 118
           +L  T  +     PS   +   +S  +  Y  K + ++K I ++SSTSIY N  G + + 
Sbjct: 58  ELINTDFLFINFPPSKFEN--YLSFLEKIYSSKNISNIKKIIFISSTSIYPNINGVFTEI 115

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLV 178
               +P S +  +  N  KE   I         + R+SG+ G  R  +   R  N     
Sbjct: 116 SEINNPSSQIVFEAENLIKERSDI---------IFRVSGLVGDNR--YFGKRSANKEVEF 164

Query: 179 KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDE 214
               + N +  EDV R   F++ +++ GIFNL  +E
Sbjct: 165 PLTPI-NFVHREDVIRATKFVLENNISGIFNLCSNE 199


>gi|315157152|gb|EFU01169.1| NAD-binding domain 4 [Enterococcus faecalis TX0043]
          Length = 323

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 112 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 171

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 172 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 231

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 232 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 276


>gi|315149292|gb|EFT93308.1| NAD-binding domain 4 [Enterococcus faecalis TX0012]
          Length = 319

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|300860675|ref|ZP_07106762.1| NAD-binding protein [Enterococcus faecalis TUSoD Ef11]
 gi|300849714|gb|EFK77464.1| NAD-binding protein [Enterococcus faecalis TUSoD Ef11]
          Length = 316

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|311693198|gb|ADP96071.1| NAD-dependent epimerase/dehydratase [marine bacterium HP15]
          Length = 288

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
           WVDE S   P      Q    E+  L       I    +R SGIYGP R  F++  Q+  
Sbjct: 125 WVDESSPTEPARFSGEQVLAGEQTALESGHPATI----IRYSGIYGPSRRRFLEEVQEGR 180

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-----IFNLSDDEPAPPQNVIMEAASLM 229
           +   K     NRI  ED A     L+   L G      +  SD EP            L 
Sbjct: 181 MNPAKPAPFSNRIHEEDAAEAAAHLVKLALSGASLETCYLASDCEP----------VRLD 230

Query: 230 KITPPLEQCFDTANISPFTR-FFYADNKRISNAKIKSLGFQLLYPNYRISLKQL 282
           ++   + Q    A+  P  R    A +KR SN ++   GFQ  YP++R   + +
Sbjct: 231 EVVDWVRQQTPCADPQPDARKGGRAGSKRCSNKRLLGTGFQFRYPDFRAGYRAM 284


>gi|229545315|ref|ZP_04434040.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis TX1322]
 gi|229309522|gb|EEN75509.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis TX1322]
          Length = 324

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 116 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 175

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 176 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 235

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 236 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 280


>gi|206561037|ref|YP_002231802.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           cenocepacia J2315]
 gi|198037079|emb|CAR53000.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           cenocepacia J2315]
          Length = 345

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 12/182 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG----IFNLSDDEP 215
             R P  ++ ++ +  L   + V+ N I  +D+A     L    + G    + + SDD  
Sbjct: 210 ANRLPVARL-ERGTPALEPADDVYTNHIHADDLA---AILRRAAVRGKPARVVHASDDTE 265

Query: 216 APPQNVIMEAASLMKIT-PPLEQCFDTAN-ISPFTRFFYADNKRISNAKIKS-LGFQLLY 272
                     A ++ +  PP     D    + P    F  +++R+SNA++K+ L   L Y
Sbjct: 266 LRMGEYFDRVAQVLGLPRPPRVSRADAERLLEPTLLSFMRESRRLSNARLKAELCVTLRY 325

Query: 273 PN 274
           P 
Sbjct: 326 PT 327


>gi|315161355|gb|EFU05372.1| NAD-binding domain 4 [Enterococcus faecalis TX0645]
          Length = 316

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|312902879|ref|ZP_07762083.1| NAD-binding domain 4 [Enterococcus faecalis TX0635]
 gi|310633933|gb|EFQ17216.1| NAD-binding domain 4 [Enterococcus faecalis TX0635]
 gi|315578207|gb|EFU90398.1| NAD-binding domain 4 [Enterococcus faecalis TX0630]
          Length = 322

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FN----------RIRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|257090435|ref|ZP_05584796.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis CH188]
 gi|256999247|gb|EEU85767.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis CH188]
          Length = 319

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|269139616|ref|YP_003296317.1| NAD-dependent epimerase/dehydratase [Edwardsiella tarda EIB202]
 gi|267985277|gb|ACY85106.1| NAD-dependent epimerase/dehydratase [Edwardsiella tarda EIB202]
 gi|304559492|gb|ADM42156.1| Nucleoside-diphosphate-sugar epimerase [Edwardsiella tarda FL6-60]
          Length = 275

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 124/290 (42%), Gaps = 37/290 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS--PFLFADQ-KINNLLR 59
           + I G G+ G  +A + +  G    G+  +   +   +  G++  P   A Q + ++   
Sbjct: 4   VAIVGLGWLGMPLALSLMARGYRVVGSKTTPDGVEAAQMSGVACYPLRLAPQLECDDEDL 63

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH-----VKWIGYLSSTSIYGNREGQ 114
            +L     +V  + P+S G+   I   +   + +       V  I +LSSTS+YG+  G+
Sbjct: 64  AQLLSVDALVITL-PASCGNDEGIGYRQSVRQLVDSALAYGVARIIFLSSTSVYGDARGE 122

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V+E S + P + +A Q     + WL      N  + VLRL+G+ G  R+P   +  K  
Sbjct: 123 -VNEDSPLQP-NTLAGQALADLERWLHDLP--NTSVDVLRLAGLVGEGRHPGRFLAGKTD 178

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL-SDDEPA-----PPQNVIMEAAS 227
           L     N   N +  ED    ++ L+    GG ++NL +   PA     PP       A 
Sbjct: 179 LP--GGNLGVNLLHREDAIAAIMLLLAQPQGGHVYNLCAPQHPARRLFYPP------LAR 230

Query: 228 LMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRI 277
            + +TPP  +  D A     T+    D  RIS+     LGF   Y +  I
Sbjct: 231 ALGLTPPAFRSDDDA-----TQGKAVDGSRISH----ELGFVYRYSDPTI 271


>gi|312900810|ref|ZP_07760104.1| NAD-binding domain 4 [Enterococcus faecalis TX0470]
 gi|311291909|gb|EFQ70465.1| NAD-binding domain 4 [Enterococcus faecalis TX0470]
          Length = 325

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 112 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 171

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I      RL+   +V FN           + VEDV 
Sbjct: 172 SAVRFFNVYGPNQNPNSPYSGVISIVMDKKKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 231

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 232 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 276


>gi|323481236|gb|ADX80675.1| NAD dependent epimerase/dehydratase family protein [Enterococcus
           faecalis 62]
          Length = 324

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 116 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 175

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 176 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 235

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 236 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 280


>gi|256752410|ref|ZP_05493269.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256748679|gb|EEU61724.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 316

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 104/251 (41%), Gaps = 40/251 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLL- 58
           L+  GAG+ G  IAD  ++ G         V NL T KH+ I+    F   D   N+L  
Sbjct: 4   LITGGAGFIGSNIADLLIENGYEVV----IVDNLSTGKHEFINKKAVFYNKDITDNDLYE 59

Query: 59  ---REKLYFTTHIVQCI-------------KPSSEGDPCIISMSKDFYKFMPHVKWIGYL 102
              +EK  +  H    I             K +  G   ++  SK +      VK I Y 
Sbjct: 60  VFEKEKPDYVIHQAAQIDIQKSIKEPVFDAKVNILGTVNLLECSKSY-----KVKKIIYA 114

Query: 103 SSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPK 162
           SS ++YG+ E   +DE   V PIS     +   E  +    +   +K  +LR + +YG +
Sbjct: 115 SSAAVYGDPEYLAIDEKHKVDPISYYGISKHTPEHYFEVYRQLYGLKYTILRYANVYGIR 174

Query: 163 RNP---------FIK--IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
           ++P         F+   ++ +  +     NQ  + + V+DVA+  +  +      I N+S
Sbjct: 175 QDPKGEGGVISIFVDKILKDERPIIFGDGNQTRDFVYVKDVAKANLLALEKGDNEIVNIS 234

Query: 212 DDEPAPPQNVI 222
            ++P     +I
Sbjct: 235 TNKPTSINELI 245


>gi|256853617|ref|ZP_05558982.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T8]
 gi|256710560|gb|EEU25603.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T8]
          Length = 321

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|315025851|gb|EFT37783.1| NAD-binding domain 4 [Enterococcus faecalis TX2137]
          Length = 325

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 112 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 171

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 172 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 231

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 232 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 276


>gi|257416481|ref|ZP_05593475.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis AR01/DG]
 gi|257419723|ref|ZP_05596717.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T11]
 gi|257158309|gb|EEU88269.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis ARO1/DG]
 gi|257161551|gb|EEU91511.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T11]
          Length = 321

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|307295622|ref|ZP_07575457.1| NAD-binding domain 4 [Enterococcus faecalis TX0411]
 gi|306496334|gb|EFM65911.1| NAD-binding domain 4 [Enterococcus faecalis TX0411]
 gi|315028622|gb|EFT40554.1| NAD-binding domain 4 [Enterococcus faecalis TX4000]
          Length = 324

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|257087302|ref|ZP_05581663.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis D6]
 gi|256995332|gb|EEU82634.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis D6]
          Length = 321

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|315174076|gb|EFU18093.1| NAD-binding domain 4 [Enterococcus faecalis TX1346]
          Length = 324

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|256762972|ref|ZP_05503552.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T3]
 gi|256684223|gb|EEU23918.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis T3]
          Length = 321

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 272


>gi|29376673|ref|NP_815827.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis V583]
 gi|227520221|ref|ZP_03950270.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis TX0104]
 gi|227555344|ref|ZP_03985391.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis HH22]
 gi|29344137|gb|AAO81897.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis V583]
 gi|227072300|gb|EEI10263.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis TX0104]
 gi|227175555|gb|EEI56527.1| possible UDP-glucose 4-epimerase [Enterococcus faecalis HH22]
 gi|315575155|gb|EFU87346.1| NAD-binding domain 4 [Enterococcus faecalis TX0309B]
 gi|315582582|gb|EFU94773.1| NAD-binding domain 4 [Enterococcus faecalis TX0309A]
          Length = 324

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+T P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPVE 275


>gi|110636630|ref|YP_676837.1| nucleoside-diphosphate-sugar epimerases [Cytophaga hutchinsonii
           ATCC 33406]
 gi|110279311|gb|ABG57497.1| nucleoside-diphosphate-sugar epimerases [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 279

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 121/290 (41%), Gaps = 44/290 (15%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-AD------QKIN 55
           + I G G+ G  +A+A ++ G    G+T     L  ++  G   ++  AD      +++N
Sbjct: 7   ISILGCGWLGLPLAEAFIQSGFRVKGSTTREERLSVIEAAGAEGYVLKADGGAWTGERLN 66

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPC------IISMSKDFYKFMPHVKWIGYLSSTSIYG 109
           + LR  +     ++  I P ++ +        I  +     K+   +K + Y+SSTS+Y 
Sbjct: 67  DFLRCDI-----LLIAIPPGTKRNANSTHAVEIGQLMDHIKKYSIAIKQLIYISSTSVYK 121

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKE--WLAITKKLNIKLAVLRLSGIYGPKR--NP 165
           N     ++  + + P +      F AEK      I +KL     +LRL G+ G  R    
Sbjct: 122 NINSVVIESDTAI-PSNIGNQILFQAEKHVHESVIERKL-----ILRLGGLTGYDRMLGR 175

Query: 166 FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQNVIME 224
           F   +Q+    L   N+  N +  +DV  C++FL+ + +G  +FN+   +    +     
Sbjct: 176 FFAGKQE----LAGGNEPVNLVHRDDVVACILFLLKNGIGEQVFNICSPQHPSRKEFYTR 231

Query: 225 AASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
                 +  P            F+     D K +S  K+   G++ ++P+
Sbjct: 232 LCDRFNLPEP-----------HFSEILKTDWKEVSTEKMNQFGYKWIFPD 270


>gi|312622609|ref|YP_004024222.1| nad-dependent epimerase/dehydratase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203076|gb|ADQ46403.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 305

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 97/242 (40%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----VVDNLLSGNVCNINPKSKFYQLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           EK++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EKVFEENKIEYCIHQAAQ-----VSVAKSMEDSYLDCSINILGTVNLLDYCVKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  +   +DE+  + P S     +  +E+       K + +  + R S +YG
Sbjct: 112 FASSAAVYGEPKYIPIDENHPLRPESFYGLSKLTSEEYIKMFAHKFHFEYIIFRYSNVYG 171

Query: 161 PKRNPFIK-----------IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++PF +           +  K+ +      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPFGEGGVVSIFCERMLGSKDVIIYGDGTQTRDFIYVEDVAEANCIALESSVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|163856096|ref|YP_001630394.1| hypothetical protein Bpet1786 [Bordetella petrii DSM 12804]
 gi|163259824|emb|CAP42125.1| Conserved hypothetical protein [Bordetella petrii]
          Length = 276

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 80/178 (44%), Gaps = 16/178 (8%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+++YGN +G WVDE +   P         + E  WLA     ++    LRL+G+YG
Sbjct: 105 FVSSSAVYGNHDGGWVDETTPPAPAGFNGRVLLDTEN-WLAAQALPSVS---LRLAGLYG 160

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPP 218
           P R   I+  +  + R  +    + NRI ++D A     L+       ++   DD P P 
Sbjct: 161 PGRLQLIERLRAGAARAPRHPPHWANRIHIDDAAAAAAHLLALPHPETVYIGCDDTPLPL 220

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            ++    A L                +P        +K++SNA++++ G  L +P+ R
Sbjct: 221 YDLYAHLARLAGAP----------EPAPGPAPAAVGSKKLSNARLRASGLVLQWPDAR 268


>gi|225011280|ref|ZP_03701737.1| putative enzyme of sugar metabolism YeeZ precursor [Flavobacteria
           bacterium MS024-3C]
 gi|225004590|gb|EEG42555.1| putative enzyme of sugar metabolism YeeZ precursor [Flavobacteria
           bacterium MS024-3C]
          Length = 269

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 85/202 (42%), Gaps = 12/202 (5%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF--ADQKINNLLRE 60
           L I G G+ G  +A   ++      GT RS+  +  L+  GI PF F      +++   +
Sbjct: 11  LGIIGCGWLGSAVAQYFIQYNWLVKGTRRSLEKMGGLETLGIKPFKFELGAAALSHDFTK 70

Query: 61  KLYFTTHIVQCIKPSSEGDPCII---SMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVD 117
            L      V     + E D  I    S+SKD  K +P    + Y SST +Y N  G +  
Sbjct: 71  NLDLLLISVPPQLRTGENDAFIDHMKSLSKDLLKVLPKNCQVIYTSSTGVYPNSGGPY-S 129

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S     +  A +   AEK    I   L  K   +RL+G+ G  R P   +  + ++  
Sbjct: 130 ELSQWTADTDRAQKLLAAEK----IIATLPHKKTTIRLAGLVGADREPTRSLSGRTAIS- 184

Query: 178 VKKNQVFNRIRVEDVARCVIFL 199
              N+  N I  +D  + + FL
Sbjct: 185 -GGNKAANLIHQQDAVKLIWFL 205


>gi|225376928|ref|ZP_03754149.1| hypothetical protein ROSEINA2194_02570 [Roseburia inulinivorans DSM
           16841]
 gi|225211249|gb|EEG93603.1| hypothetical protein ROSEINA2194_02570 [Roseburia inulinivorans DSM
           16841]
          Length = 302

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 25/242 (10%)

Query: 3   LMIFGAGYTGKFIADAALK--VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           L+I GAG+ G  ++   +K  + VY    ++ V  +  + +  I    F D  + + L E
Sbjct: 6   LVIGGAGFIGSNLSRHLIKNDMEVYCFDMSKPVHEIAGVNY--ICGDFFDDYTLEHAL-E 62

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG-------YLSST-SIYGNRE 112
            + +  H +  + P +  +  +    +DF +     K I        +LSS  ++YGN+E
Sbjct: 63  GMDYVVHALSTVNPGNSNEKYLQGYERDFIQTTKLCKMITDQKIRMIFLSSGGTVYGNQE 122

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN-----PFI 167
            Q + E +   PI+     +   E        + + K+ + R+S  YGP ++      FI
Sbjct: 123 IQPIVEDALPRPINHYGNVKLCIENTIRTFNYQAHTKILIARISNPYGPGQDFNKGVGFI 182

Query: 168 KIRQKNSLRLVK------KNQVFNRIRVEDVARCVIFLMTHHLG-GIFNLSDDEPAPPQN 220
               K ++R  K       N V + I ++DV R +I L  +      FN+S +     ++
Sbjct: 183 DAAIKKTIRGEKIEIWGDGNNVRDYIYIDDVCRMLISLFNYQGNYDTFNISSNTGTSQRD 242

Query: 221 VI 222
           +I
Sbjct: 243 II 244


>gi|218549429|ref|YP_002383220.1| epimerase [Escherichia fergusonii ATCC 35469]
 gi|218356970|emb|CAQ89602.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia fergusonii ATCC 35469]
          Length = 274

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YG+ +G  V E +  +P++  + Q     ++WL      ++   +LR
Sbjct: 103 HIPRIIFTSSTSVYGDAQGA-VKETTPRNPVTN-SGQVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+   
Sbjct: 159 LAGLVGPERHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC-- 213

Query: 214 EPA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+ 
Sbjct: 214 APAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEY 263

Query: 271 LYPN 274
            YP+
Sbjct: 264 QYPD 267


>gi|330895688|gb|EGH27980.1| hypothetical protein PSYJA_02744 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 126

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 17/135 (12%)

Query: 154 RLSGIYGPKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS- 211
           RL+GIYGP R+    ++RQ +S+R +      NRI  +D A  +  ++     G+   S 
Sbjct: 1   RLTGIYGPGRSDLSNRVRQGHSVR-IDPPVYANRIHADDAAGLLEHVLLADQRGVALESC 59

Query: 212 ----DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLG 267
               DD+PA   +V+      + +T   E+                 +KR SNA+ ++LG
Sbjct: 60  YLGVDDDPAALADVVAWIREYLGVTEWSEE----------VSVQRVGSKRCSNARARALG 109

Query: 268 FQLLYPNYRISLKQL 282
           ++ +YP+YR     L
Sbjct: 110 WKPMYPDYRAGYAAL 124


>gi|327402078|ref|YP_004342916.1| UDP-glucose/GDP-mannose dehydrogenase [Fluviicola taffensis DSM
           16823]
 gi|327317586|gb|AEA42078.1| UDP-glucose/GDP-mannose dehydrogenase [Fluviicola taffensis DSM
           16823]
          Length = 261

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 119/281 (42%), Gaps = 34/281 (12%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           M + I G G+ G  +A + L  G +  GTTR+ S  + L H+  S  L+ D  +      
Sbjct: 1   MKIGIIGLGWLGLPLAKSLLNKGHHVIGTTRTRS--VELSHERFSHVLY-DPTLKKQASS 57

Query: 61  KLYFTTH-IVQCIKPSSEGDPCIISMSKDFYKFM----PHVKWIGYLSSTSIYGNREGQW 115
             +     I+    PS   +    + +KD  K +    P  K I ++SST IY  R G +
Sbjct: 58  GYFNELEVIILAFTPSRVDEK---AYAKDCVKVLDTISPTCKVI-HISSTGIYPQRTGIF 113

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
            ++    +P   + T      +  LAI+  L  +L V+RLSG+ GPKR+P   + +  S 
Sbjct: 114 NEKD---YPAGSIKTNAIGYAE--LAISSILRERLTVIRLSGLIGPKRHPVTAMLK--SE 166

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHL--GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           +        N I +ED    +  ++        I   S + P   Q    E A+ + I  
Sbjct: 167 KTYNALDPINVIHLEDAIGLIEHVIIQKAWNKTINGCSSEHPLKGQ-FYSEMATKLGIES 225

Query: 234 PLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           PL   F+    S F R        ISN     LG+  ++PN
Sbjct: 226 PL---FEQK--SSFERI-------ISNQYSIELGYNYIFPN 254


>gi|284029458|ref|YP_003379389.1| NAD-dependent epimerase/dehydratase [Kribbella flavida DSM 17836]
 gi|283808751|gb|ADB30590.1| NAD-dependent epimerase/dehydratase [Kribbella flavida DSM 17836]
          Length = 303

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 72/188 (38%), Gaps = 28/188 (14%)

Query: 109 GNREGQWVD-EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFI 167
           G REG WV  E   + P S  A        E       L    AVLR    YGP      
Sbjct: 126 GIREGGWVKTEEDPLDPTSTGAAAAAIRHLE----DAVLRAGGAVLRYGAFYGPGAT--- 178

Query: 168 KIRQKNSLRLVKKNQ---VFNR------IRVEDVARCVIFLMTHHLGGIFNLSDDEPAPP 218
                + + LV++ Q   V N       + ++D A   +  +     G+FN+ DD+PAP 
Sbjct: 179 ----DDQVELVRRRQYPVVGNGAGHSSWVHLDDAATATVLAVEGRAQGVFNIVDDDPAPA 234

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTR----FFYADNKRISNAKIK-SLGFQLLYP 273
              +   A      PPL     T    P           + +  SNAK K  LG+Q  YP
Sbjct: 235 SEWLPHLAVCAGAKPPLR--IPTWLARPLAGRTAVTMMTEGRGFSNAKAKRELGWQPRYP 292

Query: 274 NYRISLKQ 281
           ++R   ++
Sbjct: 293 SWRQGFRE 300


>gi|228996406|ref|ZP_04156048.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus mycoides Rock3-17]
 gi|228763369|gb|EEM12274.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus mycoides Rock3-17]
          Length = 304

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 108/258 (41%), Gaps = 36/258 (13%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP-------FLFADQKIN 55
           L+  GAG+ G  I +  L+  +     T  V NL+T  HK   P       F   D  I+
Sbjct: 4   LVTGGAGFIGSHIVEFLLENNI----DTVVVDNLVT-GHKYNIPSKVAFYHFDIRDPNID 58

Query: 56  NL-LREKLYFTTH----------IVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSS 104
            + + EK  F  H          + Q     SE     +++ +   K+  +VK I Y S+
Sbjct: 59  KIFMVEKPDFVIHQAAQVSVQESVKQPFYDCSENVMATVNILQACIKY--NVKKIIYAST 116

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
            ++YGN +   +DE   ++P+S     +  +E       K   +K  +LR S +YG ++N
Sbjct: 117 AAVYGNPQYLPIDEKHDLNPVSFYGLSKLTSEAYIQLFAKLYGLKYTILRYSNVYGARQN 176

Query: 165 P---------FIKIRQKNSLRLV--KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDD 213
           P         F+    KN   ++    NQ  + I V+DVA        +    I N+S +
Sbjct: 177 PDGEAGVISIFMDRLFKNDSPIIYGDGNQTRDFIFVKDVAHANFLAFRNADNQICNISSN 236

Query: 214 EPAPPQNVIMEAASLMKI 231
           +      ++    +LMKI
Sbjct: 237 QQISVNELLDTICNLMKI 254


>gi|207721429|ref|YP_002251870.1| nad-dependent epimerase/dehydratase protein [Ralstonia solanacearum
           MolK2]
 gi|206586588|emb|CAQ17175.1| nad-dependent epimerase/dehydratase protein [Ralstonia solanacearum
           MolK2]
          Length = 341

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 81/197 (41%), Gaps = 42/197 (21%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVAT--QRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +  AT          W  +      + ++LR+ GI
Sbjct: 154 YASTSGVYGDCGGAWVDESRPVRPSTPRATRRVAAERRVRWFGVGG--GWRTSILRIPGI 211

Query: 159 YGPKRNPFIK-IRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH------ 202
           Y   R P  + +R   +LR  ++  VF N I  +D+AR VI  +         H      
Sbjct: 212 YAADRLPEARLLRGTPALR--REEDVFTNHIHADDLARAVIAALFRGRPQRVVHVSDATE 269

Query: 203 -HLGGIFNLSDDE---PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRI 258
             +G  F+   D    P PP+    EAA                 + P    F ++++R+
Sbjct: 270 LRMGDYFDAVADARGLPRPPRIARAEAAR---------------QLEPALLSFMSESRRL 314

Query: 259 SNAKI-KSLGFQLLYPN 274
            N ++ + L   L YP 
Sbjct: 315 RNVRLARELRLALRYPT 331


>gi|294637046|ref|ZP_06715361.1| NAD dependent epimerase/dehydratase family protein [Edwardsiella
           tarda ATCC 23685]
 gi|291089743|gb|EFE22304.1| NAD dependent epimerase/dehydratase family protein [Edwardsiella
           tarda ATCC 23685]
          Length = 276

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 98/246 (39%), Gaps = 26/246 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS--PFLFADQ------KI 54
           + I G G+ G  +A + L  G    G+  +   +   +  G+   P L A Q       +
Sbjct: 4   VAIVGLGWLGMPLALSLLARGYQVVGSKTTPDGVEAARLSGVECYPLLLAPQLECDEEDL 63

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSIYG 109
             LLR      T    C      G+   I+  +   + +      G     +LSSTS+YG
Sbjct: 64  AQLLRVDALVITLPANC------GNDGGIAYRQAVRQLVDSALGYGVARIIFLSSTSVYG 117

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           +  G+ V+E + +HP S  A Q     + WL      ++   VLRL+G+ G  R+P   +
Sbjct: 118 DVAGE-VNEDTPLHPTS-QAGQALADLERWLHDLPHTSVD--VLRLAGLVGEGRHPGRFL 173

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASL 228
             K  L     N   N +  +D    +  L+    GG I+NL        Q      A  
Sbjct: 174 AGKTDLP--GGNAGVNLLHRDDAIAAIQLLLEQPQGGHIYNLCAPHHPARQQFYPSLARS 231

Query: 229 MKITPP 234
           + +TPP
Sbjct: 232 LGLTPP 237


>gi|238784354|ref|ZP_04628365.1| hypothetical protein yberc0001_17510 [Yersinia bercovieri ATCC
           43970]
 gi|238714782|gb|EEQ06783.1| hypothetical protein yberc0001_17510 [Yersinia bercovieri ATCC
           43970]
          Length = 275

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 115/281 (40%), Gaps = 29/281 (10%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF---------ADQKIN 55
           I G G+ G  +A + ++ GV   G+  +   +   +  GI  +L           D    
Sbjct: 6   IIGLGWLGLPLAQSLIRRGVQVVGSKTTPDGVEAARMSGIDCYLLQLTPELICDPDDLAQ 65

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQW 115
            +  + L  T    +  +   +    +  +      F   V  I + SSTS+YG   G+ 
Sbjct: 66  LMTVDALVITLPASRTTEGGGDYLQAVQMVVDSALAF--GVPRIIFTSSTSVYGETRGR- 122

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           + E S + P++         E  WL   K  N  + +LRL+G+ G  R+P   +  K  +
Sbjct: 123 IKESSPLQPVTTAGKTLLELEL-WLH--KLPNTSVDILRLAGLVGADRHPGRFLAGKIDV 179

Query: 176 RLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKITPP 234
           +    +   N +  EDV   +  L+    GG I+NL        ++    +A  +++TPP
Sbjct: 180 K--GGSLGVNLVHQEDVISAIELLLNLPRGGHIYNLCAPLHPRKRDFYPASARALQLTPP 237

Query: 235 LEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
               F + +I   TR        I  +KI + LGF+  YP+
Sbjct: 238 E---FASEDIEEPTR-------EIDGSKICRELGFEYQYPD 268


>gi|312127797|ref|YP_003992671.1| nad-dependent epimerase/dehydratase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777816|gb|ADQ07302.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 305

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 97/239 (40%), Gaps = 39/239 (16%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIEKGYDVC----IVDNLLSGNVCNINPKAKFYQLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDFY-----KFMPHVKWIGYL-----------S 103
           EK++    I  CI  +++    +    KD Y       +  V  + Y            S
Sbjct: 57  EKVFEENKIEYCIHQAAQ--VSVAKSMKDAYLDCSINVLGTVNLLDYCVKYKVKKFILAS 114

Query: 104 STSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR 163
           S ++YG  +   +DE+  + P S     +  +E+         N +  + R S +YGP++
Sbjct: 115 SAAVYGEPKYIPIDENHPLRPESFYGLSKLTSEEYIKMFAHNFNFEYIIFRYSNVYGPRQ 174

Query: 164 NPF-----IKI---RQKNSLRLV---KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
           +PF     + I   R + S  ++      Q  + I VEDVA      +   + G FNLS
Sbjct: 175 DPFGEGGVVSIFCERMQGSKDVIIFGDGTQTRDFIYVEDVAEANCIALESSVSGTFNLS 233


>gi|225012061|ref|ZP_03702498.1| NAD-dependent epimerase/dehydratase [Flavobacteria bacterium
           MS024-2A]
 gi|225003616|gb|EEG41589.1| NAD-dependent epimerase/dehydratase [Flavobacteria bacterium
           MS024-2A]
          Length = 264

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 87/212 (41%), Gaps = 15/212 (7%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLREK 61
           I G G+ G  + +   K      GT R    +  LK KGI+ F   +F D KI       
Sbjct: 6   ILGCGWLGIALGEVLKKKEYTVRGTRRGKEGIRLLKKKGIAAFQMDVFPD-KITGDFSFF 64

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREGQWVDEH 119
               T I+             +         +    +  I +LSSTS+YGN  G + +E+
Sbjct: 65  DGIDTLIISIPPDRKNSSSSFVQKITTVLNIVRSSSINRILFLSSTSVYGNSAGIF-NEY 123

Query: 120 SFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVK 179
           +  +P +  A   +  E++ L       +   ++RL G+ G  RNPF+ ++ K   ++  
Sbjct: 124 TVPNPQTTSAKALYEVEQKLL----NFQVPKLIIRLGGLVGEDRNPFVYLQDK---KISN 176

Query: 180 KNQVFNRIRVEDVARCVIFLMTHHLG-GIFNL 210
            N   N I   D    +  L+ H    GI+NL
Sbjct: 177 PNGCINFIHQIDAVNGISALLNHFENEGIYNL 208


>gi|294460904|gb|ADE76025.1| unknown [Picea sitchensis]
          Length = 332

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 99/235 (42%), Gaps = 34/235 (14%)

Query: 1   MHLMIFGAGYTGKFIADAALKVG----VYTCGTTRSVSNLLTLKHKGISPFLFADQKINN 56
           M L++ G G  G+ +A+  LKV     VY  G TR++ +   L   GI P +      N 
Sbjct: 70  MDLLVVGPGVLGRLVAENWLKVNPSCRVY--GQTRTMDHHGELGRLGIKPIIKGSDSRNC 127

Query: 57  LLREKLYFTTHIVQCIKPS-SEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSIYGN 110
                      ++ C  PS SE  P  +  +          +W G     + SS+++Y +
Sbjct: 128 F--------PFVIFCAPPSGSEDYPAEVRAATS--------QWSGEGSFLFTSSSAVYDS 171

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
            + +   E S   P+     +    +   +A  + L I   V+RL+G+Y   R P +   
Sbjct: 172 NDNRLCLEDSPTVPMG----RSLRTDILLMAEAEVLKIGGNVVRLAGLYKFDRGPHMYYL 227

Query: 171 QKNSLRLVKKNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQNVIME 224
           +K ++ +  ++ + N I  ED A  C + L   + G +F   D  P   Q ++ E
Sbjct: 228 KKGTVDVCPEH-IINLIHYEDAASLCKVILAKKYRGHVFMGCDGCPLSRQEMMEE 281


>gi|194290583|ref|YP_002006490.1| oxidoreductase protein [Cupriavidus taiwanensis LMG 19424]
 gi|193224418|emb|CAQ70429.1| putative OXIDOREDUCTASE PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 338

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (50%), Gaps = 9/138 (6%)

Query: 78  GDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK 137
           G+P I+       +  P   ++ Y S+T +YG+R+G  V E   V P +  A +R  AE+
Sbjct: 137 GEPAILP-----DRTWPRAAFV-YASTTGVYGDRQGARVAEFHAVRPQTARARRRVAAEQ 190

Query: 138 EWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCV 196
              A  +    + +V+R+ GIY   R P  ++R + +  LV ++ V+ + I  +D+AR +
Sbjct: 191 AVRAFGRDAGWRASVVRIPGIYAEDRLPLARLR-RGTPALVPQDDVYTSHIHADDLARIM 249

Query: 197 I-FLMTHHLGGIFNLSDD 213
           +  L       + + SDD
Sbjct: 250 VAALFRGRPQRVVHASDD 267


>gi|332977774|gb|EGK14534.1| NAD-dependent epimerase/dehydratase [Psychrobacter sp. 1501(2011)]
          Length = 294

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 90/221 (40%), Gaps = 27/221 (12%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           +I G G  G  + +   +      G  R       L  +  + FL AD     L  E++ 
Sbjct: 18  LIIGQGDIGLAVTNTLARQQKNVTGLARGEKQSYALHEE--AHFLQADAL--KLSAEQIK 73

Query: 64  FTTHIVQCIKPSSEGDP-------CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
             THI   + P +            I     D    +P +K + ++SST +YG  +G+W+
Sbjct: 74  EITHIAIVVTPDNYDAENYKNTYLGIAQHIADLESQLPQLKRVVFISSTGVYGQDDGEWI 133

Query: 117 DEHSFVHPISCVATQR-FNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ--KN 173
           DE     P     ++    AE+    + +    +  ++R SGIYG +R   ++IRQ  + 
Sbjct: 134 DEAVEPKPAKREGSKYILQAEQ---VLQQAYGSRAVIIRPSGIYGEER--LMRIRQVKEK 188

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDE 214
            L  + +    NRI   D+   ++         I +LSD E
Sbjct: 189 QLEALPQYDWTNRIMDTDLVTIIV--------QILSLSDAE 221


>gi|117620786|ref|YP_856098.1| NAD dependent epimerase/dehydratase family protein [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117562193|gb|ABK39141.1| NAD dependent epimerase/dehydratase family protein [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 270

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 109/272 (40%), Gaps = 27/272 (9%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYF 64
           I GAG+ G  +A A    G     T  S      L  +G+  +     ++   L    + 
Sbjct: 11  IVGAGWLGLPLARALQAEGRQVAVTVSSAQKAAQLTAEGLQAWPL---QLGTGLTALPFR 67

Query: 65  TTHIVQCIKPSSEGD-PCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVH 123
              +V C+ PS   D P  I    +       V+ + ++S+TS++   +G+  DE     
Sbjct: 68  CRELVICVPPSKVEDYPAAIGRVAEL-ALAAGVQRLLFVSATSVWAPGQGE--DEQPM-- 122

Query: 124 PISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQV 183
           P      +   AE+   A+   +   + VLR +G+YGP+R+P   +  K    L    Q 
Sbjct: 123 PAHERGMRMLAAEQA--AMGAGIPCAM-VLRPAGLYGPQRHPGRFLAGKT---LEGGGQA 176

Query: 184 FNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA 242
            N + ++D VA C + L     G  +NLS       +     AA  + +  P+       
Sbjct: 177 VNLVHLDDVVAACQLLLAQGKDGDAYNLSAPVHPRREQFYPFAARQLGLPAPV------- 229

Query: 243 NISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            I P  RF   +  RI     + LGF   +P+
Sbjct: 230 FIEPAGRFLPVEGLRI----CEQLGFVYRWPD 257


>gi|283785839|ref|YP_003365704.1| hypothetical protein ROD_21561 [Citrobacter rodentium ICC168]
 gi|282949293|emb|CBG88904.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 274

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE-KEWLAITKKLNIKLAVL 153
           H+  I + SSTS+YG+  G  V E +  HP++  A+ R   E ++WL      ++   +L
Sbjct: 103 HIPRIIFTSSTSVYGDVNG-IVKESTPRHPVT--ASGRVLKELEDWLHHLPGTSVD--IL 157

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSD 212
           RL+G+ GP R+P      K +       Q  N + +EDV   +  L+    GG I+N+  
Sbjct: 158 RLAGLVGPGRHPGRFFAGKTA---PNGEQGVNLVHLEDVISAITLLLQAPKGGHIYNIC- 213

Query: 213 DEPA-PPQNVIM-EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
             P  P +NV   + A  +   PP  Q  D+ +     +    D  RI N     LGF+ 
Sbjct: 214 -APVHPARNVFYPQMARQLNTEPP--QFLDSPDNG---KGKIIDGSRICN----ELGFEY 263

Query: 271 LYPN 274
            YP+
Sbjct: 264 QYPD 267


>gi|307265779|ref|ZP_07547330.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919174|gb|EFN49397.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 311

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 30/240 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLL- 58
           L+  GAG+ G  I D  ++ G         V NL T K K I+    F   D   ++L  
Sbjct: 4   LVAGGAGFIGSHIGDLLIENGYEIV----IVDNLSTGKEKFINKKAIFYKKDITDDDLYE 59

Query: 59  ---REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFM--------PHVKWIGYLSSTSI 107
              +EK  +  H    I      D  +     +    +          VK I Y SS ++
Sbjct: 60  IFRKEKPDYVIHQAAQIDVQKSIDNSVFDAKVNVLGTVNILECCRKSGVKKIIYASSAAV 119

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP-- 165
           YGN E   +DE   ++PIS     +  AE  +   ++  ++K  +LR + +YG +++P  
Sbjct: 120 YGNPEYLPIDEGHKINPISSYGISKHTAEHYFEVYSQLYDLKYTILRYANVYGIRQDPKG 179

Query: 166 ---FIKIRQKNSLR------LVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPA 216
               I I     L+          NQ  + + V+DVA+  +  +      + N+S ++P 
Sbjct: 180 EGGVISIFTDKMLKGERPVIFGDGNQTRDFVYVKDVAKANLLALERGDNEVVNVSTNKPT 239


>gi|256619578|ref|ZP_05476424.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis ATCC
           4200]
 gi|256963447|ref|ZP_05567618.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis
           HIP11704]
 gi|307272703|ref|ZP_07553950.1| NAD-binding domain 4 [Enterococcus faecalis TX0855]
 gi|307276099|ref|ZP_07557232.1| NAD-binding domain 4 [Enterococcus faecalis TX2134]
 gi|256599105|gb|EEU18281.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis ATCC
           4200]
 gi|256953943|gb|EEU70575.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis
           HIP11704]
 gi|306507429|gb|EFM76566.1| NAD-binding domain 4 [Enterococcus faecalis TX2134]
 gi|306510317|gb|EFM79340.1| NAD-binding domain 4 [Enterococcus faecalis TX0855]
          Length = 316

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +M++T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNKLISSLNDIMQVTLPVE 272


>gi|187929771|ref|YP_001900258.1| NAD-dependent epimerase/dehydratase [Ralstonia pickettii 12J]
 gi|187726661|gb|ACD27826.1| NAD-dependent epimerase/dehydratase [Ralstonia pickettii 12J]
          Length = 342

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 54/203 (26%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQR---------FNAEKEWLAITKKLNIKLA 151
           Y S++ +YG+  G WVDE   V P +  A +R         F A   W         + +
Sbjct: 156 YASTSGVYGDAAGAWVDESRPVKPTTARAQRRVAAERRVRWFGAGGGW---------RTS 206

Query: 152 VLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH 202
           +LR+ GIY   R P  ++ ++ +  L  ++ V+ N I  +D+AR VI  +         H
Sbjct: 207 ILRIPGIYAADRLPIARL-ERGTPALRAEDDVYTNHIHADDLARAVIAALFRGRPQRIVH 265

Query: 203 -------HLGGIFNLSDDEPA---PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFY 252
                   +G  F+   D      PP+  I  A +L +I P L               F 
Sbjct: 266 ATDASELRMGDYFDAVADARGLQRPPR--ISRAEALQQIEPALLS-------------FM 310

Query: 253 ADNKRISNAKI-KSLGFQLLYPN 274
           ++++R+ N ++ + L   L YP 
Sbjct: 311 SESRRLRNTRLARELRVALRYPT 333


>gi|300703320|ref|YP_003744922.1| epimerase [Ralstonia solanacearum CFBP2957]
 gi|299070983|emb|CBJ42292.1| putative epimerase [Ralstonia solanacearum CFBP2957]
          Length = 341

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 82/197 (41%), Gaps = 42/197 (21%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVAT--QRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +  AT          W  +      + ++LR+ GI
Sbjct: 155 YASTSGVYGDCGGAWVDESRPVRPSTPRATRRVAAERRVRWFGVGG--GWRTSILRIPGI 212

Query: 159 YGPKRNPFIK-IRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH------ 202
           Y   R P  + +R   +LR  +++ VF N I  +D+AR VI  +         H      
Sbjct: 213 YAADRLPEARLLRGTPALR--REDDVFTNHIHADDLARAVIAALFRGRPQRVVHVSDATE 270

Query: 203 -HLGGIFNLSDDE---PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRI 258
             +G  F+   D    P PP+    +AA                 + P    F ++++R+
Sbjct: 271 LRMGDYFDAVADARGLPRPPRIARADAAR---------------QLEPALLSFMSESRRL 315

Query: 259 SNAKI-KSLGFQLLYPN 274
            N ++ + L   L YP 
Sbjct: 316 RNVRLARELRLALRYPT 332


>gi|295113339|emb|CBL31976.1| Nucleoside-diphosphate-sugar epimerases [Enterococcus sp. 7L76]
          Length = 316

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +M++T P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNKLISSLNDIMQVTLPVE 272


>gi|254190860|ref|ZP_04897367.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938535|gb|EDO94205.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 283

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 343

Query: 274 N 274
           +
Sbjct: 344 S 344


>gi|134281272|ref|ZP_01767981.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 305]
 gi|167893209|ref|ZP_02480611.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 7894]
 gi|167909913|ref|ZP_02497004.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 112]
 gi|167917935|ref|ZP_02505026.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei BCC215]
 gi|217419398|ref|ZP_03450904.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 576]
 gi|226194453|ref|ZP_03790051.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|254181472|ref|ZP_04888069.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1655]
 gi|254261898|ref|ZP_04952952.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1710a]
 gi|134247578|gb|EBA47663.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 305]
 gi|184212010|gb|EDU09053.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1655]
 gi|217396702|gb|EEC36718.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 576]
 gi|225933538|gb|EEH29527.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|254220587|gb|EET09971.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1710a]
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 283

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 343

Query: 274 N 274
           +
Sbjct: 344 S 344


>gi|145590601|ref|YP_001152603.1| NAD-dependent epimerase/dehydratase [Pyrobaculum arsenaticum DSM
           13514]
 gi|145282369|gb|ABP49951.1| NAD-dependent epimerase/dehydratase [Pyrobaculum arsenaticum DSM
           13514]
          Length = 299

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 89/225 (39%), Gaps = 25/225 (11%)

Query: 7   GAGYTGKFIADAALKVG--VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYF 64
           GAG+ G  +A      G  V    +    S L  L+  G+ P + AD + + L R     
Sbjct: 8   GAGFIGSHVAAHLKSRGFDVVAVDSLERASGLGRLRAAGV-PLVVADLRRDELPRGDAVV 66

Query: 65  TTHIVQCIKPSSE--------GDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
                  ++ S E               + K+  +      ++ YLSS ++YGN     +
Sbjct: 67  HAAAYISVEESWEKPYEYMWNNAAVTAKVGKEALRMG---AYLVYLSSAAVYGNPVYTPI 123

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR-NPFIKI------ 169
           DE     P S     +   E E LA+ +   +K AV RL  +YGP +  P+  +      
Sbjct: 124 DEEHPTRPTSPYGLSKLAGE-EALALLQSAGLKYAVARLFNVYGPGQTGPYAGVITKFIE 182

Query: 170 RQKNSLRLV---KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLS 211
           R +  L  V      Q  + I V DVAR V  L+     G+FN+ 
Sbjct: 183 RARAGLPPVIFGSGEQTRDFIHVLDVARFVETLVEKGAQGVFNVG 227


>gi|76811926|ref|YP_332564.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1710b]
 gi|167901663|ref|ZP_02488868.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei NCTC 13177]
 gi|76581379|gb|ABA50854.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1710b]
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 170 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 229

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 230 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 286

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 287 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 346

Query: 274 N 274
           +
Sbjct: 347 S 347


>gi|126452148|ref|YP_001065279.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1106a]
 gi|237811193|ref|YP_002895644.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei MSHR346]
 gi|242317733|ref|ZP_04816749.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1106b]
 gi|254197015|ref|ZP_04903439.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei S13]
 gi|126225790|gb|ABN89330.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1106a]
 gi|169653758|gb|EDS86451.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei S13]
 gi|237505240|gb|ACQ97558.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei MSHR346]
 gi|242140972|gb|EES27374.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 1106b]
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 283

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 343

Query: 274 N 274
           +
Sbjct: 344 S 344


>gi|167844681|ref|ZP_02470189.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei B7210]
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 170 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 229

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 230 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 286

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 287 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 346

Query: 274 N 274
           +
Sbjct: 347 S 347


>gi|109900357|ref|YP_663612.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas atlantica T6c]
 gi|109702638|gb|ABG42558.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas atlantica T6c]
          Length = 283

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 111/255 (43%), Gaps = 27/255 (10%)

Query: 1   MHLMIFGAGYTGKFIADA-------ALKVGVYTCGTTRSVSNLLTLKHKGISP--FLFAD 51
           M + IFG G+ G+ +A A       A +       T RS +++ T++ +G+    F+   
Sbjct: 1   MKITIFGGGWLGQPLAVALSKNSANANETAPEVQVTCRSEASMATIRAQGLQARQFILGG 60

Query: 52  QKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMP----------HVKWIGY 101
              +      L  +  +V  I P           S+ F   M             K I +
Sbjct: 61  SLQDKAAGSPLLHSDIVVINIPPGRRNLANNPQASEQFVSDMSALIRQTCIEQSAKLI-F 119

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
           +S++++YG+ EG+ + E+S ++P +  A      E+    I + +     +LRL+G+ GP
Sbjct: 120 ISTSAVYGDVEGE-ITENSQLNPSTESARAHCAIEQ---FIQQNIPQAATILRLAGLVGP 175

Query: 162 KRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQN 220
           KR+P   +  K  L L   +QV N +  +DV   +  ++   + G I +LS       + 
Sbjct: 176 KRHPAKFLAGK--LDLSGASQVVNLVHQQDVIHAIEHIINREIWGEILHLSAQAHPTRKE 233

Query: 221 VIMEAASLMKITPPL 235
               A+  + +TPP+
Sbjct: 234 YYSWASKQLALTPPV 248


>gi|53725930|ref|YP_103556.1| hypothetical protein BMA1965 [Burkholderia mallei ATCC 23344]
 gi|254175616|ref|ZP_04882276.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|52429353|gb|AAU49946.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|160696660|gb|EDP86630.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 170 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 229

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 230 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 286

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 287 KMGDYFERVARAFGLRRPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 346

Query: 274 N 274
           +
Sbjct: 347 S 347


>gi|126439362|ref|YP_001058042.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 668]
 gi|126218855|gb|ABN82361.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 668]
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 283

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFERVARAFGLRSPPRISRAEAERQLEPMLLSFMRESRRLANARMKRELCITLRYP 343

Query: 274 N 274
           +
Sbjct: 344 S 344


>gi|121599938|ref|YP_992288.1| hypothetical protein BMASAVP1_A0949 [Burkholderia mallei SAVP1]
 gi|124386428|ref|YP_001026867.1| hypothetical protein BMA10229_A0876 [Burkholderia mallei NCTC
           10229]
 gi|126451405|ref|YP_001079846.1| hypothetical protein BMA10247_0272 [Burkholderia mallei NCTC 10247]
 gi|238560965|ref|ZP_04609366.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           mallei GB8 horse 4]
 gi|251767045|ref|ZP_04819934.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei PRL-20]
 gi|254202242|ref|ZP_04908605.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei FMH]
 gi|254207575|ref|ZP_04913925.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei JHU]
 gi|121228748|gb|ABM51266.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124294448|gb|ABN03717.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126244275|gb|ABO07368.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147746489|gb|EDK53566.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei FMH]
 gi|147751469|gb|EDK58536.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei JHU]
 gi|238525272|gb|EEP88700.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           mallei GB8 horse 4]
 gi|243064094|gb|EES46280.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           mallei PRL-20]
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 283

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFERVARAFGLRRPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 343

Query: 274 N 274
           +
Sbjct: 344 S 344


>gi|256961465|ref|ZP_05565636.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis Merz96]
 gi|256951961|gb|EEU68593.1| NAD-dependent epimerase/dehydratase [Enterococcus faecalis Merz96]
          Length = 316

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 108 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 167

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 168 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 227

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+  P+E
Sbjct: 228 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVALPVE 272


>gi|284991302|ref|YP_003409856.1| NAD-dependent epimerase/dehydratase [Geodermatophilus obscurus DSM
           43160]
 gi|284064547|gb|ADB75485.1| NAD-dependent epimerase/dehydratase [Geodermatophilus obscurus DSM
           43160]
          Length = 311

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 5/136 (3%)

Query: 151 AVLRLSGIYGP-KRNPFIKIRQKNSLRLVKKNQVFNR-IRVEDVARCVIFLMTHHLGGIF 208
           AVLR  G YGP   +  +++ ++    L+     ++  I ++D A   +  +     G+F
Sbjct: 173 AVLRYGGFYGPGATDDVVELVRRRQFPLIGGGTGYSSWIHLDDAASATVLAVEQKATGVF 232

Query: 209 NLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANI--SPFTRFFYADNKRISNAKIK-S 265
           N+ DDEPAP    +   A+      P+      A +           + +  SNAK K  
Sbjct: 233 NIVDDEPAPASEWLPYLAACTGAKRPVRIPTWLARLVAGDVAVTMMTEGRGFSNAKAKRE 292

Query: 266 LGFQLLYPNYRISLKQ 281
           LG++L Y ++R   K+
Sbjct: 293 LGWELRYSSWRQGFKE 308


>gi|293382114|ref|ZP_06628058.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis R712]
 gi|293386631|ref|ZP_06631208.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis S613]
 gi|312908242|ref|ZP_07767206.1| NAD-binding domain 4 [Enterococcus faecalis DAPTO 512]
 gi|312910687|ref|ZP_07769528.1| NAD-binding domain 4 [Enterococcus faecalis DAPTO 516]
 gi|291080493|gb|EFE17857.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis R712]
 gi|291083924|gb|EFE20887.1| NAD-dependent epimerase/dehydratase family protein [Enterococcus
           faecalis S613]
 gi|310625656|gb|EFQ08939.1| NAD-binding domain 4 [Enterococcus faecalis DAPTO 512]
 gi|311289063|gb|EFQ67619.1| NAD-binding domain 4 [Enterococcus faecalis DAPTO 516]
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 21/166 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
           +  + L+ H    LG ++N+   +      +I     +MK+  P+E
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVALPVE 275


>gi|289577898|ref|YP_003476525.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter italicus
           Ab9]
 gi|289527611|gb|ADD01963.1| NAD-dependent epimerase/dehydratase [Thermoanaerobacter italicus
           Ab9]
          Length = 288

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 11/132 (8%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK + Y SS ++YGN E   +DE   ++PIS     +  AE  +   ++  ++K  +LR 
Sbjct: 78  VKKVIYASSAAVYGNPEYLPIDEGHRINPISSYGISKHTAEHYFEVYSQLYDLKYTILRY 137

Query: 156 SGIYGPKRNP-----FIKI------RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL 204
           + +YG +++P      I I      + K  +     NQ  + + V+DVA+  +  +    
Sbjct: 138 ANVYGIRQDPKGEGGVISIFTDKMLKGKRPVIFGDGNQTRDFVYVKDVAKANLLALERGD 197

Query: 205 GGIFNLSDDEPA 216
             + N+S ++P 
Sbjct: 198 NEVVNISTNKPT 209


>gi|255531844|ref|YP_003092216.1| NAD-dependent epimerase/dehydratase [Pedobacter heparinus DSM 2366]
 gi|255344828|gb|ACU04154.1| NAD-dependent epimerase/dehydratase [Pedobacter heparinus DSM 2366]
          Length = 282

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 104/248 (41%), Gaps = 31/248 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + I G G+ G  +A   +  G    G++ +V  L  L  + I PFL   +K +    + L
Sbjct: 13  ISILGCGWYGIELARELVAKGYTVKGSSTTVQKLQLLAEQQIQPFLVNFEK-DKESYDPL 71

Query: 63  YFTTHIV-QCIKPS-SEGDPCI-------ISMSKDFYKFMPHVKWIGYLSSTSIYGNREG 113
           +F T ++  CI P  SEG           I  +   +K    +  + ++SST++YG+   
Sbjct: 72  FFKTELLFVCIPPKRSEGQQSDYLHKIQRICTAAQLHK----ISNLIFISSTAVYGDHNE 127

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP----FIKI 169
           + V E +  +P +       +AE     ++        +LR  G+ GP R+P      K 
Sbjct: 128 E-VTELTVPNPETASGKAILDAEN---LLSTHPGFNCTILRFGGLVGPGRHPGRFFAGKT 183

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIF--NLSDDEPAPPQNVIMEAAS 227
              N L  V      N I + D     I L+ H +  I     S D PA  Q+  + AA 
Sbjct: 184 DIPNGLAPV------NLIHLTDCIGISIHLVQHEITNIIINACSPDHPA-KQDFYVAAAL 236

Query: 228 LMKITPPL 235
             K+ PP+
Sbjct: 237 NAKLPPPV 244


>gi|53718570|ref|YP_107556.1| hypothetical protein BPSL0928 [Burkholderia pseudomallei K96243]
 gi|52208984|emb|CAH34923.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
          Length = 341

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 149 YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 208

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 209 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAVRGKPARVVHASDDTEL 265

Query: 217 PPQNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 266 KMGDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYP 325

Query: 274 N 274
           +
Sbjct: 326 S 326


>gi|315031076|gb|EFT43008.1| NAD-binding domain 4 [Enterococcus faecalis TX0017]
          Length = 319

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 21/165 (12%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K+   +K + + SS ++YG+       E S + P++  A  +F +EK  L      ++  
Sbjct: 111 KYQKDLKRLVFASSAAVYGDEPTLPKQEESVIRPLTPYAVDKFASEKYVLNYCHLYDVPT 170

Query: 151 AVLRLSGIYGPKRNP------FIKIRQKNSLRLVKKNQV-FNR----------IRVEDVA 193
           + +R   +YGP +NP       I I   +  RL+   +V FN           + VEDV 
Sbjct: 171 SAVRFFNVYGPNQNPNSPYSGVISIVMDSYKRLLANQEVTFNIFGDGKQSRDFVFVEDVV 230

Query: 194 RCVIFLMTH---HLGGIFNLSDDEPAPPQNVIMEAASLMKITPPL 235
           +  + L+ H    LG ++N+   +      +I     +MK+T P+
Sbjct: 231 QA-LNLVAHSDQSLGEVYNVGTGKATDLNELISSLNDIMKVTLPV 274


>gi|317401854|gb|EFV82462.1| hypothetical protein HMPREF0005_00554 [Achromobacter xylosoxidans
           C54]
          Length = 281

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 20/194 (10%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE--KEWLAITKKLNIKLAVL 153
           V+ I ++SS+++YG   G WVDE +   P      Q FN     E  A      I    L
Sbjct: 100 VERIVFVSSSAVYGEHHGDWVDEDTPTAP------QGFNGRILLEAEATLAARAIPHTTL 153

Query: 154 RLSGIYGPKRNPFI-KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFL-MTHHLGGIFNLS 211
           R +G+YGP R   + ++R   +   V+     NRI ++D A  +  + +      ++   
Sbjct: 154 RFAGLYGPGRLQLLERLRAGKASAPVEPPHWANRIHIDDAAAAIAHVALLPEASPVYIGC 213

Query: 212 DDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
           DD P P   +  E A ++    P +                  +K++SNA++++ G  L 
Sbjct: 214 DDTPLPLHELYAELARMIGAPLPADGPAPAG----------VGSKKLSNARLRASGLALQ 263

Query: 272 YPNYRISLKQLWKE 285
           +P+ R     L  +
Sbjct: 264 WPDSRAGYAALLAD 277


>gi|197284562|ref|YP_002150434.1| hypothetical protein PMI0667 [Proteus mirabilis HI4320]
 gi|227356742|ref|ZP_03841127.1| GDP-L-fucose synthase [Proteus mirabilis ATCC 29906]
 gi|194682049|emb|CAR41556.1| putative exported protein [Proteus mirabilis HI4320]
 gi|227163032|gb|EEI47967.1| GDP-L-fucose synthase [Proteus mirabilis ATCC 29906]
          Length = 273

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 125/291 (42%), Gaps = 47/291 (16%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A+A  + G    GT  +   +   +  G+       +P +  D+   
Sbjct: 4   ITIVGLGWLGLPLANALREAGYQVKGTKTTEDGVEAARMSGVDCCLMNLTPAIECDRDDF 63

Query: 56  NLLREKLYFTTHIVQCIKPSS--------EGDPCII--SMSKDFYKFMPHVKWIGYLSST 105
           + L E    T  ++  + PS+        EG   ++  +MS+       HV  + Y+SST
Sbjct: 64  DYLME----TDVLIITLPPSAAGGGYDYVEGIQTLVDSAMSR-------HVTRVIYISST 112

Query: 106 SIYGNREGQWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRN 164
           S+YGN+ G  + E   + P +  A  +  AE E WL       +   +LRL+G+ GP R+
Sbjct: 113 SVYGNQSG-VITEEVDIRPETQSA--KMIAEVENWLHRLPLTTVD--ILRLAGLVGPGRH 167

Query: 165 PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIM 223
               +  K  ++    +Q  N + ++DV   +  L+  + GG ++NL        ++   
Sbjct: 168 AGRFLSGKKQVK--GAHQSVNLVHLDDVIFAIEQLLAQNEGGRLYNLCAPIHPKKKDFYS 225

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
             A+ + +TPP    F   +  P       D + I     + LGF   YP+
Sbjct: 226 RVAAQLDLTPPE---FALEDKPPAREI---DGQEIC----RDLGFHYHYPD 266


>gi|163755376|ref|ZP_02162496.1| NAD dependent epimerase/dehydratase family protein [Kordia algicida
           OT-1]
 gi|161324796|gb|EDP96125.1| NAD dependent epimerase/dehydratase family protein [Kordia algicida
           OT-1]
          Length = 272

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 107/279 (38%), Gaps = 23/279 (8%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            + I G G+ G  +A   +       G+T S   + TLK  GI P++F      N     
Sbjct: 5   QISILGCGWLGLPLAKHFIAKNYTVKGSTTSAEKVETLKEVGIQPYVFTLGTTENDELLI 64

Query: 62  LYFTTHIVQCIKPSSEGDPCIISM-SKDFYKFMP---HVKWIGYLSSTSIYGNREGQWVD 117
            +F    V  I    +  P I  +  K     +P     + + ++SSTS+Y N    WV 
Sbjct: 65  DFFKNSDVIVINFPPKRVPNIEEIYQKQIQTILPFTNETQRVIFVSSTSVYQNT-NDWVT 123

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E     P        F  E    A  K    +L +LR +G++G  R P   +  K    +
Sbjct: 124 EDQHNQPEKASGKAVFAVENLLKATLKN---RLTILRFAGLFGYDRVPRRFLANKKD--V 178

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITPPLE 236
                  N I  +D    +  +   ++ G I N   DE    +     AA  + +TPP  
Sbjct: 179 ANGKAPINMIHQDDCIGLIQAITDRNVWGEIINGCADEHPLREEFYTLAAKKIGLTPP-- 236

Query: 237 QCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           +  DT  +S          K+I+N K K  L +   YP+
Sbjct: 237 KFKDTDEVS---------FKKIANMKSKELLDYSYQYPD 266


>gi|107023427|ref|YP_621754.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia AU
           1054]
 gi|116690509|ref|YP_836132.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia
           HI2424]
 gi|105893616|gb|ABF76781.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia AU
           1054]
 gi|116648598|gb|ABK09239.1| NAD-dependent epimerase/dehydratase [Burkholderia cenocepacia
           HI2424]
          Length = 345

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 83/181 (45%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETHPLRPANPRAFRRVSAERQLRAATVRGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ ++ +  L   + V+ N I  +D+A   I       G    + + SDD   
Sbjct: 210 ANRLPVARL-ERGTPALEPADDVYTNHIHADDLA--AILRRAAEQGKPARVVHASDDTEW 266

Query: 217 PPQNVIMEAASLMKIT-PPLEQCFDTAN-ISPFTRFFYADNKRISNAKIKS-LGFQLLYP 273
                    A ++ +  PP     D    + P    F  +++R+SN ++K+ L   L YP
Sbjct: 267 RMGEYFDRVAQVLGLPKPPRVSRADAERLLEPTLLSFMRESRRLSNTRLKAELCVTLRYP 326

Query: 274 N 274
            
Sbjct: 327 T 327


>gi|221134732|ref|ZP_03561035.1| NAD-dependent epimerase/dehydratase [Glaciecola sp. HTCC2999]
          Length = 294

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 109/250 (43%), Gaps = 24/250 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQK-------IN 55
           +M+ G G+ G+ +A   +  G+   GTT     L  L   GI+P LF+  K        N
Sbjct: 8   VMLCGCGWLGQPLASRLISQGIKVYGTTTRTCQLSFLNELGITPHLFSISKNSEDSPEFN 67

Query: 56  NLLREKLYFTTHIVQCIKPSS---EGDPCIISMSKDFYKFM---PHVKWIGYLSSTSIYG 109
             L   L     +V  I P     + +    +M + F   M   P V+ I ++S+TS++G
Sbjct: 68  PSLLADLAKCDVLVINIPPGRRDLDANSFTQNMLRLFKTAMTQQPDVRII-FVSTTSVFG 126

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           +  GQ VDE +   P++         E  WL   K  + +  ++RL+G+    R+P   +
Sbjct: 127 DVTGQ-VDEDTPTAPVTASGIAHQTLE-HWLL--KHASKQSTIVRLAGLINQTRHPVTSL 182

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARC---VIFLMTHHLGGIFNLSDDEPAPPQNVIMEAA 226
            +++ +   + +QV N +   D       V+      +G I +L   E  P +    +AA
Sbjct: 183 VKRSVIE--QGHQVVNLVHQIDAVNGLLQVVLKWNEVVGHILHLCAPE-HPTREDYYQAA 239

Query: 227 SLMKITPPLE 236
           +  K  P L+
Sbjct: 240 AQSKQLPKLK 249


>gi|167814651|ref|ZP_02446331.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           pseudomallei 91]
          Length = 235

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 43  YASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIPGIYA 102

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ +K +  LV+ + V+ N I  +D+A  ++          + + SDD     
Sbjct: 103 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLASILLRAAVRGKPARVVHASDDTELKM 161

Query: 219 QNVIMEAASL--MKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
            +     A    ++  P + +      + P    F  +++R++NA++K  L   L YP+
Sbjct: 162 GDYFERVARAFGLRSPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIALRYPS 220


>gi|241663897|ref|YP_002982257.1| NAD-dependent epimerase/dehydratase [Ralstonia pickettii 12D]
 gi|240865924|gb|ACS63585.1| NAD-dependent epimerase/dehydratase [Ralstonia pickettii 12D]
          Length = 332

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 54/203 (26%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQR---------FNAEKEWLAITKKLNIKLA 151
           Y S++ +YG+  G WVDE   V P +  A +R         F A   W         + +
Sbjct: 146 YASTSGVYGDAGGAWVDESRPVKPRTARAQRRVAAERRVRWFGAGGAW---------RTS 196

Query: 152 VLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH 202
           +LR+ GIY   R P  ++ ++ +  L  ++ V+ N I  +D+AR VI  +         H
Sbjct: 197 ILRIPGIYAADRLPVARL-ERGTPALRAQDDVYTNHIHADDLARAVIAALFRGRPQRIVH 255

Query: 203 -------HLGGIFNLSDDEPA---PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFY 252
                   +G  F+   D      PP+  I  A +L +I P L               F 
Sbjct: 256 ATDASELRMGDYFDAVADARGLQRPPR--ISRAEALQQIEPALLS-------------FM 300

Query: 253 ADNKRISNAKI-KSLGFQLLYPN 274
           ++++R+ N ++ + L   L YP 
Sbjct: 301 SESRRLRNTRLARELRVALRYPT 323


>gi|309781513|ref|ZP_07676249.1| NAD dependent epimerase/dehydratase family protein [Ralstonia sp.
           5_7_47FAA]
 gi|308919926|gb|EFP65587.1| NAD dependent epimerase/dehydratase family protein [Ralstonia sp.
           5_7_47FAA]
          Length = 333

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 54/203 (26%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQR---------FNAEKEWLAITKKLNIKLA 151
           Y S++ +YG+  G WVDE   V P +  A +R         F A   W         + +
Sbjct: 147 YASTSGVYGDAGGAWVDESRPVKPRTARAQRRVAAERRVRWFGAGGAW---------RTS 197

Query: 152 VLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH 202
           +LR+ GIY   R P  ++ ++ +  L  ++ V+ N I  +D+AR VI  +         H
Sbjct: 198 ILRIPGIYAADRLPVARL-ERGTPALRAQDDVYTNHIHADDLARAVIAALFRGRPQRIVH 256

Query: 203 -------HLGGIFNLSDDEPA---PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFY 252
                   +G  F+   D      PP+  I  A +L +I P L               F 
Sbjct: 257 ATDASELRMGDYFDAVADARGLQRPPR--ISRAEALQQIEPALLS-------------FM 301

Query: 253 ADNKRISNAKI-KSLGFQLLYPN 274
           ++++R+ N ++ + L   L YP 
Sbjct: 302 SESRRLRNTRLARELRVALRYPT 324


>gi|238795755|ref|ZP_04639269.1| hypothetical protein ymoll0001_16130 [Yersinia mollaretii ATCC
           43969]
 gi|238720481|gb|EEQ12283.1| hypothetical protein ymoll0001_16130 [Yersinia mollaretii ATCC
           43969]
          Length = 275

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 115/285 (40%), Gaps = 33/285 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS--PFLFADQKINNLLRE 60
           + I G G+ G  +A + ++ GV   G+  +   +   +  GI   P     + I      
Sbjct: 4   VAIIGLGWLGMPLAQSLIRRGVQVVGSKTTPDGVEAARMSGIDCYPLQLTPELICEPDDL 63

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMP---------HVKWIGYLSSTSIYGNR 111
               T   +    P+S           D+++ +           V  I + SSTS+YG  
Sbjct: 64  AQLMTVDALVITLPASR----TTEGGGDYFQAVQMVVDSALAFGVPRIIFTSSTSVYGET 119

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
            G+ + E S + P++         E  WL   K  N  + +LRL+G+ G  R+P   +  
Sbjct: 120 RGR-IKESSPLQPVTTAGKTLMELEL-WL--HKLPNTSVDILRLAGLVGADRHPGRFLAG 175

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMK 230
           K +++    +   N +  EDV   +  L+    GG I+NL        ++    +A  ++
Sbjct: 176 KTNVK--GGSLGVNLVHQEDVISAIELLLNLPRGGHIYNLCAPLHPSKRDFYPASARALQ 233

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           +TPP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 234 LTPPE---FAVEDIEEPAR-------EIDGSKICSELGFEYQYPD 268


>gi|323968149|gb|EGB63558.1| NAD dependent epimerase/dehydratase [Escherichia coli M863]
 gi|323977816|gb|EGB72902.1| NAD dependent epimerase/dehydratase [Escherichia coli TW10509]
          Length = 274

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LR
Sbjct: 103 HIPRIIFTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+   
Sbjct: 159 LAGLVGPERHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC-- 213

Query: 214 EPA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+ 
Sbjct: 214 APAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEY 263

Query: 271 LYPN 274
            YP+
Sbjct: 264 QYPD 267


>gi|288925878|ref|ZP_06419808.1| NAD dependent epimerase/reductase-related protein [Prevotella
           buccae D17]
 gi|288337302|gb|EFC75658.1| NAD dependent epimerase/reductase-related protein [Prevotella
           buccae D17]
          Length = 331

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 1   MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M ++I GA G+ G FI + ALK G+ T    R  S+   L+   I  F+  D      L 
Sbjct: 1   MKILITGASGFIGSFIVEEALKQGMETWAAVRRSSSRQYLQDGRIH-FIELDLSSPADLE 59

Query: 60  EKLY-----FTTHIVQCIKPSSEGDPCIISMSKDFYKF----------------MPHVKW 98
            +L      +  H     K       C+    +DFY+                 MP  ++
Sbjct: 60  RRLAGMQFDYVVHAAGATK-------CL--HEEDFYRVNTEGTKNLVHALLKVQMPLKRF 110

Query: 99  IGYLSSTSIYGN-REG---QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           + YLSS S++G  RE    Q + EH    P +     +  AE+   +I    +    VLR
Sbjct: 111 V-YLSSLSVFGAIREQQPYQEITEHDTPRPNTAYGKSKLEAERFLDSIGN--DFPYIVLR 167

Query: 155 LSGIYGPKRNPFI----KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG 206
            +G+YGP+   +      IR      +  + Q    + V DV + V   + H + G
Sbjct: 168 PTGVYGPREKDYFLMVKSIRSHTDFSVGFRRQDITFVYVADVVQAVFLALDHGMSG 223


>gi|121608730|ref|YP_996537.1| NAD-dependent epimerase/dehydratase [Verminephrobacter eiseniae
           EF01-2]
 gi|121553370|gb|ABM57519.1| NAD-dependent epimerase/dehydratase [Verminephrobacter eiseniae
           EF01-2]
          Length = 358

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 84/166 (50%), Gaps = 7/166 (4%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+ +G  V E   + P +  A +R +AE+  L    +  +++++LR+ GIY 
Sbjct: 146 YASTSGVYGDCQGALVPETRRLAPATPRAQRRASAER-VLRELGRAGLRVSLLRIPGIYA 204

Query: 161 PKRNP-FIKIRQKNSLRLVK-KNQVF-NRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPA 216
             R    ++ R + ++ +++ ++ VF + I  +D+AR C+  L        +N+SD  P 
Sbjct: 205 ADRAADTVQDRLRRAIPVLRPEDDVFTSHIHADDLARACIAALWRSRPQRAYNVSDLTPM 264

Query: 217 PPQNVIMEAASLMKI--TPPLEQCFDTANISPFTRFFYADNKRISN 260
              +    AA L  +   P L +      +SP    F ++++R+ N
Sbjct: 265 KMGDYFDLAAGLYGLPRPPRLPRSAAQQQLSPLRLSFMSESRRLDN 310


>gi|167569103|ref|ZP_02361977.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           oklahomensis C6786]
          Length = 362

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 87/181 (48%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 170 YASTSGVYGDCGGARVDETRPVRPANPRARRRVSAERQLRRATVRGALSARIVRIPGIYA 229

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 230 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAARGKPARVVHASDDTEL 286

Query: 217 PPQNV--IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +   ++  A  M+  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 287 KMGDYFELVARAFGMRNPPRITRAEAERQLEPMLLSFMRESRRLANARMKRELRVTLRYP 346

Query: 274 N 274
            
Sbjct: 347 T 347


>gi|167561883|ref|ZP_02354799.1| NAD-dependent epimerase/dehydratase family protein [Burkholderia
           oklahomensis EO147]
          Length = 359

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 87/181 (48%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  VDE   V P +  A +R +AE++    T +  +   ++R+ GIY 
Sbjct: 167 YASTSGVYGDCGGARVDETRPVRPANPRARRRVSAERQLRRATVRGALSARIVRIPGIYA 226

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTHHLGG---IFNLSDDEPA 216
             R P  ++ +K +  LV+ + V+ N I  +D+A   I L     G    + + SDD   
Sbjct: 227 ANRLPLARL-EKGTPALVEADDVYTNHIHADDLA--SILLRAAARGKPARVVHASDDTEL 283

Query: 217 PPQNV--IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYP 273
              +   ++  A  M+  P + +      + P    F  +++R++NA++K  L   L YP
Sbjct: 284 KMGDYFELVARAFGMRNPPRITRAEAERQLEPMLLSFMRESRRLANARMKRELRVTLRYP 343

Query: 274 N 274
            
Sbjct: 344 T 344


>gi|324114052|gb|EGC08025.1| NAD dependent epimerase/dehydratase [Escherichia fergusonii B253]
 gi|325497756|gb|EGC95615.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           fergusonii ECD227]
          Length = 274

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LR
Sbjct: 103 HIPRIIFTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+   
Sbjct: 159 LAGLVGPERHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC-- 213

Query: 214 EPA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+ 
Sbjct: 214 APAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEY 263

Query: 271 LYPN 274
            YP+
Sbjct: 264 QYPD 267


>gi|327253146|gb|EGE64800.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli STEC_7v]
          Length = 261

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LR
Sbjct: 90  HIPRIIFTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLKELEDWLHNLPGTSVD--ILR 145

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+   
Sbjct: 146 LAGLVGPERHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC-- 200

Query: 214 EPA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+ 
Sbjct: 201 APAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEY 250

Query: 271 LYPN 274
            YP+
Sbjct: 251 QYPD 254


>gi|315606983|ref|ZP_07881989.1| NAD-dependent epimerase [Prevotella buccae ATCC 33574]
 gi|315251364|gb|EFU31347.1| NAD-dependent epimerase [Prevotella buccae ATCC 33574]
          Length = 331

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 94/236 (39%), Gaps = 43/236 (18%)

Query: 1   MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR 59
           M ++I GA G+ G FI + ALK G+ T    R  S+   L+   I  F+  D      L 
Sbjct: 1   MKILITGASGFIGSFIVEEALKQGMETWAAVRRSSSRQYLQDGRIH-FIELDLSSPADLE 59

Query: 60  EKLY-----FTTHIVQCIKPSSEGDPCIISMSKDFYKF----------------MPHVKW 98
            +L      +  H     K       C+    +DFY+                 MP  ++
Sbjct: 60  RRLAGMQFDYVVHAAGATK-------CL--HEEDFYRVNTEGTKNLVHALLKVQMPLKRF 110

Query: 99  IGYLSSTSIYGN-REG---QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           + YLSS S++G  RE    Q + EH    P +     +  AE+   +I    +    VLR
Sbjct: 111 V-YLSSLSVFGAIREQQPYQEITEHDTPRPNTAYGKSKLEAERFLDSIGN--DFPYIVLR 167

Query: 155 LSGIYGPKRNPFI----KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG 206
            +G+YGP+   +      IR      +  + Q    + V DV + V   + H + G
Sbjct: 168 PTGVYGPREKDYFLMVKSIRSHTDFSVGFRRQDITFVYVTDVVQAVFLALDHGMSG 223


>gi|254247449|ref|ZP_04940770.1| Nucleoside-diphosphate-sugar epimerase [Burkholderia cenocepacia
           PC184]
 gi|124872225|gb|EAY63941.1| Nucleoside-diphosphate-sugar epimerase [Burkholderia cenocepacia
           PC184]
          Length = 345

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 84/179 (46%), Gaps = 6/179 (3%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S+T +YG+  G  +DE   + P +  A +R +AE++  A T +  +   ++R+ GIY 
Sbjct: 150 YASTTGVYGDCGGARIDETQPLRPANPRAFRRVSAERQLRAATVRGVLSARIVRIPGIYA 209

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLMTH-HLGGIFNLSDDEPAPP 218
             R P  ++ ++ +  L   + V+ N I  +D+A  +  ++       + + SDD     
Sbjct: 210 ANRLPVARL-KRGTPALEPADDVYTNHIHADDLAAILRRVVERGKPARVVHASDDTEWRM 268

Query: 219 QNVIMEAASLMKIT-PPLEQCFDTAN-ISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
                  A ++ +  PP     D    + P    F  +++R+SN ++K+ L   L YP 
Sbjct: 269 GEYFDRVAQVLGLPKPPRVSRADAERLLEPTLLSFMRESRRLSNTRLKAELCVTLRYPT 327


>gi|332285960|ref|YP_004417871.1| hypothetical protein PT7_2707 [Pusillimonas sp. T7-7]
 gi|330429913|gb|AEC21247.1| hypothetical protein PT7_2707 [Pusillimonas sp. T7-7]
          Length = 296

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 76/175 (43%), Gaps = 17/175 (9%)

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
           + S++++G  +  WVDE++ V      A    +AE    A+          LRLSG+YGP
Sbjct: 112 VGSSAVWGPCD-DWVDENTPVDKTDFRAMSLLDAEAALHALMPP--GAGVTLRLSGLYGP 168

Query: 162 KRNPFIKIRQKNSLRLVK-KNQVFNRIRVEDVAR-CVIFLMTHHLGGIFNLSDDEPAPPQ 219
            R   +   +  ++R         NRI ++D A+ CV  L       ++  +DD P P  
Sbjct: 169 GRMRLLNGLRAGTIRAPDGPGHWANRIHIDDAAQACVHLLAMSDPQPLYIGTDDHPMPTA 228

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            +    A L  I  PL          P  R   +  KR+SN ++++ G+   + N
Sbjct: 229 ELYDALARL--IGAPL----------PARRPQASSGKRLSNVRLRASGWAPKWSN 271


>gi|226227523|ref|YP_002761629.1| hypothetical protein GAU_2117 [Gemmatimonas aurantiaca T-27]
 gi|226090714|dbj|BAH39159.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 314

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 29  TTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS-SEGDPCII--SM 85
           + RS  ++  L    I+  L A   +  L         H+V C+ P+ + G+   +   +
Sbjct: 50  SARSEPDVSPLAPIAIAADLLAPTAMEMLHHLLPETADHLVVCVAPAFARGEDAAVYPQL 109

Query: 86  SKDFYKFMPH--VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAIT 143
           +        H  V+ + Y+SST IY   +G  VDE S + P S       +AE   LAI 
Sbjct: 110 AASAALLATHLRVRSVVYVSSTGIYDRTDGSDVDESSTITPDSPRVRALHDAE---LAIR 166

Query: 144 KKLNIKLAV--LRLSGIYGPKRNPFIKIRQKNS-LRLVKKNQVFNRIRVEDVARCVIFLM 200
           +      AV  LR +G+YGP R+P  +     S +         N +  +DV   +  L+
Sbjct: 167 QASGPHCAVQILRATGLYGPGRDPASRFTAMASHIDAAADGAWCNFVWRDDVVSAITHLI 226

Query: 201 THH---LGGIFNLSDDEP 215
           +     L  IFN +D  P
Sbjct: 227 SRQTPTLFEIFNCADGHP 244


>gi|78484793|ref|YP_390718.1| NAD-dependent epimerase/dehydratase [Thiomicrospira crunogena
           XCL-2]
 gi|78363079|gb|ABB41044.1| NAD dependent epimerase/dehydratase family protein [Thiomicrospira
           crunogena XCL-2]
          Length = 276

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 63/136 (46%), Gaps = 8/136 (5%)

Query: 152 VLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNL 210
           V+R  GIYGP R   I +  +     ++ +   NRI  ED    +  LM    L  I+  
Sbjct: 148 VVRFGGIYGPGRTYLIDLVLQGKAHCME-DVYSNRIHSEDCVGLLTHLMEQPALDPIYIG 206

Query: 211 SDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            DDEP     V    A  + ++  +E    T N S   R     NKR+SNAK+K+ G+  
Sbjct: 207 VDDEPTFTCEVYEWLAEQLSVSN-IEHLEPTEN-SRAQR----SNKRLSNAKVKATGYTF 260

Query: 271 LYPNYRISLKQLWKEI 286
            YP+YR    +L + +
Sbjct: 261 KYPSYREGYLELLESM 276


>gi|119356153|ref|YP_910797.1| NAD-dependent epimerase/dehydratase [Chlorobium phaeobacteroides
           DSM 266]
 gi|119353502|gb|ABL64373.1| NAD-dependent epimerase/dehydratase [Chlorobium phaeobacteroides
           DSM 266]
          Length = 274

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 93/216 (43%), Gaps = 22/216 (10%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL-FADQKINNLLREKLY 63
           I G G+ G  +A A +       G+T +  NL  ++  GI P+L + D ++N        
Sbjct: 8   ILGCGWLGMPLAKALIAQDYPVKGSTTNEDNLEAMRDAGIEPYLVWLDPEVNGEDITDFL 67

Query: 64  FTTHIVQCIKPSSEGDPCIISMSKDFYKFM------PHVKWIGYLSSTSIYGNREGQWVD 117
            +  ++  I P    D  I+    + +  +        V+ + ++SSTS+Y   + +  +
Sbjct: 68  QSDILIVNIPPERRDD--IVEYHIEQFSSLIDALGQSPVRSVLFVSSTSVYPALQREVTE 125

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E S V P +       + E+    + ++   +  V+R  G+ G  RNP     +KN  R+
Sbjct: 126 EDS-VEPEALSGQALLHVEE---MLMQETGFQTTVVRFGGLIGYDRNP-----EKNLARM 176

Query: 178 VK---KNQVFNRIRVEDVARCVI-FLMTHHLGGIFN 209
            +    +Q  N I  +D  R ++  +     G +FN
Sbjct: 177 TELKDPDQPMNLIHRDDCVRIIMEIIRLQQWGEVFN 212


>gi|170769797|ref|ZP_02904250.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           albertii TW07627]
 gi|170121411|gb|EDS90342.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           albertii TW07627]
          Length = 274

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LR
Sbjct: 103 HIPRIIFTSSTSVYGDVQGT-VKETTPRNPVTN-SGRVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+   
Sbjct: 159 LAGLVGPERHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC-- 213

Query: 214 EPA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
            PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+ 
Sbjct: 214 APAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEY 263

Query: 271 LYPN 274
            YP+
Sbjct: 264 QYPD 267


>gi|238789855|ref|ZP_04633636.1| hypothetical protein yfred0001_10060 [Yersinia frederiksenii ATCC
           33641]
 gi|238722051|gb|EEQ13710.1| hypothetical protein yfred0001_10060 [Yersinia frederiksenii ATCC
           33641]
          Length = 288

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 120/283 (42%), Gaps = 29/283 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFA--DQK 53
           + I G G+ G  +A + ++ G+   G+  +   +  ++  GI       +P L    D  
Sbjct: 17  IAIIGLGWLGLPLAQSLIRRGIQVVGSKTTPDGVEAVRMSGIDCYQLQLTPELICEPDDL 76

Query: 54  INNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREG 113
              +  + L  T    +  +  ++    +  +      F   V  I + SSTS+YG   G
Sbjct: 77  AQLMTADVLIITLPASRTTEGGAQYFQAVQMVVDSALAF--GVPRIIFTSSTSVYGETRG 134

Query: 114 QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
           + + E S + P++  A +     + WL      ++   +LRL+G+ G  R+P   +  K 
Sbjct: 135 R-IKESSPLQPVT-TAGKTLEELELWLHQLPHTSVD--ILRLAGLVGADRHPGRFLAGKT 190

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASLMKIT 232
           +++    +Q  N +  EDV   +  L+    GG I+NL   +    ++     A  +++T
Sbjct: 191 NVK--GGSQGVNLVHQEDVISAIELLLNLPKGGHIYNLCAPKHPRKRDFYPACARALQLT 248

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPN 274
           PP    F   +I    R        I  +KI S LGF+  YP+
Sbjct: 249 PPE---FAPEDIEEPIR-------EIDGSKICSELGFEYAYPD 281


>gi|222529140|ref|YP_002573022.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222455987|gb|ACM60249.1| NAD-dependent epimerase/dehydratase [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 305

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 96/242 (39%), Gaps = 45/242 (18%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP---FLFADQKINNLLR 59
           L+  GAG+ G  I D  ++ G   C     V NLL+     I+P   F   D + N    
Sbjct: 4   LVTGGAGFIGSHIVDKLIERGYDVC----VVDNLLSGNVCNINPKSKFYQLDIRDN---L 56

Query: 60  EKLYFTTHIVQCIKPSSEGDPCIISMSKDF-------------------YKFMPHVKWIG 100
           EK++    I  CI  +++     +S++K                     Y     VK   
Sbjct: 57  EKVFEENKIEYCIHQAAQ-----VSVAKSMEDSYLDCSINILGTVNLLDYCVKYKVKKFI 111

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS ++YG  +   +DE+  + P S     +  +E+       K + +  + R S +YG
Sbjct: 112 FASSAAVYGEPKYIPIDENHPLRPESFYGLSKLTSEEYIKMFAHKFHFEYIIFRYSNVYG 171

Query: 161 PKRNPFIK-----------IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFN 209
           P+++P  +           +  K+ +      Q  + I VEDVA      +   + G FN
Sbjct: 172 PRQDPCGEGGVVSIFCERMLGSKDVIIYGDGTQTRDFIYVEDVAEANCIALESSVSGTFN 231

Query: 210 LS 211
           LS
Sbjct: 232 LS 233


>gi|238757185|ref|ZP_04618372.1| hypothetical protein yaldo0001_10830 [Yersinia aldovae ATCC 35236]
 gi|238704563|gb|EEP97093.1| hypothetical protein yaldo0001_10830 [Yersinia aldovae ATCC 35236]
          Length = 275

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 103/228 (45%), Gaps = 22/228 (9%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFAD-QKI 54
           + I G G+ G  +A + ++ GV   G+  +   +   +  GI       +P L  D   +
Sbjct: 4   IAIIGLGWLGMPLAQSLVRRGVQVVGSKTTPDGVEAARMSGINCYQLQLTPELICDPDDL 63

Query: 55  NNLLR-EKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREG 113
             L+  + L  T    +    S++    +  +      F   V  I + SSTS+YG   G
Sbjct: 64  EQLMTVDALVITLPASRTTDGSAQYFQAVQMVVDSALAF--GVPRIIFTSSTSVYGETRG 121

Query: 114 QWVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
           + + E+S + P++     +  AE E WL   K  N  + +LRL+G+ G +R+P   +  K
Sbjct: 122 R-IKENSPLQPVTTAG--KTLAELELWLH--KLPNTSVDILRLAGLVGAERHPGRFLAGK 176

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQ 219
            +++    +Q  N +  EDV   +  L+    GG I+NL    PA P+
Sbjct: 177 TNVK--GGSQGVNLVHQEDVISAIELLLNLPRGGHIYNLC--APAHPR 220


>gi|312973743|ref|ZP_07787915.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 1827-70]
 gi|310332338|gb|EFP99573.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 1827-70]
          Length = 274

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      KN+          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKNA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|297719811|ref|NP_001172267.1| Os01g0261500 [Oryza sativa Japonica Group]
 gi|56783824|dbj|BAD81236.1| unknown protein [Oryza sativa Japonica Group]
 gi|56783987|dbj|BAD81442.1| unknown protein [Oryza sativa Japonica Group]
 gi|215678843|dbj|BAG95280.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|255673081|dbj|BAH90997.1| Os01g0261500 [Oryza sativa Japonica Group]
          Length = 175

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 7/137 (5%)

Query: 148 IKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT-HHLGG 206
           + L V   S +    ++  +  RQK+     +  Q   RI V D+ + ++  M+      
Sbjct: 27  MTLCVDYCSAVDTIAKSKSLSRRQKSR----ESKQYTARIHVADICQAILASMSIRSARR 82

Query: 207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIK-S 265
           I+N+ DD+PAP   V   A SL++   P     D+  +        A  KR+SNA++K  
Sbjct: 83  IYNVVDDDPAPRSEVFAFARSLVERKHP-GLIMDSVVLPATQDRIVAAEKRVSNARLKEE 141

Query: 266 LGFQLLYPNYRISLKQL 282
           LG +LL+P Y+  L+ +
Sbjct: 142 LGVKLLHPTYKSGLQSI 158


>gi|238920451|ref|YP_002933966.1| NAD-dependent epimerase/dehydratase [Edwardsiella ictaluri 93-146]
 gi|238870020|gb|ACR69731.1| NAD-dependent epimerase/dehydratase [Edwardsiella ictaluri 93-146]
          Length = 276

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 111/287 (38%), Gaps = 36/287 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS--PFLFADQ------KI 54
           + I G G+ G  +A + L  G    G+  +   +   +  G+   P L A Q       +
Sbjct: 4   VAIVGLGWLGMPLALSLLARGYQVVGSKTTPDGVEAARLSGVECYPLLLAPQLECDEEDL 63

Query: 55  NNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSIYG 109
             LLR      T    C    S+G    I+  +   + +      G     +LSSTS+YG
Sbjct: 64  AQLLRVDALVITLPANC---GSDGG---IAYRQAVRQLVDSALGYGVTRIIFLSSTSVYG 117

Query: 110 NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKI 169
           +  G+ V+E + +HP S       + E  WL      ++   VLRL+G+ G  R+P   +
Sbjct: 118 DVTGE-VNEDTPLHPTSQAGKALADLEC-WLHDLPHTSVD--VLRLAGLVGEGRHPGRFL 173

Query: 170 RQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAASL 228
             K  L     N   N +  +D    +  L+    GG I+NL        Q      A  
Sbjct: 174 AGKTDLP--DGNAGVNLLHRDDAIAAIQRLLEQSQGGHIYNLCAPHHPARQQFYPSLARA 231

Query: 229 MKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPN 274
           + + PP  +  D A          A  K +  ++I   LGF   Y +
Sbjct: 232 LGLMPPQFRATDEA---------LAPGKSVDGSRIHHELGFVYRYSD 269


>gi|207742591|ref|YP_002258983.1| nad-dependent epimerase/dehydratase protein [Ralstonia solanacearum
           IPO1609]
 gi|206593985|emb|CAQ60912.1| nad-dependent epimerase/dehydratase protein [Ralstonia solanacearum
           IPO1609]
          Length = 340

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVAT--QRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +  AT          W  +      + ++LR+ GI
Sbjct: 154 YASTSGVYGDCGGAWVDESRPVRPSTPRATRRVAAERRVRWFGVGG--GWRTSILRIPGI 211

Query: 159 YGPKRNPFIK-IRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM 200
           Y   R P  + +R   +LR  +++ VF N I  +D+AR VI  +
Sbjct: 212 YAADRLPEARLLRGTPALR--REDDVFTNHIHADDLARAVIAAL 253


>gi|260772667|ref|ZP_05881583.1| nucleoside-diphosphate-sugar epimerase [Vibrio metschnikovii CIP
           69.14]
 gi|260611806|gb|EEX37009.1| nucleoside-diphosphate-sugar epimerase [Vibrio metschnikovii CIP
           69.14]
          Length = 276

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 113/283 (39%), Gaps = 30/283 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + I GAG+ G+ +     +   Y C +  S+S +  L  +G+  F+        L+   L
Sbjct: 4   IAIIGAGWLGQPLIQHLKQQNYYVCASRTSLSGVEQLHAQGVEGFVCQLPDAPQLVEALL 63

Query: 63  YFTTH-IVQCIKPS-SEGDPCIISMSKDFY---KFMPHVKWIGYLSSTSIYGNREGQWVD 117
            F    ++ C  P   +G       S            ++ I  +SSTS+Y ++     +
Sbjct: 64  NFRCDALIGCFPPGFRKGHGTDYQASWQTLVNAAQQAGIRKIIMISSTSVYPDQAKTMRE 123

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKL----NIKLAVLRLSGIYGPKRNPFIKIRQKN 173
           E + +  + C     F+ + + +   ++      I+ A+LR SG+ GP R+P      + 
Sbjct: 124 EDASL--VQCEQNPMFSEKAKIMLCAEQAVIDSGIEYAILRCSGLIGPNRHP-----ARF 176

Query: 174 SLRL--VKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
           +LRL  V      N +   DV + + F ++     I N++   P          A+L  +
Sbjct: 177 ALRLSQVSDQAPANMVHQYDVLQAITFSLSEINNHIINVT--MPTTVSKAEFYRAALSAV 234

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
             P           P     +  +KRI + K+ ++GF   Y N
Sbjct: 235 QSP----------HPLPPIVHLPDKRIVSDKLITMGFHFHYAN 267


>gi|83746670|ref|ZP_00943719.1| Nucleoside-diphosphate-sugar epimerases [Ralstonia solanacearum
           UW551]
 gi|83726623|gb|EAP73752.1| Nucleoside-diphosphate-sugar epimerases [Ralstonia solanacearum
           UW551]
          Length = 355

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVAT--QRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +  AT          W  +      + ++LR+ GI
Sbjct: 169 YASTSGVYGDCGGAWVDESRPVRPSTPRATRRVAAERRVRWFGVGG--GWRTSILRIPGI 226

Query: 159 YGPKRNPFIK-IRQKNSLRLVKKNQVF-NRIRVEDVARCVI 197
           Y   R P  + +R   +LR  +++ VF N I  +D+AR VI
Sbjct: 227 YAADRLPEARLLRGTPALR--REDDVFTNHIHADDLARAVI 265


>gi|152978658|ref|YP_001344287.1| hypothetical protein Asuc_0984 [Actinobacillus succinogenes 130Z]
 gi|150840381|gb|ABR74352.1| conserved hypothetical protein [Actinobacillus succinogenes 130Z]
          Length = 267

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SSTS++G+  G++ DE     P +  A   F  E+    + +   I + +LR  G+ G
Sbjct: 109 FISSTSVFGDETGKF-DESCTPQPKTPAAKALFKVEQMLQHLQQ---IDVDILRFGGLIG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM 200
             R+P   +R  + LRL + N   N +  ED +R V  L+
Sbjct: 165 ADRHP---VRSMSGLRLKQGNTPVNLVHAEDCSRAVQLLL 201


>gi|209694942|ref|YP_002262871.1| hypothetical protein VSAL_I1420 [Aliivibrio salmonicida LFI1238]
 gi|208008894|emb|CAQ79105.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 262

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 118/289 (40%), Gaps = 55/289 (19%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF------ADQKINN 56
           + I G G+ G  +A   ++ G    G+ RS     +L    ++PF+        DQ+ + 
Sbjct: 4   ISILGCGWLGLPLAKQLVECGFSVKGSVRSEEKAHSLNEFSVTPFILNIDDATTDQQWDE 63

Query: 57  LLREKLYFTTHIVQCIKPSSEGDPCIIS-MSKDFYKFMPHVKWIGYLSSTSIYGNR---- 111
            L  ++     I+     +++G   +IS + K F      VK + ++SSTS+Y +     
Sbjct: 64  FLGSEIL----IIAIPSKNTDGFMSLISALEKSF------VKRVIFVSSTSVYKDTNDVV 113

Query: 112 -EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
            E +   + S ++ I  + TQ       + A T        V+R SG+ G  RNP  +  
Sbjct: 114 FESEAAQDSSTLYQIETLFTQSV-----FFATT--------VVRFSGLVGYSRNPG-RFF 159

Query: 171 QKNSLRLVKKNQVFNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLM 229
           QK+   +   +   + I  +D +      +  +  G  FN   D     +    E    +
Sbjct: 160 QKSGRSVSNPDAAVSMIHQDDCIGLIEQIIKQNQWGQTFNACADTHPTKREFYTEMTQRI 219

Query: 230 KITPPLEQCFDTANISPFTRFFYADN---KRISNAKIK-SLGFQLLYPN 274
            +  P               F  ++N   K ISN KIK +LG++ +YP+
Sbjct: 220 GVDTP--------------TFIESENQTFKLISNQKIKEALGYEFIYPD 254


>gi|330818051|ref|YP_004361756.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           gladioli BSR3]
 gi|327370444|gb|AEA61800.1| NAD dependent epimerase/dehydratase family protein [Burkholderia
           gladioli BSR3]
          Length = 353

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y S++ +YG+  G  +DE   V P +  A +R +AE +  A T +  +   ++R+ GIY 
Sbjct: 158 YASTSGVYGDCGGARIDETRPVRPANARAVRRVSAECQLRAATARGALSARIVRIPGIYA 217

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFN 185
             R P  ++ ++ +  LV  + V+ 
Sbjct: 218 ANRLPIARL-ERGTPALVDADDVYT 241


>gi|228994844|ref|ZP_04154641.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus pseudomycoides DSM 12442]
 gi|228764891|gb|EEM13648.1| NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid
           dehydrogenase [Bacillus pseudomycoides DSM 12442]
          Length = 304

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 108/258 (41%), Gaps = 36/258 (13%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISP-------FLFADQKIN 55
           L+  GAG+ G  I +  L+  +     T  V NL+T  HK   P       F   D  I+
Sbjct: 4   LVTGGAGFIGSHIVEFLLENNI----DTVVVDNLVT-GHKYNIPSKVAFYHFDIRDPNID 58

Query: 56  NL-LREKLYFTTH----------IVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSS 104
            + + EK  F  H          + Q     SE     +++ +   K+  +VK I Y S+
Sbjct: 59  KIFMVEKPDFVIHQAAQVSVQESVKQPFYDCSENVMATVNILQACIKY--NVKKIIYAST 116

Query: 105 TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRN 164
            ++YGN +   +DE+  ++P+S     +  +E       K   +K  +LR S +YG ++N
Sbjct: 117 AAVYGNPQYLPIDENHDLNPVSFYGLSKLTSEAYIQLFAKLYGLKYTILRYSNVYGARQN 176

Query: 165 P---------FIKIRQKNSLRLV--KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDD 213
                     F+    KN   ++    NQ  + I V+DVA        +    I N+S +
Sbjct: 177 TDGEAGVISIFMDRLFKNDSPIIYGDGNQTRDFIFVKDVAHANFLAFRNADNQICNISSN 236

Query: 214 EPAPPQNVIMEAASLMKI 231
           +      ++    +LMKI
Sbjct: 237 QQISVNELLDTICNLMKI 254


>gi|149191900|ref|ZP_01870133.1| hypothetical protein VSAK1_04322 [Vibrio shilonii AK1]
 gi|148834248|gb|EDL51252.1| hypothetical protein VSAK1_04322 [Vibrio shilonii AK1]
          Length = 280

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 117/287 (40%), Gaps = 40/287 (13%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
            +++ GAG+ G  +A A    G     T  SV  +  +   G+         I +   E+
Sbjct: 5   QILVVGAGWLGLPLAHALQSRGYKVIATRTSVEGVAEISQAGVDSLCLDLNAIRSE-EEE 63

Query: 62  LYFTTH--------IVQCIKPS-SEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSI 107
           L  T          I+ C  P   +G   +   +  + + +   K IG      +SS+S+
Sbjct: 64  LTLTDQLIKKQINVIIGCFPPGFRQGGGAL--YASQWAQLVQVAKRIGVEKIIMISSSSV 121

Query: 108 YGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIK-----LAVLRLSGIYGPK 162
           Y  R  + + E     PI+    + F+A K  + +T + +++       ++R SG++GP 
Sbjct: 122 YPER-AEIMTEDMARLPIA-KGREGFSA-KSIIMLTAEEHVRNSTLDYVIVRCSGLFGPN 178

Query: 163 RNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVI 222
           R+P    R  + L+ V      N + ++D    +IF + H    + N +   P     V 
Sbjct: 179 RHPS---RFASKLKTVSDQASANMLHLDDAVGAIIFCLEHVDASVVNAT--TPETCDKVT 233

Query: 223 MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQ 269
              A+L  +   L+   +  N  P        +K IS+ K++ LG+ 
Sbjct: 234 FYRAALRSVG--LDTSLNLVNSEP--------DKTISSEKLQGLGYH 270


>gi|261346788|ref|ZP_05974432.1| ADP-glyceromanno-heptose 6-epimerase [Providencia rustigianii DSM
           4541]
 gi|282565186|gb|EFB70721.1| ADP-glyceromanno-heptose 6-epimerase [Providencia rustigianii DSM
           4541]
          Length = 312

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SS + YG R   +++E  F  P++     +F  ++   +I  +   ++   R   +YG
Sbjct: 113 YASSAATYGGRSDNFIEEREFEKPLNVYGYSKFQFDQYVRSILPEAQSQVCGFRYFNVYG 172

Query: 161 PKRNP-----------FIKIRQKNSLRLVKKNQVFNR--IRVEDVARCVIFLMTHHLGGI 207
           P  N              +I +  S +L + ++ F R  I V DVA   ++   H++ GI
Sbjct: 173 PNENHKGSMASVAYHLNKQINEGQSPKLFEGSETFRRDFIYVGDVAAVNLWFWEHNVSGI 232

Query: 208 FN 209
           FN
Sbjct: 233 FN 234


>gi|260549853|ref|ZP_05824069.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter sp. RUH2624]
 gi|260407103|gb|EEX00580.1| nucleoside-diphosphate-sugar epimerase [Acinetobacter sp. RUH2624]
          Length = 271

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 116/290 (40%), Gaps = 52/290 (17%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRS----------VSNLLTLKHKGISPFLFA 50
           MH++  G G T + +A    + G      +RS          V ++ TL    I+P    
Sbjct: 1   MHILFIGYGKTSQRVAKQLFETGHQITTISRSEKTDPYGKHLVQDIFTLDLSEIAPVDVV 60

Query: 51  DQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
              ++        +    V  I+P  +             K  P VK +  +SST +YG 
Sbjct: 61  YILLSPDDSTVQGYQHTYVDSIEPIRQA-----------LKSHP-VKRLIVVSSTRVYGE 108

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIR 170
             G+ +++ S +HP         N E  W    K    +  ++R +GIYG   +     R
Sbjct: 109 NSGETINDDSEIHPNDAQGHILHNMELLW---QKYFPAQCVIVRPTGIYGTSID-----R 160

Query: 171 QKNSLRLVKKNQVF------NRIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAPPQNVIM 223
            K   R+ +  Q +      NRI ++D+AR + FL         + ++++ P P   V++
Sbjct: 161 LK---RMAENTQSYPNIHYSNRIHIDDLARFLAFLADFEKPHKSYLVANNAPVPLHEVLL 217

Query: 224 EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
              S + +  PL    D+A++S          K+I    +   GFQL +P
Sbjct: 218 WFQSQLDL--PL-LTLDSAHVS---------GKKIYAKHLFETGFQLEHP 255


>gi|124266320|ref|YP_001020324.1| putative oxidoreductase [Methylibium petroleiphilum PM1]
 gi|124259095|gb|ABM94089.1| putative oxidoreductase protein [Methylibium petroleiphilum PM1]
          Length = 302

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 121/289 (41%), Gaps = 18/289 (6%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L++ G G  G+ +  A L             S L  L+  G  P L    +   L R   
Sbjct: 17  LLVVGCGDVGQRVL-AQLGGRYRVAALASQPSRLQALRALGARPLLGDLDRPATLGRLG- 74

Query: 63  YFTTHIVQCIKP--SSEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHS 120
                ++    P  S EGDP  +++ +   +     + I Y S++ +YG+  G   DE  
Sbjct: 75  ALAPRVLHLAPPPGSGEGDPRTVALLRALARGG-VTRRIVYGSTSGVYGDTGGARFDETR 133

Query: 121 FVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG---PKRNPFIKIRQKNSLRL 177
            V P +  A +R  AE +     +   +++ +LR+ GIY    P   P  ++ +   +  
Sbjct: 134 AVAPATARARRRVAAEAQLRWHGRACGVRVTLLRIPGIYATDRPGGAPRERVVRGTPVLA 193

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHHLG---GIFNLSDDEPAPPQ---NVIMEAASLMKI 231
             ++   N I  +D+ARC I  +  H G    + + SDD         +++ + A L + 
Sbjct: 194 AHEDVYTNHIHADDLARCCIAAL--HRGRPQRVVHASDDTEMKMGDYFDLVADLAGLPR- 250

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYPNYRISL 279
            P + +      ISP    F ++++R+ N ++ + L   L YP  R  L
Sbjct: 251 PPRITRAAAGEAISPVGLSFMSESRRLLNRRLHEELRVVLRYPTVREGL 299


>gi|45656903|ref|YP_000989.1| hypothetical protein LIC11017 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600140|gb|AAS69626.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 260

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 96/242 (39%), Gaps = 72/242 (29%)

Query: 1   MHLMIFGAGYTGKFIAD-----AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN 55
           M + IFG GYTG  IAD       +++  ++  T          + KG   F F++  + 
Sbjct: 1   MKIGIFGLGYTGVRIADLLKSQTGIELNTFSANT----------QIKGTLIFDFSNAVVL 50

Query: 56  NLLREK-------LYFTTHIVQCIKPSSEGDPCIISMSKD--------FYKFMPHVKWIG 100
               EK       L   T  VQ +   +     + S+SK+         YK +P +    
Sbjct: 51  KQFSEKFSKNSFDLSLVTFPVQKLSDPTAFLDVLFSVSKNSILLGTTSIYKRIPDI---- 106

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
            + ST I  + +                   RF  E +WL    K      +LRL GIYG
Sbjct: 107 -IESTPILKDHD-------------------RFVVETDWLRRGGK------ILRLCGIYG 140

Query: 161 PKRNPFIKIRQKNSLRLVKKN-QVFNRIRVEDVARCVIFLMT-------HHLGGIFNLSD 212
           P RNP   IR+     LVKKN +  N I  +DVA  +  L+          +  + NLSD
Sbjct: 141 PLRNPADWIRKG----LVKKNSRQLNLIHGDDVALTISLLIQKIQTAGWDMIPNVLNLSD 196

Query: 213 DE 214
           ++
Sbjct: 197 NQ 198


>gi|237806808|ref|YP_002891248.1| ADP-L-glycero-D-manno-heptose-6-epimerase [Tolumonas auensis DSM
           9187]
 gi|237499069|gb|ACQ91662.1| ADP-L-glycero-D-manno-heptose-6-epimerase [Tolumonas auensis DSM
           9187]
          Length = 317

 Score = 48.9 bits (115), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 62/146 (42%), Gaps = 31/146 (21%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SS + YG R   +++E  F  P++     +F  ++    I  + ++++  L+   +YG
Sbjct: 116 YASSAATYGGRNDNFIEERRFEQPLNVYGYSKFLFDEYVRRILPETDLQIVGLKYFNVYG 175

Query: 161 PKRNPFIKIRQKNSLRLVK---KNQVF---------------------NRIRVEDVARCV 196
           P+       + K S+  V     NQV                      + I VEDVA+ V
Sbjct: 176 PRE------QHKGSMASVAFHLNNQVLKGENVKLFEGCDGFPNGGQTRDFIYVEDVAKVV 229

Query: 197 IFLMTH-HLGGIFNLSDDEPAPPQNV 221
           ++ M H    GIFN    +  P QNV
Sbjct: 230 LWFMNHPDKSGIFNCGTGKAEPFQNV 255


>gi|148657967|ref|YP_001278172.1| NAD-dependent epimerase/dehydratase [Roseiflexus sp. RS-1]
 gi|148570077|gb|ABQ92222.1| NAD-dependent epimerase/dehydratase [Roseiflexus sp. RS-1]
          Length = 335

 Score = 48.9 bits (115), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 82/197 (41%), Gaps = 41/197 (20%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K  P++K + Y S+  IYG  +   VDE   +HP+      +   E   +       I+ 
Sbjct: 123 KHNPNLKLV-YASTRQIYGKPDYLPVDERHLLHPVDVNGVNKMAGEWYHILYNNVYGIRA 181

Query: 151 AVLRLSGIYGPK------RNPFIKIRQKNSLRLVKKN--QVF---NRIR----VEDVARC 195
             LRL+  YGP+      R  F+ I  K   RL+ +   QVF   ++IR    V+DV   
Sbjct: 182 CALRLTNTYGPRMRVKDARQTFLGIWIK---RLIDEEPIQVFGDGSQIRDFNYVDDVVEA 238

Query: 196 VIFLMTHHL--GGIFNLSDDEPAPPQNVIMEAASLMKIT----------PPLEQCFDTAN 243
           ++         GGIFNL  DE    +++   AA L+ I           PP  +  D  +
Sbjct: 239 LLLAGASSAADGGIFNLGSDETINLRDL---AALLIDINGGGSFEIVPFPPDRKAIDIGD 295

Query: 244 ISPFTRFFYADNKRISN 260
                  +YAD + I  
Sbjct: 296 -------YYADYRLIQG 305


>gi|305665512|ref|YP_003861799.1| hypothetical protein FB2170_04415 [Maribacter sp. HTCC2170]
 gi|88710268|gb|EAR02500.1| hypothetical protein FB2170_04415 [Maribacter sp. HTCC2170]
          Length = 267

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 87/203 (42%), Gaps = 16/203 (7%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL--FADQKINNLLRE 60
           + + G G+ G  +    +  G    G+T S S +  L   GI PF+   ++  I   + +
Sbjct: 5   IAVMGCGWLGLPLGKRLVDEGYLVHGSTTSESKIDKLSKTGIKPFVIDLSENIIKGPISQ 64

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSK------DFYKFMPHVKWIGYLSSTSIYGNREGQ 114
            L     ++  I P   G+     +SK        YK    V  + ++SSTS+YG   G+
Sbjct: 65  FLTNVGVLIINIPPKLRGEHVENYVSKMELVLEVLYK--SAVTKVIFVSSTSVYGEVSGE 122

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
            V E +   PI+    Q   +E  + + T+    K  ++R  G+ GP R+P   +  +  
Sbjct: 123 -VTEDTVPQPITESGRQLLASENLFKSSTR---FKTTIIRFGGLIGPNRHPINTLAGRKG 178

Query: 175 LRLVKKNQVFNRIRVEDVARCVI 197
           L+    N   N + ++D    ++
Sbjct: 179 LK--NGNYPVNLVHLDDCIEIMV 199


>gi|156740225|ref|YP_001430354.1| NAD-dependent epimerase/dehydratase [Roseiflexus castenholzii DSM
           13941]
 gi|156231553|gb|ABU56336.1| NAD-dependent epimerase/dehydratase [Roseiflexus castenholzii DSM
           13941]
          Length = 334

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 84/195 (43%), Gaps = 41/195 (21%)

Query: 91  KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL 150
           K  P++K + Y S+  IYG  +   VDE   +HP+      +   E   +      +I+ 
Sbjct: 123 KHNPNLKLV-YASTRQIYGKPDYLPVDERHLLHPVDVNGVNKMAGEWYHILYNNVYSIRA 181

Query: 151 AVLRLSGIYGPK------RNPFIKIRQKNSLRLVKKN--QVF---NRIR----VEDVARC 195
             LRL+  YGP+      R  F+ I  K   RL+ +   QVF   ++IR    V+DV   
Sbjct: 182 CALRLTNTYGPRMRVKDARQTFLGIWIK---RLIDEEPIQVFGDGSQIRDFNYVDDVVEA 238

Query: 196 VIFLMTHHL--GGIFNLSDDEPAPPQNVIMEAASLMKIT----------PPLEQCFDTAN 243
           ++         GGIFNL  DE    +++   AA L++I           PP  +  D  +
Sbjct: 239 MLLAGASPAADGGIFNLGSDETINLRDL---AALLVEINGGGSFEIVPFPPDRKVIDIGD 295

Query: 244 ISPFTRFFYADNKRI 258
                  +YAD + I
Sbjct: 296 -------YYADYRMI 303


>gi|327394421|dbj|BAK11843.1| protein YeeZ precursor [Pantoea ananatis AJ13355]
          Length = 275

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 94/223 (42%), Gaps = 28/223 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A A    G +  G+  +   +   +  G+       +P L  D +  
Sbjct: 4   VAIVGLGWLGMPLAMALSARGWHVTGSKTTPDGVEAARRCGLDAFQLELTPDLICDAEDL 63

Query: 56  NLLREKLYFTTHIVQCIKPSSE----GDPCIISMSKDFYKFMPH-VKWIGYLSSTSIYGN 110
           ++L     F    +    P+S     GD  + ++       + H V  I + SSTS+YG 
Sbjct: 64  DVL-----FDVDALVVTLPASRTAEGGDAYVQAVQNVVDTALAHSVPRIIFTSSTSVYGG 118

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--FIK 168
             G    E S + P +       + E  WL      ++   VLRL+G+ GPKR+P  F+ 
Sbjct: 119 SSGIKT-EKSLLQPETTAGKTLVDLEN-WLHDLPGTSVD--VLRLAGLVGPKRHPGRFLA 174

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL 210
            +Q     L   +   N + ++DV   ++ L+    GG  FNL
Sbjct: 175 GKQA----LPNGSHGVNLVHLDDVVEAIMLLLQTPRGGRTFNL 213


>gi|17547152|ref|NP_520554.1| oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17429454|emb|CAD16140.1| putative nad-dependent epimerase/dehydratase protein [Ralstonia
           solanacearum GMI1000]
          Length = 341

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 81/181 (44%), Gaps = 10/181 (5%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPIS--CVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P +   +          W  +      + ++LR+ GI
Sbjct: 155 YASTSGVYGDCGGAWVDETRPVRPATPRAMRRVAAERRVRWFGVGG--GWRTSILRIPGI 212

Query: 159 YGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCVI-FLMTHHLGGIFNLSDDEPA 216
           Y   R P  ++ Q+ +  L +++ VF N I  +D+AR +I  L       + ++SD    
Sbjct: 213 YAGDRLPEARL-QRGTPALRREDDVFTNHIHADDLARALIAALFRGRPQRVVHVSDATEL 271

Query: 217 PPQNV--IMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQLLYP 273
              +    + AA  +   P + +      + P    F ++++R+ + ++ + L   L YP
Sbjct: 272 RMGDYFDAVAAARGLPRPPRIARAEAVRQLEPALLSFMSESRRLRSVRLARELRLALRYP 331

Query: 274 N 274
            
Sbjct: 332 T 332


>gi|110597641|ref|ZP_01385926.1| NAD-dependent epimerase/dehydratase:6-phosphogluconate
           dehydrogenase, NAD-binding [Chlorobium ferrooxidans DSM
           13031]
 gi|110340761|gb|EAT59238.1| NAD-dependent epimerase/dehydratase:6-phosphogluconate
           dehydrogenase, NAD-binding [Chlorobium ferrooxidans DSM
           13031]
          Length = 271

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 90/218 (41%), Gaps = 22/218 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLF-ADQKINNLLREK 61
           + I G G+ G  +A A +K G    G+TR   NL  L+  GI P+L   D+++N    E+
Sbjct: 6   ITILGCGWLGLPLAKALIKEGYAVKGSTRREENLEQLRDAGIEPYLVEVDREVNG---EE 62

Query: 62  L--YFTTHIVQCIKPSSEGDPCIISMSKDFYKFM-----PHVKWIGYLSSTSIYG--NRE 112
           +  +  + I+    P    D  I      F   +       V+ + ++SSTS+Y   NRE
Sbjct: 63  IADFLQSDILVINIPPERRDDIIEYHIAQFSSLIDALGQSQVRSVLFVSSTSVYASLNRE 122

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
              V E     P S         E+    + ++   +  V+R  G+ G  R+P   +   
Sbjct: 123 ---VTEEDAGTPESLAGEALLLVEE---MLMQERGFQTTVVRFGGLVGYDRSPEKYLGGM 176

Query: 173 NSLRLVKKNQVFNRIRVEDVARCVI-FLMTHHLGGIFN 209
             +     +Q  N I  +D  + +   +     G +FN
Sbjct: 177 KEIS--NPDQPMNLIHQDDCVKIISEIIRLQQWGEVFN 212


>gi|24215778|ref|NP_713259.1| hypothetical protein LA_3079 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24196962|gb|AAN50277.1|AE011470_1 hypothetical protein LA_3079 [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 260

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 96/242 (39%), Gaps = 72/242 (29%)

Query: 1   MHLMIFGAGYTGKFIAD-----AALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKIN 55
           M + IFG GYTG  IAD       +++  ++  T          + KG   F F++  + 
Sbjct: 1   MKVGIFGLGYTGVRIADLLKSQTGIELNTFSANT----------QIKGTLIFDFSNAVVL 50

Query: 56  NLLREK-------LYFTTHIVQCIKPSSEGDPCIISMSKD--------FYKFMPHVKWIG 100
               EK       L   T  VQ +   +     + S+SK+         YK +P +    
Sbjct: 51  KQFSEKFSKNSFDLSLVTFPVQKLSDPTAFLDILFSVSKNSILLGTTSIYKRIPDI---- 106

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
            + ST I  + +                   RF  E +WL    K      +LRL GIYG
Sbjct: 107 -IESTLILKDHD-------------------RFAVETDWLRRGGK------ILRLCGIYG 140

Query: 161 PKRNPFIKIRQKNSLRLVKKN-QVFNRIRVEDVARCVIFLMT-------HHLGGIFNLSD 212
           P RNP   IR+     LVKKN +  N I  +DVA  +  L+          +  + NLSD
Sbjct: 141 PLRNPADWIRKG----LVKKNSRQLNLIHGDDVALTISLLIQKIQTAGWDMIPNVLNLSD 196

Query: 213 DE 214
           ++
Sbjct: 197 NQ 198


>gi|331663514|ref|ZP_08364424.1| protein YeeZ [Escherichia coli TA143]
 gi|284922015|emb|CBG35093.1| putative exported protein [Escherichia coli 042]
 gi|331059313|gb|EGI31290.1| protein YeeZ [Escherichia coli TA143]
          Length = 274

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 83/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL-SDDEPAPP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+ + D PA  
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNICAPDHPA-- 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|293610811|ref|ZP_06693111.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827155|gb|EFF85520.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 271

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 80/181 (44%), Gaps = 22/181 (12%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK I  +SST +YG   G+ +D+ S +HP         N E  W    K    +  ++R 
Sbjct: 94  VKKIIVVSSTRVYGENAGEIIDDFSEIHPNDAQGHILRNMELFW---QKYYPTQSVIVRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM---THHLGGIFNLSD 212
           +GIYG       K+ + +  +        NRI ++D+AR + F+    +H    I  +++
Sbjct: 151 TGIYGTSIARLKKMAENH--QSYPNIHYSNRIHIDDLARFLAFMADYESHQASYI--VTN 206

Query: 213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
           ++P P   VI+     + +    E   ++  IS          KRI    + + GFQL +
Sbjct: 207 NQPLPLHEVIVWFQKKLGLP---ELTLESNQIS---------GKRIYAKHLSTTGFQLEH 254

Query: 273 P 273
           P
Sbjct: 255 P 255


>gi|288549830|ref|ZP_06390816.1| protein YeeZ [Enterobacter cancerogenus ATCC 35316]
 gi|288317559|gb|EFC56497.1| protein YeeZ [Enterobacter cancerogenus ATCC 35316]
          Length = 276

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 17/181 (9%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YGN  G    E +  HP++  + Q     ++WL       +   +LR
Sbjct: 105 HIPRILFTSSTSVYGNIHGT-AKETTERHPVTA-SGQVLKELEDWLHNLPGTQVD--ILR 160

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP R+P      K++       Q  N + ++DV   +  L+    GG I+N+   
Sbjct: 161 LAGLVGPGRHPGRFFAGKSA---PDGQQGVNLVHLDDVIGAIELLLQAPKGGHIYNICAP 217

Query: 214 EPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYP 273
                Q      A  + + PP+   F +       +    D  RI +     LGF+  YP
Sbjct: 218 SHPARQTFYPLMARQLGLAPPV---FSSEGGEGKGKII--DGNRICH----ELGFEYQYP 268

Query: 274 N 274
           +
Sbjct: 269 D 269


>gi|113868977|ref|YP_727466.1| nucleoside-diphosphate-sugar epimerase [Ralstonia eutropha H16]
 gi|113527753|emb|CAJ94098.1| Nucleoside-diphosphate-sugar epimerase [Ralstonia eutropha H16]
          Length = 335

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 78  GDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK 137
           G+P I+       +  P   ++ Y S++ +YG+R+G  V E   V P +  A +R  AE+
Sbjct: 134 GEPAILP-----DRGRPRAAFV-YASTSGVYGDRQGARVSEFHAVRPQTARARRRVAAEQ 187

Query: 138 EWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVF-NRIRVEDVARCV 196
                 +    + +++R+ GIY   R P  ++  + +  LV ++ V+ + I  +D+AR +
Sbjct: 188 AVRGFGRDAGWRASIVRIPGIYAEDRLPLARL-HRGTPALVPQDDVYTSHIHADDLARTM 246

Query: 197 I-FLMTHHLGGIFNLSDD 213
           +  L       + + SDD
Sbjct: 247 VAALFRGRAQRVVHASDD 264


>gi|260060970|ref|YP_003194050.1| hypothetical protein RB2501_05215 [Robiginitalea biformata
           HTCC2501]
 gi|88785102|gb|EAR16271.1| Hypothetical enzyme of sugar metabolism [Robiginitalea biformata
           HTCC2501]
          Length = 284

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 73/184 (39%), Gaps = 19/184 (10%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF--LFADQKINNLLRE 60
           + I G G+ G  +A   L+ G    GTT     L  L++ GI  F  +  +       RE
Sbjct: 19  IGILGCGWLGFPLAGRLLESGYSVRGTTTRAEKLDKLENAGIRAFQVVLTETGFTGDWRE 78

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH---------VKWIGYLSSTSIYGNR 111
            L     +V  I P    +P       D+   + H         V  + Y+ STS+YG  
Sbjct: 79  FLQGLDLLVCNIPPGIRANP-----QTDYPAKIRHLVRALEDHGVPRLIYIGSTSVYGRS 133

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
           +G  VDE +   P S    Q   AE+   A    L     +LR  G+ GP R+P   +  
Sbjct: 134 QG-VVDEAAEPEPDSESGRQLLRAEEILRA--SPLAGSSLILRFGGLIGPNRHPVTMLSG 190

Query: 172 KNSL 175
           +  L
Sbjct: 191 RTGL 194


>gi|261343389|ref|ZP_05971034.1| NAD dependent epimerase/dehydratase family protein [Providencia
           rustigianii DSM 4541]
 gi|282568531|gb|EFB74066.1| NAD dependent epimerase/dehydratase family protein [Providencia
           rustigianii DSM 4541]
          Length = 274

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 104/247 (42%), Gaps = 29/247 (11%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA--------DQKI 54
           + I G G+ G  +A+A +  G+   GT      +   +  GI  +            + +
Sbjct: 4   ITIIGLGWLGLPLANALMAQGMRVTGTKTHADGVEAARAVGIDCYKLQLTPNIQCNSEDL 63

Query: 55  NNLLREKLYFTTHIVQCIKPS----SEGDPCIISMSKDFYKFMPHVKWIGYLSSTSIYGN 110
           N L+++    +  +V  + PS    SE    I  +      +   +  I + SSTS+YG+
Sbjct: 64  NQLMKD----SDVMVILLPPSKVTLSEYVLAIEQLVDSAIAY--KIPRIIFTSSTSVYGD 117

Query: 111 REGQWVDEHSFVHPI--SCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIK 168
             G  +DE S   P+     + +   A + W+      NI++ VLRL+G+ G KR+    
Sbjct: 118 VNG-VIDEES---PLLGETASARALIAVEHWMHGLP--NIRVDVLRLAGLVGEKRHAGRF 171

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEAAS 227
           +  K  ++    NQ  N +  +DV   +I L+    GG  +NL   E    +      A 
Sbjct: 172 LAGKQQVK--GGNQPVNMVHQDDVISAIILLIQQSEGGNTYNLCAPEHPTRKQFYTHMAQ 229

Query: 228 LMKITPP 234
            + + PP
Sbjct: 230 SIGLVPP 236


>gi|148652331|ref|YP_001279424.1| NAD-dependent epimerase/dehydratase [Psychrobacter sp. PRwf-1]
 gi|148571415|gb|ABQ93474.1| NAD-dependent epimerase/dehydratase [Psychrobacter sp. PRwf-1]
          Length = 296

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 91/225 (40%), Gaps = 27/225 (12%)

Query: 4   MIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLY 63
           +I G G  G  + +   +  +   G  R       L  +  + +L AD     L  E+LY
Sbjct: 18  LIIGQGDIGLAVTNVLAQQQLKVTGLARGERQSYDLNEQ--ADYLQADAL--TLTAEQLY 73

Query: 64  FTTHIVQCIKPSSEGDP-------CIISMSKDFYKFMPHVKWIGYLSSTSIYGNREGQWV 116
             THI   + P              +     +    +P ++ + ++SST +YG  +G+W+
Sbjct: 74  QFTHIAIIVTPDGYETKNYKHTYLGVAQHVANLADQLPKLQRVVFISSTGVYGQDKGEWI 133

Query: 117 DEHSF-VHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSL 175
           D+    V P    +     AE+   A+ +    +  ++R SGIYG +R   +++RQ    
Sbjct: 134 DDTVVPVAPKREASKYILQAEQ---ALQQVFAERAVIIRPSGIYGEQR--LMRLRQAKEA 188

Query: 176 RLVKK--NQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPP 218
                  +   NRI   D+   ++ ++T        LS  EP  P
Sbjct: 189 DKAPMPVSAWTNRIMDTDLVTIIVKVLT--------LSASEPIAP 225


>gi|239637688|ref|ZP_04678658.1| VI polysaccharide biosynthesis protein VipB/tviC [Staphylococcus
           warneri L37603]
 gi|239596713|gb|EEQ79240.1| VI polysaccharide biosynthesis protein VipB/tviC [Staphylococcus
           warneri L37603]
          Length = 309

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 127/319 (39%), Gaps = 67/319 (21%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL----FADQKINNLL 58
           L+  GAG+ G  IA   L+  +        + NL T + + I P++    F  + INNL 
Sbjct: 4   LITGGAGFIGSHIAHKCLQNNI----EVHVIDNLSTGRIENI-PYVKKEYFYQEDINNLK 58

Query: 59  -------REKLYFTTH------IVQCIKPSSEGDPCIISMSKDFYKFM----PHVKWIGY 101
                  +E+  +  H      +V+ ++     +   I  + +  + +     +VK   +
Sbjct: 59  FVSDLIKKEQFDYVIHLAAVVSVVETVQQPGRSNQVNIDATLNILETLRLQHSNVKRFLF 118

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
            SS ++YG  EG     HS + P S  A Q++  E       +   +    LR   +YGP
Sbjct: 119 ASSAAVYGQLEGLPKAIHSRIDPRSPYAVQKYAGESYAKIYHQLYQLPTVSLRFFNVYGP 178

Query: 162 KRNPFI-----------KIRQKNSLRLVKKN-QVFNRIRVED-VARCVIFLMTHHL-GGI 207
           K+NP+            K + K +        Q  + I ++D V  C + L   ++ G +
Sbjct: 179 KQNPYSDYSGVISILNHKFKHKETFTFYGDGLQTRDFIYIDDLVEACWLVLHNDNVNGNV 238

Query: 208 FNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAK----- 262
           +NL             +  +L ++    EQ F+      ++  +  D +R+ + K     
Sbjct: 239 YNLGTG----------KQTTLKQMVNIFEQHFN------YSIPYVYDEERVGDIKHSYAD 282

Query: 263 ---IKSLGFQLLYPNYRIS 278
              I+SLGF    P Y + 
Sbjct: 283 ISPIQSLGFN---PQYSVE 298


>gi|320177923|gb|EFW52907.1| NAD dependent epimerase/dehydratase family protein [Shigella boydii
           ATCC 9905]
          Length = 274

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 84/179 (46%), Gaps = 25/179 (13%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE-KEWLAITKKLNIKLAVLRLSGIY 159
           + SSTS+YG+ +G  V E +  +P++   ++R   E ++WL      ++   +LRL+G+ 
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVT--NSERVLEELEDWLHNLPGTSVD--ILRLAGLV 163

Query: 160 GPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-P 217
           GP R+P      K +          N + +EDV   +  L+    GG I+N+    PA P
Sbjct: 164 GPGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHP 218

Query: 218 PQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
            +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 219 ARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|193071572|ref|ZP_03052480.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E110019]
 gi|194428757|ref|ZP_03061293.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli B171]
 gi|218558897|ref|YP_002391810.1| epimerase, with NAD(P)-binding Rossmann-fold domain [Escherichia
           coli S88]
 gi|260868736|ref|YP_003235138.1| putative epimerase [Escherichia coli O111:H- str. 11128]
 gi|192955109|gb|EDV85604.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E110019]
 gi|194413204|gb|EDX29490.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli B171]
 gi|218365666|emb|CAR03403.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli S88]
 gi|257765092|dbj|BAI36587.1| predicted epimerase [Escherichia coli O111:H- str. 11128]
 gi|323177083|gb|EFZ62673.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 1180]
          Length = 274

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTSRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|157374880|ref|YP_001473480.1| NAD-dependent epimerase/dehydratase [Shewanella sediminis HAW-EB3]
 gi|157317254|gb|ABV36352.1| NAD-dependent epimerase/dehydratase [Shewanella sediminis HAW-EB3]
          Length = 286

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 118/289 (40%), Gaps = 49/289 (16%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF----------------- 47
           I G G+ G  +A A +K G    G+ RS+     L H GIS F                 
Sbjct: 8   IVGCGWFGLPLAKALVKQGYIVSGSKRSMEGAAALTHDGISGFGLDLDKQQFNGNVVGES 67

Query: 48  -LFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYK-FMPHVKW--IGYLS 103
            L  D+    +LR++L  T  I+  I P+    P        F K  M   ++  I ++S
Sbjct: 68  ELGFDESTLAMLRQRLR-TDAIIINIPPAIVKSPGAYQQRLSFLKRLMAQHEYMRIIFVS 126

Query: 104 STSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKL---AVLRLSGIYG 160
           +T +Y           S VHP++       +A  E L   +KL  +L    ++R +G+ G
Sbjct: 127 TTGVY----------PSSVHPVTESDAAPHSASSEVLLAAEKLFSELPNACIIRFAGLVG 176

Query: 161 PKRNP--FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMT-HHLGGIFNLSDDEPAP 217
           P+R+P  F+  +Q     L  +    N + ++D    V  L++   L  ++N+   +   
Sbjct: 177 PERHPGRFLAGKQN----LPGRESPVNLVHLDDCIGAVSCLLSAGSLSPVYNICARQHPG 232

Query: 218 PQNVIMEAASLMKITPP-------LEQCFDTANISPFTRFFYADNKRIS 259
            ++    AA  + +T P       + +C D   IS    F Y  N  ++
Sbjct: 233 RESFYSAAAKDISLTAPAFSDESQVGKCIDGTKISTELGFQYRYNDPLA 281


>gi|254478563|ref|ZP_05091937.1| NAD dependent epimerase/dehydratase family protein
           [Carboxydibrachium pacificum DSM 12653]
 gi|214035492|gb|EEB76192.1| NAD dependent epimerase/dehydratase family protein
           [Carboxydibrachium pacificum DSM 12653]
          Length = 311

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK I Y SS ++YGN E   +DE   ++PIS     +  AE  +   ++   +K  +LR 
Sbjct: 108 VKKIVYASSAAVYGNPEYLPIDEVHKINPISYYGISKHTAEHYFEVYSQLYGLKYTILRY 167

Query: 156 SGIYGPKRNP---------FIKIRQKNSLRLV--KKNQVFNRIRVEDVARCVIFLMTHHL 204
           + +YG +++P         FI    K    ++     Q  + + V+DVA+  +  +    
Sbjct: 168 ANVYGIRQDPKGEGGVISIFIDKMLKGERPIIFGDGKQTRDFVYVKDVAKANLLALKRGD 227

Query: 205 GGIFNLSDDEPA 216
             + N+S ++P 
Sbjct: 228 NEVVNISTNKPT 239


>gi|260910471|ref|ZP_05917140.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635417|gb|EEX53438.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 342

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 97/237 (40%), Gaps = 39/237 (16%)

Query: 3   LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREK 61
           +++ GA G+ G FI + AL  G+      R  S+   L+ K I    F +  +NN  R K
Sbjct: 4   ILVTGASGFIGSFIVEEALNRGMEVWAAVRKSSSKEYLQDKRIR---FVELDLNNAERLK 60

Query: 62  LYFTTHIVQCIKPSSEGDPCIISMSKDFYKF----------------MPHVKWIGYLSST 105
              + H    +  ++    C+     DFY+                 MP  +++ ++SS 
Sbjct: 61  SQLSGHHFDYVVHAAGATKCL--HRDDFYRVNTEGTKNLANAVIELKMPLKRFV-FISSL 117

Query: 106 SIYGN-REGQ---WVDEHSFVHPISCVATQRFNAEKEWLAITKK--------LNIKLAVL 153
           S++G  RE Q    + E     P +     +  AE+   ++  K        + +   VL
Sbjct: 118 SVFGPVREQQPYEEIQETDQPMPNTAYGHSKLLAEQYLDSLNPKNEDGEITDVVLPFIVL 177

Query: 154 RLSGIYGPKRNPFI----KIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG 206
           R +G+YGP+   +      I+Q     +  K Q    + V+DV + V   + H + G
Sbjct: 178 RPTGVYGPREKDYFLMAKSIKQHVDFAVGYKPQDITFVYVQDVVQAVFLALDHGMSG 234


>gi|304397401|ref|ZP_07379279.1| 6-phosphogluconate dehydrogenase NAD-binding [Pantoea sp. aB]
 gi|304355019|gb|EFM19388.1| 6-phosphogluconate dehydrogenase NAD-binding [Pantoea sp. aB]
          Length = 275

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 92/219 (42%), Gaps = 18/219 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPF---LFADQKINNLLR 59
           + I G G+ G  +A A    G    G+  +   +   +  GI  F   L  +   +    
Sbjct: 4   VAIVGLGWLGMPLATALTARGWQVTGSKTTPDGVEAARRCGIEAFQLELTPELLCDAADI 63

Query: 60  EKLYFTTHIVQCIKPS--SEGDPCIISMSKDFYK--FMPHVKWIGYLSSTSIYGNREGQW 115
           E L+    ++  +  S  +EG    +   ++      +  V  I + SSTS+YG   G  
Sbjct: 64  EPLFNVDALIVTLPASRTAEGGEAYLQAVQNVVDTALVYKVPRIIFTSSTSVYGGSSG-- 121

Query: 116 VDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--FIKIRQKN 173
           V   +       VA +     + WL      ++   +LRLSG+ GPKR+P  F+  +Q  
Sbjct: 122 VKRENSPLAAETVAGKTLVKLESWLHDLPGTSVD--ILRLSGLVGPKRHPGRFLAGKQD- 178

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLS 211
              +   +Q  N + ++DV   +  L+    GG I+NLS
Sbjct: 179 ---VANGSQGVNLVHLDDVVEAITLLLQLPKGGRIYNLS 214


>gi|204929067|ref|ZP_03220210.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204321611|gb|EDZ06810.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 274

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 21/177 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E++  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGV-VKENTPRNPVTA-SGRTLKELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGQHGVNLVHLEDVVGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   +   L+ I PP    F  A  +   +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMTRLLGIAPP---HFRDAPDNGKGKII--DGSRICN----ELGFEYQYPD 267


>gi|197334628|ref|YP_002156189.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri MJ11]
 gi|197316118|gb|ACH65565.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri MJ11]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 111/284 (39%), Gaps = 47/284 (16%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           + + G G+ G  +A   + +G    G+ RS S +  L+   I P+L     +     + L
Sbjct: 4   ISVLGCGWLGLPLAKHLIDIGFMVKGSIRSSSKISELEKNHIKPYLLDIDAVEQSWSQFL 63

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMP-----HVKWIGYLSSTSIYGNREGQWVD 117
                I+     + EG          F  F+P      +K + ++SSTS+Y +   + V 
Sbjct: 64  TSDVLIIAIPSKNIEG----------FTSFIPIIEASSIKHVLFVSSTSVYED-ANRVVT 112

Query: 118 EHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRL 177
           E     P S ++      E+ ++  TK       V+R SG+ G  RNP  +   K+   +
Sbjct: 113 EEGATIPFSALS----QIERLFMQSTK---FTTTVVRFSGLVGYSRNPG-RFFAKSGRSV 164

Query: 178 VKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNLSDDEPAPPQNVIMEAASLMKITPPL- 235
              +   N I  +D    +  ++       IFN   D     +    +A   + +  P  
Sbjct: 165 SNPDAPVNMIHQDDCIGLITQIIKQEKWNEIFNACADTHPSKREFYTQATQRIGVETPTF 224

Query: 236 ----EQCFDTANISPFTRFFYADNKRISNAKIK-SLGFQLLYPN 274
               EQ F                K ISN KIK +LG++ ++P+
Sbjct: 225 IESSEQTF----------------KIISNHKIKEALGYEFIHPD 252


>gi|162453146|ref|YP_001615513.1| NDP-sugar oxidoreductase [Sorangium cellulosum 'So ce 56']
 gi|161163728|emb|CAN95033.1| NDP-sugar oxidoreductase [Sorangium cellulosum 'So ce 56']
          Length = 312

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 51/125 (40%), Gaps = 10/125 (8%)

Query: 112 EGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF----- 166
           EGQ VDE +   P       +  A     A+ + L++ L  LRL G+YGP   P      
Sbjct: 133 EGQLVDEGAPRAPSDLYGAAKAAAHDYGRAVAQALSVPLVTLRLFGVYGPGEAPHRLIPH 192

Query: 167 --IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH---HLGGIFNLSDDEPAPPQNV 221
              ++R +  + L    Q  +   VEDV   ++   T      G  +N+    P   + V
Sbjct: 193 LGARLRARERVDLTAGTQRRDLTFVEDVVEALLLGATTAGIEPGAAYNVCSGRPTSVREV 252

Query: 222 IMEAA 226
            +E A
Sbjct: 253 CLEVA 257


>gi|189345796|ref|YP_001942325.1| NAD-dependent epimerase/dehydratase [Chlorobium limicola DSM 245]
 gi|189339943|gb|ACD89346.1| NAD-dependent epimerase/dehydratase [Chlorobium limicola DSM 245]
          Length = 269

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 110/273 (40%), Gaps = 34/273 (12%)

Query: 5   IFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA-DQKINNLLREKLY 63
           I G G+ G  +A + +K G    G+T S   L  L+  GI PFL   D +I+        
Sbjct: 8   ILGCGWLGLPLAGSLIKEGYSVKGSTTSEGKLDLLREAGIEPFLVTLDPEIDGEEFCDFL 67

Query: 64  FTTHIVQCIKPSSEGDPC-----IISMSKDFYKFMPHVKWIGYLSSTSIYG--NREGQWV 116
            +  +V  I PS   D        IS   D     P V+ + ++SSTS+Y   NRE   V
Sbjct: 68  QSDILVVNIPPSRREDIVEFHIQQISSLIDALGQSP-VRSVLFVSSTSVYPMLNRE---V 123

Query: 117 DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLR 176
            E   V P S       + E+    + ++   +  VLR  G+ G  R+P   + + + + 
Sbjct: 124 TEEDAVDPESPSGQALLHVEE---MLMQETGFQTTVLRFGGLTGYDRSPEKYLSRMSGIT 180

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMT----HHLGGIFNLSDDEPAPPQNVIMEAASLMKIT 232
            +  +Q  N    +D   CV  +M        G IFN         ++    AA    I 
Sbjct: 181 AL--DQPVNLTHRDD---CVNIIMEIIRLQQWGEIFNACSPMHPLKRDFYARAAETAGI- 234

Query: 233 PPLEQCFDTANISPFTRFFYADNKRISNAKIKS 265
            PL      +  SPF        K +S+ K++S
Sbjct: 235 -PLPPAISASEPSPF--------KLVSSRKLES 258


>gi|300690702|ref|YP_003751697.1| epimerase [Ralstonia solanacearum PSI07]
 gi|299077762|emb|CBJ50400.1| putative epimerase [Ralstonia solanacearum PSI07]
          Length = 341

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 42/197 (21%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPIS--CVATQRFNAEKEWLAITKKLNIKLAVLRLSGI 158
           Y S++ +YG+  G WVDE   V P++              W  ++     + ++LR+ GI
Sbjct: 155 YASTSGVYGDCGGAWVDETRPVRPVTPRAARRVAAERRVRWFGVSG--GWRTSILRIPGI 212

Query: 159 YGPKRNPFIK-IRQKNSLRLVKKNQVF-NRIRVEDVARCVIFLM--------TH------ 202
           Y   R P  + +R   +LR  +++ VF N I  +D+AR +I  +         H      
Sbjct: 213 YAGDRLPEARLLRGTPALR--REDDVFTNHIHADDLARALIAALFRGRPQRVVHVSDATE 270

Query: 203 -HLGGIFNLSDDE---PAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRI 258
             +G  F+   D    P PP+  I  A ++ ++ P L               F ++++R+
Sbjct: 271 LRMGDYFDAVADARGLPRPPR--IARADAVRQLEPALLS-------------FMSESRRL 315

Query: 259 SNAKI-KSLGFQLLYPN 274
            + ++ + L   L YP 
Sbjct: 316 RSVRLARELRLALRYPT 332


>gi|157155443|ref|YP_001463367.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E24377A]
 gi|187732624|ref|YP_001879861.1| NAD dependent epimerase/dehydratase family protein [Shigella boydii
           CDC 3083-94]
 gi|209919480|ref|YP_002293564.1| hypothetical protein ECSE_2289 [Escherichia coli SE11]
 gi|218695641|ref|YP_002403308.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli 55989]
 gi|293446375|ref|ZP_06662797.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli B088]
 gi|300926495|ref|ZP_07142289.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 182-1]
 gi|309797276|ref|ZP_07691671.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 145-7]
 gi|331677922|ref|ZP_08378597.1| protein YeeZ [Escherichia coli H591]
 gi|157077473|gb|ABV17181.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E24377A]
 gi|187429616|gb|ACD08890.1| NAD dependent epimerase/dehydratase family protein [Shigella boydii
           CDC 3083-94]
 gi|209912739|dbj|BAG77813.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218352373|emb|CAU98147.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli 55989]
 gi|291323205|gb|EFE62633.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli B088]
 gi|300417484|gb|EFK00795.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 182-1]
 gi|308119151|gb|EFO56413.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 145-7]
 gi|323948380|gb|EGB44365.1| NAD dependent epimerase/dehydratase [Escherichia coli H120]
 gi|324119046|gb|EGC12935.1| NAD dependent epimerase/dehydratase [Escherichia coli E1167]
 gi|331074382|gb|EGI45702.1| protein YeeZ [Escherichia coli H591]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|82543393|ref|YP_407340.1| enzyme of sugar metabolism [Shigella boydii Sb227]
 gi|191167740|ref|ZP_03029548.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli B7A]
 gi|256017808|ref|ZP_05431673.1| putative enzyme of sugar metabolism [Shigella sp. D9]
 gi|300920257|ref|ZP_07136703.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 115-1]
 gi|307138683|ref|ZP_07498039.1| putative enzyme of sugar metabolism [Escherichia coli H736]
 gi|307312418|ref|ZP_07592052.1| 6-phosphogluconate dehydrogenase NAD-binding [Escherichia coli W]
 gi|331642639|ref|ZP_08343774.1| protein YeeZ [Escherichia coli H736]
 gi|331653440|ref|ZP_08354441.1| protein YeeZ [Escherichia coli M718]
 gi|331668716|ref|ZP_08369564.1| protein YeeZ [Escherichia coli TA271]
 gi|332278830|ref|ZP_08391243.1| conserved hypothetical protein [Shigella sp. D9]
 gi|81244804|gb|ABB65512.1| putative enzyme of sugar metabolism [Shigella boydii Sb227]
 gi|190902253|gb|EDV61994.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli B7A]
 gi|300412759|gb|EFJ96069.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 115-1]
 gi|306907589|gb|EFN38092.1| 6-phosphogluconate dehydrogenase NAD-binding [Escherichia coli W]
 gi|315061291|gb|ADT75618.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli W]
 gi|323378129|gb|ADX50397.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Escherichia
           coli KO11]
 gi|331039437|gb|EGI11657.1| protein YeeZ [Escherichia coli H736]
 gi|331048289|gb|EGI20365.1| protein YeeZ [Escherichia coli M718]
 gi|331063910|gb|EGI35821.1| protein YeeZ [Escherichia coli TA271]
 gi|332092396|gb|EGI97469.1| NAD dependent epimerase/dehydratase family protein [Shigella boydii
           5216-82]
 gi|332097229|gb|EGJ02212.1| NAD dependent epimerase/dehydratase family protein [Shigella boydii
           3594-74]
 gi|332101182|gb|EGJ04528.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGM-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|324016966|gb|EGB86185.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 117-3]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|218554578|ref|YP_002387491.1| putative epimerase [Escherichia coli IAI1]
 gi|218361346|emb|CAQ98934.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli IAI1]
 gi|323936914|gb|EGB33197.1| NAD dependent epimerase/dehydratase [Escherichia coli E1520]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|152971013|ref|YP_001336122.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238895595|ref|YP_002920330.1| putative enzyme [Klebsiella pneumoniae NTUH-K2044]
 gi|330002109|ref|ZP_08304192.1| NAD dependent epimerase/dehydratase family protein [Klebsiella sp.
           MS 92-3]
 gi|150955862|gb|ABR77892.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238547912|dbj|BAH64263.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537454|gb|EGF63693.1| NAD dependent epimerase/dehydratase family protein [Klebsiella sp.
           MS 92-3]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 81/183 (44%), Gaps = 21/183 (11%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YGN  G  V E+S   P    + Q     ++WL      ++   +LR
Sbjct: 103 HIPRIVFTSSTSVYGNVNGT-VKENSPRLP-QTASGQVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP R+P      K++        V N + ++DV   +  L+    GG I+NL   
Sbjct: 159 LAGLVGPSRHPGRFFAGKSA---PDGQHVVNLVHLQDVVAAIELLLQAPKGGHIYNLC-- 213

Query: 214 EPAPPQNVIM--EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
            P  P   +   + A  + + PP+   F  +      +    D  RI N     LGF+  
Sbjct: 214 APRHPARGLFYPQMARELGLPPPV---FSDSPDGGQGKIV--DGNRICN----ELGFEYQ 264

Query: 272 YPN 274
           YP+
Sbjct: 265 YPD 267


>gi|206578139|ref|YP_002237543.1| NAD dependent epimerase/dehydratase family protein [Klebsiella
           pneumoniae 342]
 gi|288934460|ref|YP_003438519.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Klebsiella
           variicola At-22]
 gi|290508662|ref|ZP_06548033.1| nucleoside-diphosphate-sugar epimerase [Klebsiella sp. 1_1_55]
 gi|206567197|gb|ACI08973.1| NAD dependent epimerase/dehydratase family protein [Klebsiella
           pneumoniae 342]
 gi|288889189|gb|ADC57507.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Klebsiella
           variicola At-22]
 gi|289778056|gb|EFD86053.1| nucleoside-diphosphate-sugar epimerase [Klebsiella sp. 1_1_55]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 81/183 (44%), Gaps = 21/183 (11%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YGN  G  V E+S   P    + Q     ++WL      ++   +LR
Sbjct: 103 HIPRIVFTSSTSVYGNVNGT-VKENSPRLP-QTASGQVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP R+P      K++        V N + ++DV   +  L+    GG I+NL   
Sbjct: 159 LAGLVGPSRHPGRFFAGKSA---PDGQHVVNLVHLQDVVAAIELLLQAPKGGHIYNLC-- 213

Query: 214 EPAPPQNVIM--EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
            P  P   +   + A  + + PP+   F  +      +    D  RI N     LGF+  
Sbjct: 214 APRHPARGLFYPQMARELGLPPPV---FSDSPDGGQGKIV--DGNRICN----ELGFEYQ 264

Query: 272 YPN 274
           YP+
Sbjct: 265 YPD 267


>gi|315125388|ref|YP_004067391.1| hypothetical protein PSM_A0285 [Pseudoalteromonas sp. SM9913]
 gi|315013901|gb|ADT67239.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 256

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 121/279 (43%), Gaps = 39/279 (13%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLR-E 60
           +L++ GAG+ G+ +   A K G    GT RS ++    + +    F+  + ++ + +  +
Sbjct: 7   NLVVLGAGWLGQALCIDAQKQGWQVQGTHRSDTHQFDFERQ----FVLQNGELQHQVDLQ 62

Query: 61  KLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYL--SSTSIYGNREGQWVDE 118
             Y+   I    + S    P ++  +    K    +   G+L  SST +Y    G +  E
Sbjct: 63  NAYWVCAIPPRSRDSESDYPQVLEQA---LKLATELNCKGFLLCSSTGVYDQEPGVY-SE 118

Query: 119 HSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--FIKIRQKNSLR 176
            S +   +    + ++AE++ L    K      VLRL+G+ GP R P  F+  ++ N+  
Sbjct: 119 SSDISGTNERQIKLYDAEEQVLEQQGK------VLRLAGLLGPNREPGRFVAGKELNT-- 170

Query: 177 LVKKNQVFNRIRVEDVARCVIFLMTHHLGG--IFNLSDDEPAPPQNVIMEAASLMKITPP 234
                QV N +  +DV   +  ++ +   G  I+N+ +  PA P           K    
Sbjct: 171 --SSQQVVNMVHQQDVINAIYVVLNNWSQGQSIYNVVN--PAHP----------TKADYY 216

Query: 235 LEQC-FDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
            ++C      +  F+    A+ K I +A I++LGF   Y
Sbjct: 217 AQKCELYGTQMPSFSSNEVAERKVIGSA-IEALGFSYQY 254


>gi|262040036|ref|ZP_06013298.1| YeeZ like protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259042613|gb|EEW43622.1| YeeZ like protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 81/183 (44%), Gaps = 21/183 (11%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           H+  I + SSTS+YGN  G  V E+S   P    + Q     ++WL      ++   +LR
Sbjct: 103 HIPRIVFTSSTSVYGNVNGT-VKENSPRLP-QTASGQVLKELEDWLHNLPGTSVD--ILR 158

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDD 213
           L+G+ GP R+P      K++        V N + ++DV   +  L+    GG I+NL   
Sbjct: 159 LAGLVGPSRHPGRFFAGKSA---PDGQHVVNLVHLQDVVAAIELLLQAPKGGHIYNLC-- 213

Query: 214 EPAPPQNVIM--EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
            P  P   +   + A  + + PP+   F  +      +    D  RI N     LGF+  
Sbjct: 214 APRHPARGLFYPQMARELGLPPPV---FSDSPDGGQGKIV--DGNRICN----ELGFEYQ 264

Query: 272 YPN 274
           YP+
Sbjct: 265 YPD 267


>gi|271500799|ref|YP_003333824.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Dickeya
           dadantii Ech586]
 gi|270344354|gb|ACZ77119.1| 6-phosphogluconate dehydrogenase NAD-binding protein [Dickeya
           dadantii Ech586]
          Length = 273

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 80/182 (43%), Gaps = 21/182 (11%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V  I Y SS S+YG   G+ V E+S + P +    +     ++WL       +   +LRL
Sbjct: 104 VPRIMYTSSISVYGTVSGR-VRENSPLQPETGTG-KVLQELEQWLHALPHTEVD--ILRL 159

Query: 156 SGIYGPKRNP--FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSD 212
           +G+ G  R+P  F+  R      L   +   N + +EDV   ++ L+   H G ++NL  
Sbjct: 160 AGLVGNHRHPGRFLAGRHD----LPDGSHGVNLVHLEDVIGAIMLLLQRPHGGHLYNLCA 215

Query: 213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
                 Q+   E A  M + PP     +  +  P  +    D +RI +     LGF+  Y
Sbjct: 216 PGHPAKQDFYPEQARRMGLEPP-----EFLSGDPL-KARLVDGQRICS----ELGFEYQY 265

Query: 273 PN 274
           P+
Sbjct: 266 PD 267


>gi|168788683|ref|ZP_02813690.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC869]
 gi|261225139|ref|ZP_05939420.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257517|ref|ZP_05950050.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. FRIK966]
 gi|189371520|gb|EDU89936.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC869]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|331673551|ref|ZP_08374314.1| protein YeeZ [Escherichia coli TA280]
 gi|331068824|gb|EGI40216.1| protein YeeZ [Escherichia coli TA280]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFSNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|15832072|ref|NP_310845.1| hypothetical protein ECs2818 [Escherichia coli O157:H7 str. Sakai]
 gi|16129957|ref|NP_416520.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74312558|ref|YP_310977.1| putative sugar metabolism protein [Shigella sonnei Ss046]
 gi|89108836|ref|AP_002616.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli str. K-12 substr. W3110]
 gi|117624219|ref|YP_853132.1| epimerase [Escherichia coli APEC O1]
 gi|157161508|ref|YP_001458826.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli HS]
 gi|168751657|ref|ZP_02776679.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4113]
 gi|168757560|ref|ZP_02782567.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4401]
 gi|168764102|ref|ZP_02789109.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4501]
 gi|168769767|ref|ZP_02794774.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4486]
 gi|168775537|ref|ZP_02800544.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4196]
 gi|168782298|ref|ZP_02807305.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4076]
 gi|168799103|ref|ZP_02824110.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC508]
 gi|170019655|ref|YP_001724609.1| NAD-dependent epimerase/dehydratase [Escherichia coli ATCC 8739]
 gi|170081646|ref|YP_001730966.1| epimerase [Escherichia coli str. K-12 substr. DH10B]
 gi|170681380|ref|YP_001743122.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli SMS-3-5]
 gi|188492021|ref|ZP_02999291.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 53638]
 gi|193062804|ref|ZP_03043897.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E22]
 gi|194431546|ref|ZP_03063838.1| NAD dependent epimerase/dehydratase family protein [Shigella
           dysenteriae 1012]
 gi|194436206|ref|ZP_03068308.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 101-1]
 gi|195939356|ref|ZP_03084738.1| epimerase [Escherichia coli O157:H7 str. EC4024]
 gi|208805736|ref|ZP_03248073.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4206]
 gi|208817146|ref|ZP_03258238.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4045]
 gi|208820020|ref|ZP_03260340.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4042]
 gi|209398834|ref|YP_002271259.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4115]
 gi|215487237|ref|YP_002329668.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217329657|ref|ZP_03445736.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. TW14588]
 gi|218690078|ref|YP_002398290.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli ED1a]
 gi|218699394|ref|YP_002407023.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli IAI39]
 gi|218705556|ref|YP_002413075.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli UMN026]
 gi|227887065|ref|ZP_04004870.1| GDP-L-fucose synthase [Escherichia coli 83972]
 gi|237704473|ref|ZP_04534954.1| NAD dependent epimerase/dehydratase [Escherichia sp. 3_2_53FAA]
 gi|238901206|ref|YP_002927002.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli BW2952]
 gi|253773053|ref|YP_003035884.1| NAD-dependent epimerase/dehydratase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162005|ref|YP_003045113.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli B str. REL606]
 gi|254793798|ref|YP_003078635.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. TW14359]
 gi|256022291|ref|ZP_05436156.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia sp. 4_1_40B]
 gi|260844626|ref|YP_003222404.1| putative epimerase [Escherichia coli O103:H2 str. 12009]
 gi|260855998|ref|YP_003229889.1| putative epimerase [Escherichia coli O26:H11 str. 11368]
 gi|291283253|ref|YP_003500071.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O55:H7 str. CB9615]
 gi|293405496|ref|ZP_06649488.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli FVEC1412]
 gi|293410375|ref|ZP_06653951.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli B354]
 gi|297516132|ref|ZP_06934518.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli OP50]
 gi|298381184|ref|ZP_06990783.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli FVEC1302]
 gi|300816645|ref|ZP_07096866.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 107-1]
 gi|300898608|ref|ZP_07116936.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 198-1]
 gi|300903886|ref|ZP_07121786.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 84-1]
 gi|300930724|ref|ZP_07146100.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 187-1]
 gi|300947328|ref|ZP_07161528.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 116-1]
 gi|300956265|ref|ZP_07168572.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 175-1]
 gi|301019179|ref|ZP_07183378.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 69-1]
 gi|301050035|ref|ZP_07196949.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 185-1]
 gi|301306498|ref|ZP_07212563.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 124-1]
 gi|301329571|ref|ZP_07222348.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 78-1]
 gi|301648511|ref|ZP_07248235.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 146-1]
 gi|312967247|ref|ZP_07781463.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 2362-75]
 gi|331683702|ref|ZP_08384298.1| protein YeeZ [Escherichia coli H299]
 gi|82583801|sp|P0AD13|YEEZ_ECO57 RecName: Full=Protein yeeZ; Flags: Precursor
 gi|82583802|sp|P0AD12|YEEZ_ECOLI RecName: Full=Protein yeeZ; Flags: Precursor
 gi|1788327|gb|AAC75077.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13362286|dbj|BAB36241.1| putative enzyme of sugar metabolism [Escherichia coli O157:H7 str.
           Sakai]
 gi|73856035|gb|AAZ88742.1| putative enzyme of sugar metabolism [Shigella sonnei Ss046]
 gi|85675192|dbj|BAE76568.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli str. K12 substr. W3110]
 gi|115513343|gb|ABJ01418.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli APEC O1]
 gi|157067188|gb|ABV06443.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli HS]
 gi|169754583|gb|ACA77282.1| NAD-dependent epimerase/dehydratase [Escherichia coli ATCC 8739]
 gi|169889481|gb|ACB03188.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170519098|gb|ACB17276.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli SMS-3-5]
 gi|187768919|gb|EDU32763.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4196]
 gi|188014327|gb|EDU52449.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4113]
 gi|188487220|gb|EDU62323.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 53638]
 gi|189000097|gb|EDU69083.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4076]
 gi|189355455|gb|EDU73874.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4401]
 gi|189361191|gb|EDU79610.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4486]
 gi|189365863|gb|EDU84279.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4501]
 gi|189378463|gb|EDU96879.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC508]
 gi|192931447|gb|EDV84048.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E22]
 gi|194420371|gb|EDX36448.1| NAD dependent epimerase/dehydratase family protein [Shigella
           dysenteriae 1012]
 gi|194424934|gb|EDX40919.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 101-1]
 gi|208725537|gb|EDZ75138.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4206]
 gi|208730765|gb|EDZ79455.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4045]
 gi|208740143|gb|EDZ87825.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4042]
 gi|209160234|gb|ACI37667.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC4115]
 gi|209748224|gb|ACI72419.1| putative enzyme of sugar metabolism [Escherichia coli]
 gi|209748226|gb|ACI72420.1| putative enzyme of sugar metabolism [Escherichia coli]
 gi|209748228|gb|ACI72421.1| putative enzyme of sugar metabolism [Escherichia coli]
 gi|215265309|emb|CAS09704.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217317425|gb|EEC25854.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. TW14588]
 gi|218369380|emb|CAR17137.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli IAI39]
 gi|218427642|emb|CAR08428.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli ED1a]
 gi|218432653|emb|CAR13548.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli UMN026]
 gi|226237423|dbj|BAH46945.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O55:H7]
 gi|226900839|gb|EEH87098.1| NAD dependent epimerase/dehydratase [Escherichia sp. 3_2_53FAA]
 gi|227835415|gb|EEJ45881.1| GDP-L-fucose synthase [Escherichia coli 83972]
 gi|238862370|gb|ACR64368.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli BW2952]
 gi|242377662|emb|CAQ32422.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli BL21(DE3)]
 gi|253324097|gb|ACT28699.1| NAD-dependent epimerase/dehydratase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973906|gb|ACT39577.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli B str. REL606]
 gi|253978100|gb|ACT43770.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli BL21(DE3)]
 gi|254593198|gb|ACT72559.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. TW14359]
 gi|257754647|dbj|BAI26149.1| predicted epimerase [Escherichia coli O26:H11 str. 11368]
 gi|257759773|dbj|BAI31270.1| predicted epimerase [Escherichia coli O103:H2 str. 12009]
 gi|260448883|gb|ACX39305.1| NAD-dependent epimerase/dehydratase [Escherichia coli DH1]
 gi|281179115|dbj|BAI55445.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|290763126|gb|ADD57087.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O55:H7 str. CB9615]
 gi|291427704|gb|EFF00731.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli FVEC1412]
 gi|291470843|gb|EFF13327.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli B354]
 gi|298278626|gb|EFI20140.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli FVEC1302]
 gi|300298219|gb|EFJ54604.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 185-1]
 gi|300316899|gb|EFJ66683.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 175-1]
 gi|300357724|gb|EFJ73594.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 198-1]
 gi|300399351|gb|EFJ82889.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 69-1]
 gi|300404125|gb|EFJ87663.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 84-1]
 gi|300453061|gb|EFK16681.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 116-1]
 gi|300461422|gb|EFK24915.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 187-1]
 gi|300530875|gb|EFK51937.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 107-1]
 gi|300838246|gb|EFK66006.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 124-1]
 gi|300844313|gb|EFK72073.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 78-1]
 gi|301073414|gb|EFK88220.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 146-1]
 gi|307554084|gb|ADN46859.1| predicted epimerase with FAD/NAD(P)-binding Rossmann-fold domain
           [Escherichia coli ABU 83972]
 gi|309702340|emb|CBJ01662.1| putative exported protein [Escherichia coli ETEC H10407]
 gi|312288055|gb|EFR15959.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 2362-75]
 gi|315136649|dbj|BAJ43808.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli DH1]
 gi|315253368|gb|EFU33336.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 85-1]
 gi|315285601|gb|EFU45043.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 110-3]
 gi|315618009|gb|EFU98601.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 3431]
 gi|320172624|gb|EFW47859.1| NAD dependent epimerase/dehydratase family protein [Shigella
           dysenteriae CDC 74-1112]
 gi|320191818|gb|EFW66466.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. EC1212]
 gi|320193303|gb|EFW67941.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli WV_060327]
 gi|320641424|gb|EFX10868.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. G5101]
 gi|320646793|gb|EFX15670.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H- str. 493-89]
 gi|320652072|gb|EFX20415.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H- str. H 2687]
 gi|320657434|gb|EFX25232.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320663250|gb|EFX30555.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668150|gb|EFX35019.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli O157:H7 str. LSU-61]
 gi|323152405|gb|EFZ38693.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli EPECa14]
 gi|323168849|gb|EFZ54529.1| NAD dependent epimerase/dehydratase family protein [Shigella sonnei
           53G]
 gi|323940902|gb|EGB37090.1| NAD dependent epimerase/dehydratase [Escherichia coli E482]
 gi|323951770|gb|EGB47644.1| NAD dependent epimerase/dehydratase [Escherichia coli H252]
 gi|323956183|gb|EGB51934.1| NAD dependent epimerase/dehydratase [Escherichia coli H263]
 gi|323972834|gb|EGB68033.1| NAD dependent epimerase/dehydratase [Escherichia coli TA007]
 gi|324008957|gb|EGB78176.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 57-2]
 gi|326338374|gb|EGD62202.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. 1044]
 gi|326347105|gb|EGD70838.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli O157:H7 str. 1125]
 gi|330911854|gb|EGH40364.1| nucleoside-diphosphate-sugar epimerase [Escherichia coli AA86]
 gi|331078654|gb|EGI49856.1| protein YeeZ [Escherichia coli H299]
 gi|332091595|gb|EGI96676.1| NAD dependent epimerase/dehydratase family protein [Shigella
           dysenteriae 155-74]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|306814862|ref|ZP_07449024.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli NC101]
 gi|305852256|gb|EFM52708.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Escherichia coli NC101]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGYIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|212276163|ref|NP_001130266.1| hypothetical protein LOC100191360 [Zea mays]
 gi|194688704|gb|ACF78436.1| unknown [Zea mays]
          Length = 359

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 74/177 (41%), Gaps = 16/177 (9%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SST++Y   +  +  E S   PI     Q    +    A    L     VLRL G+Y 
Sbjct: 188 FTSSTAVYDCSDNGFCSEDSPCVPIG----QSTRTDVLLKAENVVLEAGGCVLRLVGLYK 243

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQ 219
             R P +    K +L  V+ + + N I  ED A  VI +M   L   IF   D+EP    
Sbjct: 244 SDRGPHVYWLSKGTLD-VRPDHILNLIHYEDAASLVISIMKKRLRSCIFVGCDNEPLSRL 302

Query: 220 NVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
            ++       K        FDT     FT       KR+ N+K ++ LG+Q  YP++
Sbjct: 303 EIMDRVNRSRK--------FDT-QFHGFTGTDGPLGKRMDNSKTRAKLGWQPKYPSF 350


>gi|331647663|ref|ZP_08348755.1| protein YeeZ [Escherichia coli M605]
 gi|331043387|gb|EGI15525.1| protein YeeZ [Escherichia coli M605]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|323172604|gb|EFZ58238.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli LT-68]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|301018900|ref|ZP_07183130.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 196-1]
 gi|299882454|gb|EFI90665.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 196-1]
 gi|323961784|gb|EGB57385.1| NAD dependent epimerase/dehydratase [Escherichia coli H489]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|24113398|ref|NP_707908.1| putative enzyme of sugar metabolism [Shigella flexneri 2a str. 301]
 gi|30063465|ref|NP_837636.1| putative enzyme of sugar metabolism [Shigella flexneri 2a str.
           2457T]
 gi|110805988|ref|YP_689508.1| putative sugar metabolism protein [Shigella flexneri 5 str. 8401]
 gi|300936678|ref|ZP_07151582.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 21-1]
 gi|24052418|gb|AAN43615.1| putative enzyme of sugar metabolism [Shigella flexneri 2a str. 301]
 gi|30041718|gb|AAP17445.1| putative enzyme of sugar metabolism [Shigella flexneri 2a str.
           2457T]
 gi|110615536|gb|ABF04203.1| putative enzyme of sugar metabolism [Shigella flexneri 5 str. 8401]
 gi|281601466|gb|ADA74450.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri 2002017]
 gi|300458259|gb|EFK21752.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 21-1]
 gi|313649946|gb|EFS14366.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri 2a str. 2457T]
 gi|332756650|gb|EGJ86999.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri K-671]
 gi|332756888|gb|EGJ87233.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri 2747-71]
 gi|332766363|gb|EGJ96572.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri 2930-71]
 gi|333002409|gb|EGK21971.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri K-218]
 gi|333002530|gb|EGK22091.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri VA-6]
 gi|333003515|gb|EGK23056.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri K-272]
 gi|333017117|gb|EGK36438.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri K-304]
 gi|333017342|gb|EGK36660.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri K-227]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLQPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|226330785|ref|ZP_03806303.1| hypothetical protein PROPEN_04706 [Proteus penneri ATCC 35198]
 gi|225201580|gb|EEG83934.1| hypothetical protein PROPEN_04706 [Proteus penneri ATCC 35198]
          Length = 273

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 119/291 (40%), Gaps = 47/291 (16%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A A    G    GT  +   +   +  G+       +P +  D+   
Sbjct: 4   ITIVGLGWLGLPLAAALRDAGYQVKGTKTTEDGVEAARMSGVDCCLVNLTPAIECDRDDF 63

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMP---------HVKWIGYLSSTS 106
           + L E    T  ++  + PS+ G         D+ + +          HV  + Y+SSTS
Sbjct: 64  DYLME----TDVLIITLPPSAAGG------GYDYVEAIQTLVDSAMSRHVTRVIYISSTS 113

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF 166
           +YGN+ G   +E   + P +  A      E  WL       +   +LRL+G+ GP R+  
Sbjct: 114 VYGNQTGNITEEMD-IRPETQSAKMLAEVEN-WLHRLPLTTVD--ILRLAGLVGPGRHAG 169

Query: 167 IKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQNVIMEA 225
             +  K  ++    +Q  N + ++DV   V  L+  + GG ++NL        ++     
Sbjct: 170 RFLSGKKQVK--GAHQCVNLVHLDDVIFAVEQLLAQNEGGHLYNLCAPIHPKKKDFYSRV 227

Query: 226 ASLMKITPP--LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           ++ + + PP  +E+        P  R    D ++I     + LGF   YP+
Sbjct: 228 SNQLDLIPPEFVEE------EKPLIREI--DGQQIC----RDLGFHYHYPD 266


>gi|311743889|ref|ZP_07717695.1| ActC family protein [Aeromicrobium marinum DSM 15272]
 gi|311313019|gb|EFQ82930.1| ActC family protein [Aeromicrobium marinum DSM 15272]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 20/178 (11%)

Query: 102 LSSTSIYGNREGQWV-DEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           +SS+ ++G+   + V DE S   P          AE+ +    ++L     VLRLSG+YG
Sbjct: 109 VSSSGVFGDAGPEPVLDERSPAVPADGPGRVLLAAEELF---AERLPGG-TVLRLSGLYG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG--IFNLSDDEPAPP 218
              + F+ + Q    R+   ++  NRI  ED A  V+ L+T       ++  +DDEP   
Sbjct: 165 -GDSTFL-LDQVREGRVTDPHRWTNRIHREDAAAAVVHLLTRDADPDRLYVGTDDEPTQL 222

Query: 219 QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            +V    A+L     P      + +            KR+SNA++++ G+   YP+YR
Sbjct: 223 GDVAAHLAALSGAPTPPAADPASGH-----------GKRLSNARLRASGWTPRYPSYR 269


>gi|315296372|gb|EFU55672.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 16-3]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPAPPQ 219
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 220 NVIM--EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
             I   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNIFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|15802495|ref|NP_288521.1| putative enzyme of sugar metabolism [Escherichia coli O157:H7
           EDL933]
 gi|25348528|pir||G85826 probable enzyme of sugar metabolism Z3178 [imported] - Escherichia
           coli (strain O157:H7, substrain EDL933)
 gi|12516197|gb|AAG57075.1|AE005427_3 putative enzyme of sugar metabolism [Escherichia coli O157:H7 str.
           EDL933]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|146298637|ref|YP_001193228.1| NAD-dependent epimerase/dehydratase [Flavobacterium johnsoniae
           UW101]
 gi|146153055|gb|ABQ03909.1| NAD-dependent epimerase/dehydratase [Flavobacterium johnsoniae
           UW101]
          Length = 270

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 13/173 (7%)

Query: 2   HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA--DQKINNLLR 59
            + I G G+ G  +A   ++ G    G+T S + L  LK  GI PFL       ++    
Sbjct: 3   QISILGCGWLGLPLAKKLIEKGHTVNGSTTSENKLSILKDAGIYPFLVTVESDSVSKNFT 62

Query: 60  EKLYFTTHIVQCIKP-----SSEGDPCIISMSKDFYKFMPH--VKWIGYLSSTSIYGNRE 112
           + L  +  ++  I P     +S+ +   +   ++   F+    ++ I ++SSTS+YG+ +
Sbjct: 63  DFLAGSEILIIDIPPKLRAVASDSNMVFVQKIENLIPFIEKSTIQKILFVSSTSVYGD-D 121

Query: 113 GQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP 165
              + E +  +P +    Q   AEK    +    N +  +LR  G+ G  R+P
Sbjct: 122 NDSITEETIPNPETESGKQLLLAEK---ILQNNPNFETTILRFGGLIGKDRHP 171


>gi|325123618|gb|ADY83141.1| hypothetical protein BDGL_002555 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 271

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 77/181 (42%), Gaps = 22/181 (12%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           VK I  +SST +YG   G+ +D+ S +HP         N E  W    K    +  ++R 
Sbjct: 94  VKKIIVVSSTRVYGENAGEIIDDFSEIHPNDAQGNILRNMELLW---QKHYPTQSIIIRP 150

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM---THHLGGIFNLSD 212
           +GIYG       K+ + N  +        NRI ++D+AR + ++    TH    I  +++
Sbjct: 151 TGIYGTSIARLKKMAENN--QSYPNIHYSNRIHIDDLARFLAYIADYETHQASYI--VTN 206

Query: 213 DEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
           ++P P   VI   A   K     E   ++   S          KRI    + + GF L +
Sbjct: 207 NQPLPLHEVI---AWFQKQLGLPELTLESNQTS---------GKRIYAKHLPATGFHLEH 254

Query: 273 P 273
           P
Sbjct: 255 P 255


>gi|320198708|gb|EFW73308.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli EC4100B]
 gi|323183804|gb|EFZ69195.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli 1357]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGNRICN----ELGFEYQYPD 267


>gi|119493460|ref|ZP_01624129.1| oxidoreductase [Lyngbya sp. PCC 8106]
 gi|119452704|gb|EAW33883.1| oxidoreductase [Lyngbya sp. PCC 8106]
          Length = 343

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 86/220 (39%), Gaps = 27/220 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKL 62
           L+    G+TG  +    ++ GV      R  SNL   +   I  +L  D    NL+ + +
Sbjct: 15  LVTGATGFTGSLLVRKLVQQGVEVVAIARPTSNLEPFEGLNIE-WLRGDVFDENLINKAI 73

Query: 63  YFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHV----------------KWIGYLSSTS 106
               +I   + P    DP +    KD   F  HV                K   ++S+  
Sbjct: 74  QGVNYIFHMVTPFR--DPKL----KDIGYFNVHVLSTQLLAKAALKEPNFKRFVHVSTIG 127

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF 166
           ++G+ E    DE   + P       +  AE        K  +  AV+R +GIYGP     
Sbjct: 128 VHGHIEQPPADETYRMKPGDIYQETKVEAELWIRDFAPKAGLSFAVVRPAGIYGPGDKRL 187

Query: 167 IKIRQKNSLRLV----KKNQVFNRIRVEDVARCVIFLMTH 202
           +KI Q  + + V      + +++ I V+D+   +I   TH
Sbjct: 188 LKIFQMVNKKWVPVIGDGSNLYHFIHVDDLTNFMICAATH 227


>gi|300824749|ref|ZP_07104854.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 119-7]
 gi|300522736|gb|EFK43805.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli MS 119-7]
          Length = 274

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|54309594|ref|YP_130614.1| hypothetical protein PBPRA2429 [Photobacterium profundum SS9]
 gi|46914032|emb|CAG20812.1| Hypothetical enzyme of sugar metabolism [Photobacterium profundum
           SS9]
          Length = 277

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 86/188 (45%), Gaps = 15/188 (7%)

Query: 97  KWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLS 156
           K I ++S+TS+YGN +G+ + E     P S +    +  E++   I       L VLRLS
Sbjct: 104 KRIIFISTTSVYGNMQGE-ITESMQPSPDSELGIAHYKLEQQLRDIWGD---DLVVLRLS 159

Query: 157 GIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPA 216
           G+ GP R+P   +  +  ++   K+QV N I ++D  + +  ++     G+  L    P 
Sbjct: 160 GLIGPNRHPAKFLSGRTGIK-GGKSQV-NLIHLDDCIQAITSIIVKS-PGVKTLHLAAPF 216

Query: 217 PPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYR 276
            P       AS +K+   +E      +++P  +   ++        IK LG  L +P+  
Sbjct: 217 HPTREAYYTASALKVG--IELPIFEEDLTPKGKVINSER------TIKVLGLSLKHPDLA 268

Query: 277 ISLKQLWK 284
           +S   + K
Sbjct: 269 VSALDIAK 276


>gi|307130817|ref|YP_003882833.1| putative epimerase, with NAD(P)-binding Rossmann-fold domain
           [Dickeya dadantii 3937]
 gi|306528346|gb|ADM98276.1| predicted epimerase, with NAD(P)-binding Rossmann-fold domain
           [Dickeya dadantii 3937]
          Length = 273

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 83/184 (45%), Gaps = 25/184 (13%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           V  I Y SS S+YG   G+ V E+S + P +    +   A ++WL       +   +LRL
Sbjct: 104 VPRILYTSSISVYGPLSGR-VKENSPLQPETGTG-KVLLALEQWLHALPHTEVD--ILRL 159

Query: 156 SGIYGPKRNP--FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH-HLGGIFNLSD 212
           +G+ G  R+P  F+  R+     L   +   N + +EDV   +  L+   H G ++NL  
Sbjct: 160 AGLVGNNRHPGRFLAGRRD----LPDGSHGVNLVHLEDVIGAITLLLQRPHGGHLYNLC- 214

Query: 213 DEPAPP--QNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQL 270
             PA P  Q+     A LM + PP     D A      R    D +RI +     LGF+ 
Sbjct: 215 -APAHPAKQDFYPAQARLMGLEPPRFLPGDPAQ----ARLI--DGQRICS----ELGFEY 263

Query: 271 LYPN 274
            +P+
Sbjct: 264 QHPD 267


>gi|242057373|ref|XP_002457832.1| hypothetical protein SORBIDRAFT_03g014730 [Sorghum bicolor]
 gi|241929807|gb|EES02952.1| hypothetical protein SORBIDRAFT_03g014730 [Sorghum bicolor]
          Length = 336

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 115/286 (40%), Gaps = 46/286 (16%)

Query: 3   LMIFGAGYTGKFIADAALK--VGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLRE 60
           L+I G G  G+ +A+   K   G    G T S ++   L   GI P L         + +
Sbjct: 76  LLIVGPGVLGRIVAEKWQKEHPGCKVYGQTASKNHHSELTDLGIIPSLKG-----TTIHQ 130

Query: 61  KLYFTTHIVQCIKPSSEGD-PCIISMSKDFYKFMPHVKWIG-----YLSSTSIYGNREGQ 114
           K+    H++ C  PSS  D P  + ++           W G     + SST++Y   +  
Sbjct: 131 KV---PHVIFCAPPSSSDDYPGDVRLAAS--------NWSGEGSFLFTSSTALYDCSDNS 179

Query: 115 WVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNS 174
             +E     PI          + E +     L     VLRL+G+Y   R   +   +K +
Sbjct: 180 MCNEDCSSVPIGRSPRTDVLLKVENVV----LEAGGCVLRLAGLYKIDRGAHVFWLRKGT 235

Query: 175 LRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMKITP 233
           L   + + + N+I  ED A   + +M   L   IF   D++P   Q ++       K   
Sbjct: 236 LD-TRPDHIINQIHYEDAASLAVAIMKKRLRSRIFLGCDNKPLSRQEIMDAVNKSGK--- 291

Query: 234 PLEQCFDTANISPFTRFFYAD---NKRISNAKIKS-LGFQLLYPNY 275
                FDT     F  F   D    KR+ N+K ++ +G++  YP++
Sbjct: 292 -----FDTK----FEGFTGTDGPLGKRMENSKTRAEIGWEPKYPSF 328


>gi|291618019|ref|YP_003520761.1| YeeZ [Pantoea ananatis LMG 20103]
 gi|291153049|gb|ADD77633.1| YeeZ [Pantoea ananatis LMG 20103]
          Length = 275

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (41%), Gaps = 28/223 (12%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A A    G    G+  +   +   +  G+       +P L  D +  
Sbjct: 4   VAIVGLGWLGMPLAMALSARGWQVTGSKTTPDGVEAARRCGLDAFQLELTPDLICDAEDL 63

Query: 56  NLLREKLYFTTHIVQCIKPSSE----GDPCIISMSKDFYKFMPH-VKWIGYLSSTSIYGN 110
           ++L     F    +    P+S     GD  + ++       + H V  I + SSTS+YG 
Sbjct: 64  DVL-----FDVDALVVTLPASRTAEGGDAYVQAVQNVVDTALAHSVPRIIFTSSTSVYGG 118

Query: 111 REGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNP--FIK 168
             G    E S + P +       + E  WL      ++   VLRL+G+ GPKR+P  F+ 
Sbjct: 119 SSGIKT-EKSLLQPETTAGKTLVDLEN-WLHDLPGTSVD--VLRLAGLVGPKRHPGRFLA 174

Query: 169 IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL 210
            +Q     L   +   N + ++DV   ++ L+    GG  FNL
Sbjct: 175 GKQA----LPNGSHGVNLVHLDDVVEAIMLLLQTPRGGRTFNL 213


>gi|323161933|gb|EFZ47807.1| NAD dependent epimerase/dehydratase family protein [Escherichia
           coli E128010]
          Length = 261

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 96  FTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRLAGLVG 151

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 152 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 206

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 207 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 254


>gi|295136418|ref|YP_003587094.1| hypothetical protein ZPR_4598 [Zunongwangia profunda SM-A87]
 gi|294984433|gb|ADF54898.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 266

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 111/281 (39%), Gaps = 26/281 (9%)

Query: 1   MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA--DQKINNLL 58
           M + I G G+ G  +A   +  G    G+T +   +  L  +GI+P+     +  +   +
Sbjct: 1   MQISILGCGWLGLPLAKKLVYDGYSLKGSTTTQHKMHKLSAEGITPYHLELYESGVQGDI 60

Query: 59  REKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSIYGNREG 113
           +  L  +  ++  I P    +P  I+ +K     + ++++ G     + SSTS+Y ++E 
Sbjct: 61  QSFLSGSDILLIDIPPGLRKNPE-INFTKKITNIISNIEYSGIKKLIFTSSTSVYEDQEE 119

Query: 114 -QWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQK 172
                E+S  +  S  A Q  N E    A+    N K  +LR  G+    R+P   +  +
Sbjct: 120 FPEYTENSKPNGTSEAAKQLINCEN---ALQNNPNFKTTILRFGGLISDDRHPITMLSGR 176

Query: 173 NSLRLVKKNQVFNRIRVED-VARCVIFLMTHHLGGIFNLSDDEPAPPQNVIMEAASLMKI 231
             ++        N IR +D ++     L     G +FN +  E         + A    I
Sbjct: 177 TDIK--NGEAPVNLIRRDDCISLIATILKNDEFGTVFNAAYPEHPKKSEYYTKEAKSRNI 234

Query: 232 TPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLY 272
             P            + +   +  K IS+  +  +GF+  Y
Sbjct: 235 KAP-----------EYDKNRPSKGKIISSVNLDKIGFEFKY 264


>gi|325275154|ref|ZP_08141126.1| NAD-dependent epimerase/dehydratase [Pseudomonas sp. TJI-51]
 gi|324099712|gb|EGB97586.1| NAD-dependent epimerase/dehydratase [Pseudomonas sp. TJI-51]
          Length = 123

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           ++SS+S+Y  ++G+WV+E S   P     + R   E E LA+     I  +V+RL+GIYG
Sbjct: 62  FVSSSSVYAQKDGEWVEEGSATEPEGY--SGRVMLEAERLALGS--GIPASVVRLTGIYG 117

Query: 161 PKRN 164
           P R 
Sbjct: 118 PGRE 121


>gi|317491377|ref|ZP_07949813.1| NAD-dependent epimerase/dehydratase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920924|gb|EFV42247.1| NAD-dependent epimerase/dehydratase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 275

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 94/218 (43%), Gaps = 18/218 (8%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGI-------SPFLFADQKIN 55
           + I G G+ G  +A + L  G    G+  +   +   +  GI       +P L  +Q   
Sbjct: 4   VAIVGLGWVGMPLALSLLGRGYRVVGSKTTPDGVEAARMSGIECYPLVMTPELECEQDDL 63

Query: 56  NLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPH-VKWIGYLSSTSIYGNREGQ 114
             L +       +    +P  EG+  + ++       + H V  I +LSSTS+YG+  G 
Sbjct: 64  EQLLDADALVITLPASRRPE-EGERYLHAVQLLVDSALAHNVPRIIFLSSTSVYGDAVGT 122

Query: 115 WVDEHSFVHPISCVATQRFNAEKE-WLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKN 173
            V+E S + P +     R  AE E WL      N  + +LRL+G+ G  RNP   +  K 
Sbjct: 123 -VNERSELQPTTSAG--RTLAELETWLHDLP--NTSVDILRLAGLVGAGRNPGRFLAGKT 177

Query: 174 SLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNL 210
              +V  +   N +  +DV   +  L+    GG ++NL
Sbjct: 178 D--VVGASSGVNLVHQDDVIAAIQMLLKLPQGGHVYNL 213


>gi|193216179|ref|YP_001997378.1| NAD-dependent epimerase/dehydratase [Chloroherpeton thalassium ATCC
           35110]
 gi|193089656|gb|ACF14931.1| NAD-dependent epimerase/dehydratase [Chloroherpeton thalassium ATCC
           35110]
          Length = 318

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 20/190 (10%)

Query: 96  VKWIGYLSSTSIYG-NREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLR 154
           VK   + SS+S+YG N    W ++   + PIS  A  + + E      +    I+   LR
Sbjct: 119 VKQFVFASSSSVYGVNPNVPWREDDHVLMPISPYAATKVSGELLGHVYSHLYGIRFIALR 178

Query: 155 LSGIYGPKRNPFIKIRQKNSLRLVKKN--QVF-------NRIRVEDVARCVIFLMTHH-- 203
              ++GP++ P + I  K S R+++    QVF       +   ++D+ + +   M +   
Sbjct: 179 FFTVFGPRQRPDLAI-HKFSKRMLEGTPIQVFGDGTTRRDYTYIDDIIQGIRKAMAYEAS 237

Query: 204 LGGIFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI 263
           L  + NL ++ P     ++    S + + P +E+  +     P T   YA    I NA+ 
Sbjct: 238 LFEVINLGNNTPVTMNELLAALESALGVAPKIERLPEQPGDVPQT---YAS---IENAQ- 290

Query: 264 KSLGFQLLYP 273
           K LG+Q+  P
Sbjct: 291 KLLGYQVTTP 300


>gi|205353212|ref|YP_002227013.1| hypothetical protein SG2100 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857505|ref|YP_002244156.1| hypothetical protein SEN2069 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205272993|emb|CAR37941.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206709308|emb|CAR33648.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326628299|gb|EGE34642.1| hypothetical protein SG9_2126 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 274

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 83/177 (46%), Gaps = 21/177 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E++  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGV-VKENTPRNPVTA-SGRTLKELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGQHGVNLVHLEDVVGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   +   L+ + PP    F  A  +   +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMTRLLGMAPP---HFRNAPDNGKGKII--DGSRICN----ELGFEYQYPD 267


>gi|146312274|ref|YP_001177348.1| NAD-dependent epimerase/dehydratase [Enterobacter sp. 638]
 gi|145319150|gb|ABP61297.1| NAD-dependent epimerase/dehydratase [Enterobacter sp. 638]
          Length = 274

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 82/185 (44%), Gaps = 25/185 (13%)

Query: 95  HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE-KEWLAITKKLNIKLAVL 153
           HV  I + SSTS+YG+ EG  V E +   P++  A+ R   E ++WL       +   +L
Sbjct: 103 HVPRIIFTSSTSVYGDVEGT-VKESTERQPVT--ASGRVLKELEDWLHNLPGTQVD--IL 157

Query: 154 RLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSD 212
           RL+G+ GP+R+P      K +          N + +EDV   +  L+    GG I+N+  
Sbjct: 158 RLAGLVGPERHPGRFFAGKTA---PNGQHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC- 213

Query: 213 DEPAPPQNVIMEA--ASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKI-KSLGFQ 269
             P+ P         A  + + PP  Q  D +             K I   +I + LGF+
Sbjct: 214 -APSHPARSTFYPVMARQLGLEPP--QFRDASG--------EGQGKLIDGNRICRELGFE 262

Query: 270 LLYPN 274
             YP+
Sbjct: 263 YQYPD 267


>gi|330684676|gb|EGG96378.1| NAD dependent epimerase/dehydratase family protein [Staphylococcus
           epidermidis VCU121]
          Length = 309

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 80/185 (43%), Gaps = 26/185 (14%)

Query: 3   LMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFL----FADQKINNLL 58
           L+  GAG+ G  IA   ++  +        + NL T + + I PF+    F  + INNL 
Sbjct: 4   LITGGAGFIGSHIAQKCIQNNI----EVHVIDNLSTGRIENI-PFVKKEYFYQEDINNLK 58

Query: 59  -------REKLYFTTH------IVQCIKPSSEGDPCIISMSKDFYKFM----PHVKWIGY 101
                  +E+  +  H      +V+ ++     +   I  + +  + +     ++K   +
Sbjct: 59  FVSDLIKKERFDYVIHLAAMVSVVETVQQPGRSNQVNIDATLNILETLRLQHSNIKKFLF 118

Query: 102 LSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGP 161
            SS ++YG  EG     HS + P S  A Q++  E       +  ++    LR   +YGP
Sbjct: 119 ASSAAVYGQLEGLPKAIHSRIDPRSPYAVQKYAGESYAKIYHQLYHLPTVSLRFFNVYGP 178

Query: 162 KRNPF 166
           ++NP+
Sbjct: 179 RQNPY 183


>gi|16761000|ref|NP_456617.1| hypothetical protein STY2279 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765400|ref|NP_461015.1| dehydratase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29141304|ref|NP_804646.1| hypothetical protein t0804 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413031|ref|YP_150106.1| hypothetical protein SPA0801 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62180650|ref|YP_217067.1| hypothetical protein SC2080 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161613254|ref|YP_001587219.1| hypothetical protein SPAB_00964 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551013|ref|ZP_02344768.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990982|ref|ZP_02572081.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168229387|ref|ZP_02654445.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168236220|ref|ZP_02661278.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168242140|ref|ZP_02667072.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168259631|ref|ZP_02681604.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168818240|ref|ZP_02830240.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194446133|ref|YP_002041338.1| hypothetical protein SNSL254_A2248 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451692|ref|YP_002046120.1| hypothetical protein SeHA_C2295 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469962|ref|ZP_03075946.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194736501|ref|YP_002115157.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197247949|ref|YP_002147028.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197265730|ref|ZP_03165804.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197361955|ref|YP_002141592.1| hypothetical protein SSPA0751 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242607|ref|YP_002216156.1| hypothetical protein SeD_A2407 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|213161014|ref|ZP_03346724.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|238913448|ref|ZP_04657285.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|289829229|ref|ZP_06546841.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|25348531|pir||AI0763 conserved hypothetical protein STY2279 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420601|gb|AAL20974.1| putative dehydratase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503298|emb|CAD02431.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136930|gb|AAO68495.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127288|gb|AAV76794.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128283|gb|AAX65986.1| putative dehydratase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362618|gb|ABX66386.1| hypothetical protein SPAB_00964 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404796|gb|ACF65018.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194409996|gb|ACF70215.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194456326|gb|EDX45165.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194712003|gb|ACF91224.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197093432|emb|CAR58887.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197211652|gb|ACH49049.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197243985|gb|EDY26605.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197290567|gb|EDY29922.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937123|gb|ACH74456.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|205324098|gb|EDZ11937.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205330483|gb|EDZ17247.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335565|gb|EDZ22329.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205338446|gb|EDZ25210.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205344943|gb|EDZ31707.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205351172|gb|EDZ37803.1| protein YeeZ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|267994124|gb|ACY89009.1| putative dehydratase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158631|emb|CBW18143.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913061|dbj|BAJ37035.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320086504|emb|CBY96275.1| UDP-glucose 4-epimerase UDP-galactose 4-epimerase; Galactowaldenase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321224717|gb|EFX49780.1| hypothetical protein SEE_03177 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613663|gb|EFY10603.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620234|gb|EFY17103.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322623280|gb|EFY20121.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322630485|gb|EFY27254.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632838|gb|EFY29583.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638829|gb|EFY35523.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640286|gb|EFY36948.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647145|gb|EFY43644.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648971|gb|EFY45414.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653877|gb|EFY50201.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660984|gb|EFY57213.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663075|gb|EFY59282.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668520|gb|EFY64675.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673345|gb|EFY69448.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322679131|gb|EFY75185.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322683226|gb|EFY79241.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685904|gb|EFY81894.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322715121|gb|EFZ06692.1| Protein yeeZ [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130393|gb|ADX17823.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195191|gb|EFZ80372.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198759|gb|EFZ83859.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202403|gb|EFZ87446.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323209212|gb|EFZ94148.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213841|gb|EFZ98618.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323216131|gb|EGA00861.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323222514|gb|EGA06883.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323223736|gb|EGA08043.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231342|gb|EGA15456.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323232566|gb|EGA16663.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240991|gb|EGA25031.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245590|gb|EGA29585.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247620|gb|EGA31569.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251063|gb|EGA34937.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257461|gb|EGA41152.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263354|gb|EGA46888.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266327|gb|EGA49816.1| protein YeeZ [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|326623902|gb|EGE30247.1| 6-phosphogluconate dehydrogenase, NAD-binding protein [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|332989005|gb|AEF07988.1| putative dehydratase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 274

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 83/177 (46%), Gaps = 21/177 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E++  +P++  + +     ++WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGV-VKENTPRNPVTA-SGRTLKELEDWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGQHGVNLVHLEDVVGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   +   L+ + PP    F  A  +   +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMTRLLGMAPP---HFRDAPDNGKGKII--DGSRICN----ELGFEYQYPD 267


>gi|297171237|gb|ADI22245.1| nucleoside-diphosphate-sugar epimerases [uncultured
           Gemmatimonadales bacterium HF0200_34B24]
          Length = 233

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 84/183 (45%), Gaps = 23/183 (12%)

Query: 96  VKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL 155
           +  I + SSTS+YG+ +G  V E +  +P++  + +     ++WL      ++   +LRL
Sbjct: 63  IPRIIFTSSTSVYGDAQGT-VKETTPRNPVTN-SGRVLEELEDWLHNLPGTSVD--ILRL 118

Query: 156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDE 214
           +G+ GP R+P      K +          N + +EDV   +  L+    GG I+N+    
Sbjct: 119 AGLVGPGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--A 173

Query: 215 PA-PPQNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLL 271
           PA P +NV   + A L+ + PP      D+       +    D  RI N     LGF+  
Sbjct: 174 PAHPARNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQ 223

Query: 272 YPN 274
           YP+
Sbjct: 224 YPD 226


>gi|242057375|ref|XP_002457833.1| hypothetical protein SORBIDRAFT_03g014740 [Sorghum bicolor]
 gi|241929808|gb|EES02953.1| hypothetical protein SORBIDRAFT_03g014740 [Sorghum bicolor]
          Length = 296

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 110/286 (38%), Gaps = 46/286 (16%)

Query: 3   LMIFGAGYTGKFIADAALKV--GVYTCGTTRSVSNLLTLKHKGISPFL---FADQKINNL 57
           L+I G G  G+ +A+   +   G   CG T +  +   L   GI P L    A  K  N 
Sbjct: 35  LLIVGPGVLGRIVAEMWKQEYPGCKVCGQTATTDHHSELTDIGIIPSLKRSVAGPKFPN- 93

Query: 58  LREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIG-----YLSSTSIYGNRE 112
                     ++ C  P    D      + D    +    W G     + SST++Y   +
Sbjct: 94  ----------VIFCAPPYRSED-----YAGDLR--IAASNWNGEGSFLFTSSTAVYDCSD 136

Query: 113 GQWVDEHSFVHPISCVA-TQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQ 171
             +  E S      CV+  Q    +    A    L     VLRL+G+Y   R P +    
Sbjct: 137 NGFCGEDS-----PCVSIGQSPRTDVLLKAENVVLEAGGCVLRLAGLYKSDRGPHVYWLS 191

Query: 172 KNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL-GGIFNLSDDEPAPPQNVIMEAASLMK 230
           K +L  V+ + + N I  ED A   I +M   L   IF   D+EP     ++       K
Sbjct: 192 KGTLD-VRPDHILNLIHYEDAASLAIAIMKKRLRSRIFVGCDNEPLSRLEIMDRVNRSGK 250

Query: 231 ITPPLEQCFDTANISPFTRFFYADNKRISNAKIKS-LGFQLLYPNY 275
                   F+T     FT       KR+ N+K ++ LG+Q  YP++
Sbjct: 251 --------FET-QFQGFTGTDGPLGKRMENSKTRAELGWQPKYPSF 287


>gi|320185785|gb|EFW60539.1| NAD dependent epimerase/dehydratase family protein [Shigella
           flexneri CDC 796-83]
          Length = 274

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SSTS+YG+ +G  V E +  +P++         E +WL      ++   +LRL+G+ G
Sbjct: 109 FTSSTSVYGDAQGM-VKETTPRNPVTNSGLVLEELE-DWLHNLPGTSVD--ILRLAGLVG 164

Query: 161 PKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG-IFNLSDDEPA-PP 218
           P R+P      K +          N + +EDV   +  L+    GG I+N+    PA P 
Sbjct: 165 PGRHPGRFFAGKTA---PDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC--APAHPA 219

Query: 219 QNVIM-EAASLMKITPP-LEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPN 274
           +NV   + A L+ + PP      D+       +    D  RI N     LGF+  YP+
Sbjct: 220 RNVFYPQMARLLGLEPPQFRNSLDSG------KGKIIDGSRICN----ELGFEYQYPD 267


>gi|116330542|ref|YP_800260.1| hypothetical protein LBJ_0846 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116124231|gb|ABJ75502.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 259

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 95/236 (40%), Gaps = 60/236 (25%)

Query: 1   MHLMIFGAGYTGKFIA-----DAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFAD--QK 53
           M + IFG GYTG  IA      A +++  ++  T    + +    +    PF   +  +K
Sbjct: 1   MRVGIFGLGYTGIRIAKRLKLQAEIRLETFSAKTRVEGTEVFDFSN----PFALKEFGEK 56

Query: 54  INNLLREKLYFTTHIVQCIKPSS-------EGDPCIISMSKDFYKFMPHVKWIGYLSSTS 106
            +    +    T  + +   P S        G  CI+  +   YK +P +     + ST 
Sbjct: 57  FSREDFDLCVVTFPVQKLFDPISFINLLFSVGKRCILLGTTSIYKRVPDI-----VESTP 111

Query: 107 IYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKRNPF 166
           + G+ +                   RF  E EW+  + K      +LRL GIYGP RNP 
Sbjct: 112 LIGDHD-------------------RFAIENEWIGRSGK------ILRLCGIYGPLRNPG 146

Query: 167 IKIRQKNSLRLVKK-NQVFNRIRVEDVARCVIFLMT-------HHLGGIFNLSDDE 214
              R+     LVKK ++  N I  +DVA  +  L+          L  + NLSD++
Sbjct: 147 DWARKG----LVKKCSKQLNLIHGDDVALTISLLIRKIRTTGWDTLPNVLNLSDNQ 198


>gi|91216642|ref|ZP_01253607.1| UDP-glucose 4-epimerase [Psychroflexus torquis ATCC 700755]
 gi|91185111|gb|EAS71489.1| UDP-glucose 4-epimerase [Psychroflexus torquis ATCC 700755]
          Length = 306

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 16/144 (11%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           Y SS S+YG+ E   V E S   P S  A  +  A + +L I    ++K+  LRL  +YG
Sbjct: 112 YASSMSVYGDHENLPVTEESVTMPKSLYAVGKL-ASEHYLNIYSNSDLKVVSLRLFNVYG 170

Query: 161 PKRN------PFIKIRQKNSLR--LVKKNQVFNRIR----VEDVARCVIFLMTHHLG--- 205
           P +N        + I    +L+   +K      R R    ++DV   V  L+T  L    
Sbjct: 171 PGQNLANLKQGMLSIYLAQALKDGQIKVKGSLERFRDLVYIDDVVEVVSLLVTTDLSNPY 230

Query: 206 GIFNLSDDEPAPPQNVIMEAASLM 229
            ++N+++  P   + +I    +++
Sbjct: 231 SVYNVANAYPVKVKEMITSIKAVL 254


>gi|189426414|ref|YP_001953591.1| NAD-dependent epimerase/dehydratase [Geobacter lovleyi SZ]
 gi|189422673|gb|ACD97071.1| NAD-dependent epimerase/dehydratase