>TIGR02418 acolac_catab acetolactate synthase, catabolic; InterPro: IPR012782 Acetolactate synthase is a thiamin pyrophosphate-dependent enzyme that combines two molecules of pyruvate to yield 2-acetolactate with the release of CO2. It exists in two distinct forms that have different properties, though they are clearly related , . The biosynthetic form, found in plants, fungi and bacteria, is involved in the biosynthesis of branched-chain amino acids and contains non-catalytic FAD. The catabolic form is found only in some bacteria, participates in butanediol fermentation, and does not contain FAD. This entry represents the catabolic form of acetolactate synthase, generally found in species that posses acetolactate decarboxylase, which is often encoded in the same operon. The enzyme is thought to be a homotetramer, though this has not conclusively been shown. Each monomer consists of three distinct domains, designated, starting from the N-terminus, as alpha, beta and gamma . The core of the alpha and gamma domains is a six-stranded parallel beta sheet surrounded by alpha helices, while the the beta domain forms a double Rossman fold. The thiamin pyrophosphate cofactor has an unusual conformation that has not been seen in other enzymes using this cofactor, including the biosynthetic form of acetolactate synthase. The active site is located in a funnel at the dimer interface, bordered by residues from all three domains.; GO: 0000287 magnesium ion binding, 0003984 acetolactate synthase activity, 0030976 thiamin pyrophosphate binding, 0050660 FAD binding.

Probab=92.05 E-value=0.71 Score=25.37 Aligned_cols=110 Identities=18% Similarity=0.256 Sum_probs=53.0 Q ss_pred CCCCC-CHHHHHHHHHHHHCCC-----CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC-CCCC-CCCCCC Q ss_conf 74988-9999999999983887-----56998778989999999986421013333223323345433-3322-222223 Q gi|254780602|r 41 PDFDM-PENVKYAVVRAMERGE-----TKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKH-VIFN-ALMATV 112 (400) Q Consensus 41 p~~~~-p~~i~~a~~~al~~~~-----~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~e~I~it~G~~~-~l~~-~~~~~~ 112 (400) T Consensus 181 P~~Gaa~~~~i~~~~~~I~~Ak~PVlLlG~~a--S~~~~~~Av~rll~k~-~LPv--VeTfQgAG~vsrele~~TFfGRv 255 (553) T TIGR02418 181 PKLGAAADADIDEVAEAIKNAKLPVLLLGLRA--SSQETTEAVRRLLKKT-QLPV--VETFQGAGVVSRELEDETFFGRV 255 (553) T ss_pred CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCHHHHHHHHHHHCCC-CCCC--EEEEECCEEECHHCCCCCCEECC T ss_conf 67888738899999999983199669850478--8889999999986460-6882--14020051311002456521001 Q ss_pred -----CCCCCCC-----CCCCCCC--CCCC--CCCCCCCCCCCCCC---CCCCCCCCHHH Q ss_conf -----3223222-----2333323--2222--22222222222222---22232221033 Q gi|254780602|r 113 -----NMGDEVL-----IPRPYWV--SYPD--MVALCGGIPVFVDT---QQDDNFQVSPE 155 (400) Q Consensus 113 -----~~Gd~Vl-----v~~P~y~--~y~~--~~~~~g~~~~~v~~---~~~~~~~~d~~ 155 (400) T Consensus 256 GLFrNQ~GD~LLk~aDLvItIGYdPIEYep~~WN~~~~~~Iv~iD~~~A~i~~~yqP~~e 315 (553) T TIGR02418 256 GLFRNQPGDKLLKQADLVITIGYDPIEYEPRNWNSELDATIVHIDVEPAEIDNNYQPDLE 315 (553) T ss_pred CCCCCCCCHHHHHHCCEEEEECCCCEECCHHHCCCCCCCEEEEEEEEEEEHHHCCCCCHH T ss_conf 144587002577566978983388503075544778872068973144212003686144

HHsearch alignment for GI: 254780602 and conserved domain: TIGR02418