RPSBLAST alignment for GI: 254780595 and conserved domain: pfam01370

>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions. Length = 235
 Score = 45.0 bits (107), Expect = 3e-05
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 13/123 (10%)

Query: 101 YLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYG 160
           + SS+ +YG+     + E + + P+S  A  +   E+  LA  +   ++  +LRL  +YG
Sbjct: 113 FASSSEVYGDVADPPITEDTPLGPLSPYAAAKLAGERLVLAYARAYGLRAVILRLFNVYG 172

Query: 161 PKRNP-----FI-----KIRQKNSLRLVKKN--QVFNRIRVEDVARCVIFLMTHH-LGGI 207
           P  N       I     +I +     L+  +  Q  + + V+DVAR ++  + H   G +
Sbjct: 173 PGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVARAILLALEHPDGGEV 232

Query: 208 FNL 210
           +N+
Sbjct: 233 YNI 235