>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

Probab=96.92 E-value=0.0091 Score=37.97 Aligned_cols=119 Identities=17% Similarity=0.177 Sum_probs=68.2 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH Q ss_conf 69970787534479999999999856801107999723421000125775200004444178768999999866769999 Q gi|254780606|r 415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK 494 (744) Q Consensus 415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~ 494 (744) T Consensus 33 ~iiTGpN~sGKSt~lk~i~l~~~laq~G-----~~vpa~~~~~~~~d~---i~t-~i~~~d~~~~~~StF~~e~~~~~~i 103 (222) T cd03285 33 LIITGPNMGGKSTYIRQIGVIVLMAQIG-----CFVPCDSADIPIVDC---ILA-RVGASDSQLKGVSTFMAEMLETAAI 103 (222) T ss_pred EEEECCCCCCHHHHHHHHHHHHHHHHHC-----CCEEEEEEEEECCCE---EEE-EECCCCCCCCCHHHHHHHHHHHHHH T ss_conf 9998999887189999999999999868-----754632389952764---999-9889971003352899999999999 Q ss_pred HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHH----HHHHHHHHHHHCCEEEEEEE Q ss_conf 99807786799999886420267766654323386799984456876753103589----99999999642013589998 Q gi|254780606|r 495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIE----GAIQRLAQMARAAGIHLIMA 570 (744) Q Consensus 495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e----~~~~~la~~~ra~Gihlila 570 (744) T Consensus 104 l~~~~-----------------------------~~sLvliDElg~--GT~~~eg~aia~aile~L~---~~~~~~~i~t 149 (222) T cd03285 104 LKSAT-----------------------------ENSLIIIDELGR--GTSTYDGFGLAWAIAEYIA---TQIKCFCLFA 149 (222) T ss_pred HHHCC-----------------------------CCCEECCCCCCC--CCCHHHHHHHHHHHHHHHH---HCCCCEEEEE T ss_conf 98476-----------------------------773200023468--9882267999999999998---5068509998 Q ss_pred ECCCCC Q ss_conf 516544 Q gi|254780606|r 571 TQRPSV 576 (744) Q Consensus 571 tQrp~~ 576 (744) T Consensus 150 TH~~~L 155 (222) T cd03285 150 THFHEL 155 (222) T ss_pred EECHHH T ss_conf 200779

HHsearch alignment for GI: 254780606 and conserved domain: cd03285