RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >gnl|CDD|161929 TIGR00560, pgsA, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. Alternate names: phosphatidylglycerophosphate synthase; glycerophosphate phosphatidyltransferase; PGP synthase. A number of related enzymes are quite similar in both sequence and catalytic activity, including Saccharamyces cerevisiae YDL142c, now known to be a cardiolipin synthase. There may be problems with incorrect transitive annotation of near homologs as authentic CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. Length = 182 Score = 137 bits (347), Expect = 2e-33 Identities = 70/181 (38%), Positives = 104/181 (57%), Gaps = 11/181 (6%) Query: 7 NIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVW 66 NIPN LT RI+ +P+ +L F + SP +I LF A++TD+ DGYLAR W Sbjct: 2 NIPNWLTLFRIIALPIFILFFLENVLPIQVSP----FIGALLFIFAAVTDWLDGYLARKW 57 Query: 67 NQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAEL 126 NQ SN G+ LDP+ADK+L+ +VL+++ G W I I+ REI++SGLR AE Sbjct: 58 NQVSNFGKFLDPLADKVLVLAVLIILVYHG---YVPAWFVIVIIAREIVISGLRVLAAEK 114 Query: 127 KVSVPVTRIARFKTGIQMISIGF-LLAGPACENQTSYITGTGIILLWISALLTIYSGYDY 185 KV + + ++KT QM++IG LL + +I +L +I+A T++S +Y Sbjct: 115 KVVIAANWLGKWKTTAQMVAIGALLLWRLTFKIFFEFI---VQLLYYIAAFFTLWSFIEY 171 Query: 186 F 186 Sbjct: 172 L 172 >gnl|CDD|182763 PRK10832, PRK10832, phosphatidylglycerophosphate synthetase; Provisional. Length = 182 Score = 119 bits (300), Expect = 5e-28 Identities = 67/186 (36%), Positives = 114/186 (61%), Gaps = 23/186 (12%) Query: 6 YNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARV 65 +NIP +LT R++++P VL F++ FT + + +F +A++TD+FDG+LAR Sbjct: 3 FNIPTLLTLFRVILIPFFVLVFYL----PFTWAPFVCAL---IFCVAAVTDWFDGFLARR 55 Query: 66 WNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIW----AAITILCREILVSGLRE 121 WNQ++ G LDP+ADK++++ ++L+T Y W A T++ REI++S LRE Sbjct: 56 WNQSTRFGAFLDPVADKVMVAIAMVLVT-----EHYHSWWVTLPAATMIAREIIISALRE 110 Query: 122 YLAEL--KVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTI 179 ++AEL + SV V+ I + KT QM+++ +LL P ++ GI L +++A+LT+ Sbjct: 111 WMAELGKRSSVAVSWIGKVKTTAQMVALAWLLWRP-----NIWVEYAGIALFFVAAVLTL 165 Query: 180 YSGYDY 185 +S Y Sbjct: 166 WSMLQY 171 >gnl|CDD|166199 PLN02558, PLN02558, CDP-diacylglycerol-glycerol-3-phosphate/ 3-phosphatidyltransferase. Length = 203 Score = 94.7 bits (235), Expect = 1e-20 Identities = 67/197 (34%), Positives = 106/197 (53%), Gaps = 19/197 (9%) Query: 3 SRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYL 62 S+ +P +LT GR+ VPL+V F++ T+ S+F A+ITD+ DGYL Sbjct: 6 SKVLTLPTVLTLGRVAAVPLLVATFYVDSWWGRTATT-------SIFIAAAITDWLDGYL 58 Query: 63 ARVWNQTSNIGRMLDPIADKLLISSVLLLMTA---DGTINRYSIW----AAITILCREIL 115 AR + G LDP+ADKL++++ L+L+ + + + W AI I+ REI Sbjct: 59 ARKMKLGTAFGAFLDPVADKLMVAAALILLCSRPLEVAVLGEVPWLFTVPAIAIIGREIT 118 Query: 116 VSGLREYLA----ELKVSVPVTRIARFKTGIQMISIGFLLAG-PACENQTSYITGTGIIL 170 +S +RE+ A +L +V V + ++KT QMIS+ LLA + + +G+ L Sbjct: 119 MSAVREWAASQNGKLLEAVAVNNLGKWKTATQMISLTILLASRDSSLEGPGILVPSGVGL 178 Query: 171 LWISALLTIYSGYDYFR 187 L+ISA L+I+S Y Sbjct: 179 LYISAGLSIWSLAVYMS 195 >gnl|CDD|178391 PLN02794, PLN02794, cardiolipin synthase. Length = 341 Score = 52.2 bits (125), Expect = 9e-08 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 10/86 (11%) Query: 7 NIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVW 66 N+PN+++ R++ P+I + N M A I+ +D+ DGY+AR Sbjct: 143 NLPNLISISRLVSGPVI----------GWMIVNEMYLSAFVGLAISGASDWLDGYVARKM 192 Query: 67 NQTSNIGRMLDPIADKLLISSVLLLM 92 S +G LDP+ADK+LI V L M Sbjct: 193 GINSVVGSYLDPLADKVLIGCVALAM 218 >gnl|CDD|161896 TIGR00473, pssA, CDP-diacylglycerol--serine O-phosphatidyltransferase. This enzyme, CDP-diacylglycerol--serine O-phosphatidyltransferase, is involved in phospholipid biosynthesis catalyzing the reaction CDP-diacylglycerol + L-serine = CMP + L-1-phosphatidylserine. Members of this family do not bear any significant sequence similarity to the corresponding E.coli protein. Length = 151 Score = 34.7 bits (80), Expect = 0.015 Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 45 ALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIAD 81 A L ++ DF DG +AR N+ S+ G+ LD +AD Sbjct: 23 ACFLILLSMFFDFLDGRVARKTNRVSDFGKELDSLAD 59 >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. Length = 571 Score = 27.0 bits (60), Expect = 3.2 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 15 GRILVVPL-IVLCFFIQEIGSFTSPNLMRWIALSL 48 + VPL ++ ++ I SF S L+ W++ + Sbjct: 51 SVLWWVPLVVIGLAVLRGICSFVSTYLLSWVSNKV 85 >gnl|CDD|185115 PRK15193, PRK15193, outer membrane usher protein; Provisional. Length = 876 Score = 26.8 bits (59), Expect = 4.0 Identities = 11/21 (52%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Query: 94 ADGTINRYSI-WAAITILCRE 113 ADG+IN YS+ ++A+ +L RE Sbjct: 349 ADGSINSYSVPYSAVPLLQRE 369 >gnl|CDD|180028 PRK05341, PRK05341, homogentisate 1,2-dioxygenase; Provisional. Length = 438 Score = 26.8 bits (60), Expect = 4.2 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Query: 36 TSPNLMRWIALSLFTIASITDFFDG 60 T PN +RW L L TDF DG Sbjct: 95 TPPNQLRWDPLPLPAEP--TDFVDG 117 >gnl|CDD|181394 PRK08338, PRK08338, 2-oxoglutarate ferredoxin oxidoreductase subunit gamma; Validated. Length = 170 Score = 26.8 bits (59), Expect = 4.3 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 9/42 (21%) Query: 115 LVSGLREYLAELKVSVPVTRIARFKTG----IQMISIGFLLA 152 LV R+Y + P TRIA TG + M+++G+L+A Sbjct: 95 LVKPDRDY-----IGAPFTRIAEETTGLALTVNMVALGYLVA 131 >gnl|CDD|179764 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit alpha; Provisional. Length = 489 Score = 26.7 bits (60), Expect = 4.4 Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 16/57 (28%) Query: 107 ITILCREILVSG------LREYLAELKVSVPVTRIAR---FKTGIQ-----MISIGF 149 IT L E+L SG R Y +K P + ++ I ++ +GF Sbjct: 197 ITQLTPELLKSGEWKEKEFRPY--NVKAPPPKIYPGKKHPYREFIDEVRDILVEMGF 251 >gnl|CDD|100572 PRK00478, scpA, segregation and condensation protein A/unknown domain fusion protein; Provisional. Length = 505 Score = 26.4 bits (58), Expect = 4.6 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query: 61 YLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRY 101 YLA + + + ++ I D L+I+S +L + AD + + Sbjct: 198 YLAYINKHMNK--KAIELITDYLVITSEILRIKADNLLPNF 236 >gnl|CDD|179745 PRK04135, PRK04135, cofactor-independent phosphoglycerate mutase; Provisional. Length = 395 Score = 26.0 bits (58), Expect = 6.2 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Query: 173 ISALLTIYSGYDYFRVGIKHIDS--ED 197 I L ++ YD+F + +K DS ED Sbjct: 270 IKTLKENWNDYDFFFLHVKKTDSYGED 296 >gnl|CDD|178022 PLN02400, PLN02400, cellulose synthase. Length = 1085 Score = 26.1 bits (57), Expect = 6.6 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Query: 3 SRSYNIPN--MLTYGRILVVPLIVLCFFIQ 30 SR IP+ + Y ++++ LI+L FF+Q Sbjct: 265 SRVVPIPSSRLTPYRIVIILRLIILGFFLQ 294 >gnl|CDD|152201 pfam11765, Hyphal_reg_CWP, Hyphally regulated cell wall protein N-terminal. The proteins in this family are all fungal and largely annotated as being hyphally regulated cell wall proteins, and several are listed as the enzyme EC:3.2.1.18. This enzyme is acetylneuraminyl hydrolase or exo-alpha-sialidase, that hydrolyses glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates. Length = 332 Score = 25.9 bits (57), Expect = 8.4 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 11/74 (14%) Query: 122 YLAELKVSVPVTRIARFKT-------GIQMISIGFLLAGPACENQTSYITGTGIILLWIS 174 YLA+ K S+ I++ KT I + L G N SY TGI+ L + Sbjct: 212 YLADSKSSMRAQAISKPKTFNVYGFGNGNKIGLDLPLVGNPWNNAYSYDATTGILTLRGN 271 Query: 175 ALLT----IYSGYD 184 LL+ I GY+ Sbjct: 272 GLLSQNFNIGLGYN 285 >gnl|CDD|179715 PRK04024, PRK04024, cofactor-independent phosphoglycerate mutase; Provisional. Length = 412 Score = 25.6 bits (57), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 71 NIGRMLDPIADKLLISSVLLLMTAD 95 I +ML I D L + V + +T D Sbjct: 322 KIDKMLGYILDNLDLDEVYIAVTGD 346 >gnl|CDD|131719 TIGR02671, cas_csx9, CRISPR-associated protein (provisional), Csx9 family. Members of this family, so far, are archaeal proteins found in CRISPR-associated (cas) gene regions. So far, this rare cas protein is found in only three genomes: Pyrococcus horikoshii shinkaj OT3, Pyrococcus abyssi GE5, and Thermococcus kodakarensis KOD1. In each case it is found immediately upstream of cas3 in loci that resemble the Apern type but lack Csa1 and Csa4 genes. Length = 377 Score = 25.7 bits (56), Expect = 9.0 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 91 LMTADGTINRYSIWAAITILCREIL--VSGLREYLAELKV 128 L T+ +Y +WA + I +E+ VSG RE LA + V Sbjct: 281 LKEGGATVEKYPLWALVDIAEKELWKGVSGDREMLAYIFV 320 >gnl|CDD|118190 pfam09658, Cas_Csx9, CRISPR-associated protein (Cas_Csx9). Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry describes archaeal proteins encoded in cas gene regions. Length = 377 Score = 25.7 bits (56), Expect = 9.0 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 91 LMTADGTINRYSIWAAITILCREIL--VSGLREYLAELKV 128 L T+ +Y +WA + I +E+ VSG RE LA + V Sbjct: 281 LKEGGATVEKYPLWALVDIAEKELWKGVSGDREMLAYIFV 320 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.141 0.423 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,345,379 Number of extensions: 208373 Number of successful extensions: 576 Number of sequences better than 10.0: 1 Number of HSP's gapped: 565 Number of HSP's successfully gapped: 29 Length of query: 200 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 111 Effective length of database: 4,071,361 Effective search space: 451921071 Effective search space used: 451921071 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.2 bits)