HHsearch alignment for GI: 254780606 and conserved domain: cd03248

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=94.91  E-value=0.023  Score=35.22  Aligned_cols=30  Identities=23%  Similarity=0.317  Sum_probs=22.8

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             1201148469970787534479999999999
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
T Consensus        35 ~~i~~Ge~vaIvG~sGsGKSTL~~l-l~gl~   64 (226)
T cd03248          35 FTLHPGEVTALVGPSGSGKSTVVAL-LENFY   64 (226)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC
T ss_conf             9982999999999999849999999-96454