BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780607|ref|YP_003065020.1| hypothetical protein
CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|67458527|ref|YP_246151.1| hypothetical protein RF_0135 [Rickettsia felis URRWXCal2]
 gi|67004060|gb|AAY60986.1| unknown [Rickettsia felis URRWXCal2]
          Length = 138

 Score =  152 bits (385), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 48/131 (36%), Positives = 69/131 (52%), Gaps = 2/131 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  + Q DMN C G  +  V +KL   YK++L+ +  
Sbjct: 1   MKKTIIFCWLFLSSISYAFAVDCNNAMTQGDMNYCAGEEYKKVDKKLNQIYKEILKHISD 60

Query: 61  HQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            Q    L +KSQ  W  YR ++C F +SG   G+   MI   CL     ER ++ E+ L 
Sbjct: 61  EQEKVNLLKKSQNLWIKYRDADCEFRSSGVYGGSVYPMILLMCLTEKTEERIKEFEAMLK 120

Query: 119 CPEGDLLCPFI 129
           C EGD  CPFI
Sbjct: 121 CEEGDSSCPFI 131


>gi|238789061|ref|ZP_04632850.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
 gi|238722825|gb|EEQ14476.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
          Length = 128

 Score =  151 bits (380), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    +I    Q++A++C   + Q DMNQC    +     +L  TYK+VL K   
Sbjct: 1   MLKKIMLVSLLIFPVSQALAVDCKNAMTQLDMNQCANADYKKADAELNRTYKEVLAKTPM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  +R ++C F AS  E G+   MI + CL     ER  +L+SYL CP
Sbjct: 61  VQRALLKSAQLTWIKFRDADCTFQASATEGGSVHPMIISACLTRKTEERIAQLKSYLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|238798075|ref|ZP_04641563.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
 gi|238718055|gb|EEQ09883.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
          Length = 128

 Score =  150 bits (378), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    ++    Q +AL+C+  + Q +MNQC  + +     +L   YK+VL K   
Sbjct: 1   MLKKIMLISLLVLPISQVLALDCHNAVTQMEMNQCANSDYKSADTELNRIYKQVLVKTSV 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L CP
Sbjct: 61  AQRPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTQKTEERTTQLKSFLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|318606086|emb|CBY27584.1| putative periplasmic protein [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|330861150|emb|CBX71411.1| hypothetical protein YEW_BD05780 [Yersinia enterocolitica W22703]
          Length = 140

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 14  KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 73

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 74  QRPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 133

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 134 GDLSCPL 140


>gi|123442042|ref|YP_001006025.1| hypothetical protein YE1744 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089003|emb|CAL11817.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 129

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 3   KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 62

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 63  QRPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 122

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 123 GDLSCPL 129


>gi|332162045|ref|YP_004298622.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666275|gb|ADZ42919.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 129

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 3   KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 62

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 63  QRPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 122

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 123 GDLSCPL 129


>gi|77460115|ref|YP_349622.1| hypothetical protein Pfl01_3894 [Pseudomonas fluorescens Pf0-1]
 gi|77384118|gb|ABA75631.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 134

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 3/133 (2%)

Query: 1   MCRKIIFALT-IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M  +++ ALT  +  +    A++C     QA MNQC         ++L   Y+++  +++
Sbjct: 1   MSPRLLLALTPFLFTSVAHAAVDCANASDQATMNQCAAQENKAADKELNTVYQQITARLK 60

Query: 60  --KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                ++L   +Q AW  +R +EC F+ASG   G+   +IY NC+      R E L+ YL
Sbjct: 61  DNPDGKKLLVSAQRAWIGFRDTECKFSASGVAGGSVYPLIYNNCITSVTKTRTEALKQYL 120

Query: 118 TCPEGDLLCPFIN 130
            C EGD+ CP   
Sbjct: 121 KCEEGDMSCPVPG 133


>gi|227329538|ref|ZP_03833562.1| hypothetical protein PcarcW_20233 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 128

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K+  AL  +    Q+ A +C     Q +M+QC  + +  V  +L   Y+ V+++V   
Sbjct: 1   MKKLAIALFALQPITQAAATDCGNANTQLEMSQCAADEYKKVDGELNRLYQDVVKRVVIE 60

Query: 62  QRELF-EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           + +   + +Q  W  YR ++C F       G+   M+Y+ CL     ER ++ ++ L C 
Sbjct: 61  EHKALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVKEFKTMLRCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|227112977|ref|ZP_03826633.1| hypothetical protein PcarbP_08448 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 128

 Score =  138 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M ++   AL  +    Q+ A +C     Q +M+QC  N +  V  +L   Y+ V++++  
Sbjct: 1   MKKR-AIALFALLPITQATAADCGNANTQLEMSQCAANEYKKVDGELNRLYQDVVKRLVI 59

Query: 61  HQRELF-EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
            + +   + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C
Sbjct: 60  EEHKALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVEEFKSMLRC 119

Query: 120 PEGDLLCPF 128
            EGDL CP 
Sbjct: 120 EEGDLSCPL 128


>gi|91205457|ref|YP_537812.1| hypothetical protein RBE_0642 [Rickettsia bellii RML369-C]
 gi|157827183|ref|YP_001496247.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
 gi|91069001|gb|ABE04723.1| unknown [Rickettsia bellii RML369-C]
 gi|157802487|gb|ABV79210.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
          Length = 134

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTII--AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + II  L             ++C+    Q DMN C    F    ++L   Y+++L+  
Sbjct: 1   MRKIIILYLIFFNYLTYASDSKIDCDNAYTQFDMNYCANEDFKKADKELNQLYQEILKYT 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +  L +KSQ  W  +R ++C F +    +GT   MI + CL G    R E+L++ L 
Sbjct: 61  SEEETNLLKKSQNLWIKFRDADCEFGSFQVRDGTVFPMILSMCLAGKTKVRIEELKNILE 120

Query: 119 CPEGDLLCPFINN 131
           C EGDL C  + N
Sbjct: 121 CSEGDLSCRVLRN 133


>gi|253687870|ref|YP_003017060.1| hypothetical protein PC1_1480 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754448|gb|ACT12524.1| protein of unknown function DUF1311 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 128

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EK 60
            +K   AL  +    Q+ A +C     Q +M+QC  + +  V ++L   Y+ V +++  +
Sbjct: 1   MKKFAIALFALLPLTQAEAADCGNASTQLEMSQCAADEYKKVDDELNRLYQDVAKRLVIE 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C 
Sbjct: 61  EHKPLLKSAQRKWIAYRDADCEFQTFPTTGGSIHGMLYSQCLTQKTAERVEEFKSMLRCK 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|237730957|ref|ZP_04561438.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906496|gb|EEH92414.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 131

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 68/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+     + ++ Q++A +C     Q +MN C    +     KL  TY+  L++    
Sbjct: 1   MKRIVLTCAALLLSGQALADDCANANTQIEMNTCAAEQYKAADAKLNETYQNALKRAAPT 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q++W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C E
Sbjct: 61  QRDLLKKAQVSWITLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|304415354|ref|ZP_07396030.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
 gi|304282794|gb|EFL91281.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
          Length = 130

 Score =  134 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 64/130 (49%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K+I  L      F + AL C+    Q++MN C   ++    ++L   Y+ + E+    
Sbjct: 1   MKKMIMVLLAALPVFNASALECDNAQTQSEMNNCATAAYKKADDELNKLYENIKERTRGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            +++ +K+Q  W  YR S+C F    + + +   M+YA C +    ER  + +  L CPE
Sbjct: 61  HKKMLKKTQQKWIEYRDSDCRFQTYLSRKNSIYPMVYAYCRENKTRERVNEFKKMLDCPE 120

Query: 122 GDLLCPFINN 131
           GD+ CP   N
Sbjct: 121 GDVSCPLSVN 130


>gi|168821756|ref|ZP_02833756.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205341745|gb|EDZ28509.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085339|emb|CBY95122.1| Uncharacterized protein R02472 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 131

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 65/128 (50%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++C    SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCDLIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|168237187|ref|ZP_02662245.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243922|ref|ZP_02668854.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194451889|ref|YP_002045122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736498|ref|YP_002114121.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250924|ref|YP_002145992.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|194410193|gb|ACF70412.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712000|gb|ACF91221.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197214627|gb|ACH52024.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197289862|gb|EDY29223.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205337100|gb|EDZ23864.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|322616493|gb|EFY13402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619745|gb|EFY16620.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622560|gb|EFY19405.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629711|gb|EFY26486.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632569|gb|EFY29315.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636936|gb|EFY33639.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641526|gb|EFY38164.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644827|gb|EFY41361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649691|gb|EFY46122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654009|gb|EFY50332.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658542|gb|EFY54804.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663399|gb|EFY59601.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670133|gb|EFY66273.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674802|gb|EFY70893.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676727|gb|EFY72794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682650|gb|EFY78669.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686330|gb|EFY82312.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195712|gb|EFZ80888.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199860|gb|EFZ84949.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202853|gb|EFZ87889.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209123|gb|EFZ94060.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212404|gb|EFZ97222.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217917|gb|EGA02632.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222204|gb|EGA06588.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226726|gb|EGA10920.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229719|gb|EGA13842.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232944|gb|EGA17040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240679|gb|EGA24721.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242993|gb|EGA27014.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247684|gb|EGA31629.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252685|gb|EGA36523.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255726|gb|EGA39478.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261688|gb|EGA45262.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268077|gb|EGA51556.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269927|gb|EGA53376.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 131

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|283833727|ref|ZP_06353468.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
 gi|291070385|gb|EFE08494.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
          Length = 131

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 68/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+     + ++ Q++A +C     QA+MN C    F     KL  TY+  L++    
Sbjct: 1   MKRIVLTCAALLLSGQALADDCASANTQAEMNTCAAEQFKAADAKLNETYQNALKRAAPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q +W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C E
Sbjct: 61  QRDLLKKAQTSWISLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|16760000|ref|NP_455617.1| secreted protein [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142229|ref|NP_805571.1| hypothetical protein t1798 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413886|ref|YP_150961.1| hypothetical protein SPA1728 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179643|ref|YP_216060.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161503792|ref|YP_001570904.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|168233506|ref|ZP_02658564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194445821|ref|YP_002040377.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194471793|ref|ZP_03077777.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197362809|ref|YP_002142446.1| hypothetical protein SSPA1606 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|213163118|ref|ZP_03348828.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213416807|ref|ZP_03349951.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213609877|ref|ZP_03369703.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648753|ref|ZP_03378806.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852027|ref|ZP_03381559.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224584370|ref|YP_002638168.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238911057|ref|ZP_04654894.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289830140|ref|ZP_06547571.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25363759|pir||AD0633 probable secreted protein STY1158 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502294|emb|CAD08247.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137859|gb|AAO69420.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128143|gb|AAV77649.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62127276|gb|AAX64979.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160865139|gb|ABX21762.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|194404484|gb|ACF64706.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194458157|gb|EDX46996.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197094286|emb|CAR59794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205332414|gb|EDZ19178.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|224468897|gb|ACN46727.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714111|gb|EFZ05682.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 131

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|238791812|ref|ZP_04635449.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
 gi|238728916|gb|EEQ20433.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
          Length = 123

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 65/123 (52%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +    ++    Q++A++C   + Q D+NQC  + +     +L   YK+VL K    QR L
Sbjct: 1   MLISILVLPISQALAIDCQNAVTQLDINQCANSDYKKADTELNRIYKQVLAKTPATQRAL 60

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLL 125
            + +Q+ W  YR ++C F +S  E G+   MI + CL      R+ +L S+L C EGDL 
Sbjct: 61  LKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEARSAELLSFLNCAEGDLS 120

Query: 126 CPF 128
           CP 
Sbjct: 121 CPL 123


>gi|16764480|ref|NP_460095.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993697|ref|ZP_02574791.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264107|ref|ZP_02686080.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197264332|ref|ZP_03164406.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244474|ref|YP_002215053.1| hypothetical protein SeD_A1197 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|16419638|gb|AAL20054.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197242587|gb|EDY25207.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197938990|gb|ACH76323.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328287|gb|EDZ15051.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347389|gb|EDZ34020.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261246336|emb|CBG24145.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992883|gb|ACY87768.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157665|emb|CBW17157.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912110|dbj|BAJ36084.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223738|gb|EFX48801.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323129392|gb|ADX16822.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326622806|gb|EGE29151.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332988015|gb|AEF06998.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      + I+ Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLISSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|161614673|ref|YP_001588638.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552609|ref|ZP_02346361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168467574|ref|ZP_02701411.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|200390183|ref|ZP_03216794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205352274|ref|YP_002226075.1| hypothetical protein SG1011 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|161364037|gb|ABX67805.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|195630064|gb|EDX48716.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|199602628|gb|EDZ01174.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205272055|emb|CAR36900.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322736|gb|EDZ10575.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|326627319|gb|EGE33662.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 131

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|238749614|ref|ZP_04611119.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
 gi|238712269|gb|EEQ04482.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
          Length = 128

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 60/112 (53%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q+ A++C   L Q +MNQC    +     +L   YK++  K     + L + +Q+ W  +
Sbjct: 17  QTFAVDCKNALTQKEMNQCANADYKKADTELNRIYKEIFAKTSADIKPLLKSAQLTWIKF 76

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R ++C F +S  E G+   MI + CL     ER  +L+SYL CPEG+L CP 
Sbjct: 77  RDADCRFQSSATEGGSVHPMIISACLTHKTEERISQLKSYLNCPEGELSCPL 128


>gi|204930708|ref|ZP_03221581.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320167|gb|EDZ05371.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 131

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ QSMI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQSMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|27884639|gb|AAN18026.1| unknown [Pseudomonas chlororaphis subsp. aurantiaca]
          Length = 147

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           M  +   AL  + +   + A +C     QA MNQC         ++L   Y+++ +++  
Sbjct: 15  MNPRTFLALAPLLLTPLAQADDCANATTQAAMNQCAAEQHKAADKELNTLYQRINQRLED 74

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              +++L   +Q AW  +R +EC FAASG   G+   ++Y+NC       R E  +SYL 
Sbjct: 75  NPDRKKLLLGAQRAWVAFRDAECGFAASGVAGGSVYPLLYSNCTTELTKARVEAFKSYLE 134

Query: 119 CPEGDLLCPFINN 131
           C EGDL CP   N
Sbjct: 135 CQEGDLGCPVPGN 147


>gi|170738341|ref|YP_001779601.1| hypothetical protein Bcenmc03_5990 [Burkholderia cenocepacia MC0-3]
 gi|169820529|gb|ACA95111.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 134

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 58/127 (45%), Gaps = 2/127 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQR 63
           +     +  +      NC +   QA M  C   ++     +L  TY+ V  ++       
Sbjct: 7   LLGSLALVASVAHAQANCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRGAPPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EGD
Sbjct: 67  DKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEGD 126

Query: 124 LLCPFIN 130
           L CP   
Sbjct: 127 LACPVPG 133


>gi|261339324|ref|ZP_05967182.1| hypothetical protein ENTCAN_05568 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319187|gb|EFC58125.1| putative periplasmic protein [Enterobacter cancerogenus ATCC 35316]
          Length = 131

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 69/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            + ++ A   +  +  ++A  C     QADMN CT   +    +KL  TY+ V+++ +  
Sbjct: 1   MKPLLIAGAALLFSTSALADVCASANTQADMNSCTAQQYQAADKKLNQTYQTVMKRADAA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +K+Q AW + R ++CAFAASG+  G+ Q MI   CL     ER   L S + C E
Sbjct: 61  QQPLLKKAQQAWIVLRDADCAFAASGSAGGSVQPMIANQCLAEKTTEREAYLASLMQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|207856464|ref|YP_002243115.1| hypothetical protein SEN0986 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708267|emb|CAR32568.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 131

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKQIFLTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|107026354|ref|YP_623865.1| hypothetical protein Bcen_4003 [Burkholderia cenocepacia AU 1054]
 gi|116692458|ref|YP_837991.1| hypothetical protein Bcen2424_4364 [Burkholderia cenocepacia
           HI2424]
 gi|105895728|gb|ABF78892.1| protein of unknown function DUF1311 [Burkholderia cenocepacia AU
           1054]
 gi|116650458|gb|ABK11098.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           HI2424]
          Length = 134

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQR 63
           +     +  +      NC +   QA M  C   ++     +L  TY+ V  ++       
Sbjct: 7   LLGSLALVASVAHAQANCADATDQATMTACADRAYKKSDGELNRTYQAVTGRLRGAPPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EGD
Sbjct: 67  DKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|311280067|ref|YP_003942298.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
 gi|308749262|gb|ADO49014.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
          Length = 131

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+ A   + ++  ++A  C+    Q  +N+CT   +    +KL  TY  VL++    
Sbjct: 1   MKRILIACGALLVSATALADECSSASTQTALNECTAAQYQAADKKLNDTYATVLKRAPDA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L + +Q  W   R ++CA  +SG+  G+ Q MI + C+    +ER   LES L C E
Sbjct: 61  QKALLKTAQQKWVALRDADCALMSSGSAGGSIQPMINSQCMADKTVERTAWLESLLHCDE 120

Query: 122 GDLLCPFI 129
           GD+ CP  
Sbjct: 121 GDISCPLP 128


>gi|213428504|ref|ZP_03361254.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 131

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 65/128 (50%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++       +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRYFPTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|254248430|ref|ZP_04941750.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
 gi|124874931|gb|EAY64921.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
          Length = 162

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQR 63
           +     +  +      NC +   QA M  C   ++     +L  TY+ V  ++       
Sbjct: 35  LLGSLALVASVAHAQANCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRGAPPLA 94

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EGD
Sbjct: 95  DKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEGD 154

Query: 124 LLCPFI 129
           L CP  
Sbjct: 155 LACPVP 160


>gi|222081429|ref|YP_002540792.1| urease-associated protein [Agrobacterium radiobacter K84]
 gi|221726108|gb|ACM29197.1| urease-associated protein [Agrobacterium radiobacter K84]
          Length = 135

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 2   CRKIIFALTIIA--IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
            R   FA+ +I     F     NC +   Q DMN C G ++A    +L   YK++  ++ 
Sbjct: 1   MRITAFAIALILATPTFALAEQNCGDLTTQTDMNICAGKAYAKSDAELNVLYKQIEARLK 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   ++L   +Q AW  YR +EC F++S    GT    I ++CL      R E L+ YL
Sbjct: 61  DDADTKKLLVSTQKAWVGYRDAECNFSSSKVTGGTVYPFISSSCLNNMTRSRIEDLKGYL 120

Query: 118 TCPEGDLLCPFI 129
            C +GDL CP  
Sbjct: 121 KCGDGDLDCPVP 132


>gi|157146286|ref|YP_001453605.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
 gi|157083491|gb|ABV13169.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 70/128 (54%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++IIF    + ++ Q++A +C     Q +MN C    F    +KL  TY+  L++ E  
Sbjct: 1   MKRIIFTCAALLLSAQALADDCANASTQMEMNTCAAAQFQTADKKLNETYQNALKRAEPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q+AW   R ++CA  +SG E G+ Q MI + C+     ER   L S L C E
Sbjct: 61  QRDLLKKAQIAWIALRDADCALVSSGTEGGSIQPMIASQCMTDKTDEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|83591822|ref|YP_425574.1| hypothetical protein Rru_A0482 [Rhodospirillum rubrum ATCC 11170]
 gi|83574736|gb|ABC21287.1| Protein of unknown function DUF1311 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV--LEKVEKHQRELFEKSQMAWE 74
           Q+ A  C     QA+M  C   +      +L   YK +    K +   +     +Q AW 
Sbjct: 110 QARAQECAAPQTQAEMTLCADQALRRTDGELNQLYKDLGGRLKNDPDTKARLVGAQKAWL 169

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
            +R  ECAFA SG E G+A  M  A C +G   +R ++L SYL C EGDL CP  
Sbjct: 170 AFRDGECAFATSGVEGGSAYPMALATCREGLTQKRVKELRSYLRCAEGDLTCPVP 224


>gi|238762255|ref|ZP_04623227.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
 gi|238699602|gb|EEP92347.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 70/128 (54%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + +KI+    ++    Q++ALNC   + Q DMNQC  + +     +L  TYK+VL K   
Sbjct: 2   LKQKIMLVSLLLLPLGQALALNCQNAVTQQDMNQCATSDYKKADTELNRTYKEVLAKTSV 61

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q  W  YR ++C F +S  E G+   MI + CL     ER   L+S+L CP
Sbjct: 62  GQRALLKSAQQTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTHLKSFLNCP 121

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 122 EGDLSCPL 129


>gi|153007841|ref|YP_001369056.1| hypothetical protein Oant_0496 [Ochrobactrum anthropi ATCC 49188]
 gi|151559729|gb|ABS13227.1| protein of unknown function DUF1311 [Ochrobactrum anthropi ATCC
           49188]
          Length = 136

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 3/126 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-R 63
           I  A +  AI   + A +C     Q+ +N+C G ++     +L   +K +  + +    +
Sbjct: 9   IGVAFSAFAIIATAQADDCQNASSQSALNECYGKAYKKSDAELNKIFKTLQRRADDADLK 68

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +   +SQ  W  +R +EC         G+   M Y+ CL     ER   L+ YL C EGD
Sbjct: 69  KKLVQSQRTWIAFRDAECDMQT--VGGGSISGMAYSICLSDLTAERVSDLKKYLKCEEGD 126

Query: 124 LLCPFI 129
             CPF 
Sbjct: 127 SNCPFP 132


>gi|206563342|ref|YP_002234105.1| hypothetical protein BCAM1492 [Burkholderia cenocepacia J2315]
 gi|198039382|emb|CAR55347.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 134

 Score =  124 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-- 63
           +     +  +      NC +   QA M  C   ++     +L  TY+ V  ++   +   
Sbjct: 7   LLGSLALVASVAHAQANCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRDARPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE+G+A  M+ + CL      R + L+ YL+C EGD
Sbjct: 67  DKLVNAQRAWIAYRDAECRFSSANAEDGSAYPMVVSTCLDDLTKARTDTLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040284|gb|ACT57080.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 131

 Score =  124 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK
Sbjct: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP
Sbjct: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120

Query: 121 EGDLLCPFINN 131
           EGDLLCPFINN
Sbjct: 121 EGDLLCPFINN 131


>gi|146311196|ref|YP_001176270.1| hypothetical protein Ent638_1540 [Enterobacter sp. 638]
 gi|145318072|gb|ABP60219.1| protein of unknown function DUF1311 [Enterobacter sp. 638]
          Length = 131

 Score =  123 bits (308), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++++     +  +  ++A +C     Q++MN C    +    +KL  TY+  +++    
Sbjct: 1   MKRLMITAAALLFSASALADDCANANTQSEMNICAAQQYQAADKKLNQTYQDAMKRAAVP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q AW   R ++CAFAASG   G+ Q MI   CL     +R   L S + C E
Sbjct: 61  QRDLLKKAQQAWITLRDADCAFAASGTAGGSVQPMILNQCLAEKTTDREAFLASMMQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|182678739|ref|YP_001832885.1| hypothetical protein Bind_1768 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634622|gb|ACB95396.1| protein of unknown function DUF1311 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 135

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 3/132 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   I+  L ++A+   + + + C + + QA MN+C   +F     +L   YKK+  ++ 
Sbjct: 1   MKATILSGLMVLAMPALAFSKDKCADAMDQATMNECANVAFKKSDSQLNELYKKIETRLS 60

Query: 60  K--HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                ++L  ++Q AW  +R +EC F  S +  G+   MI + C+ G    R + L++YL
Sbjct: 61  DNTDTKKLLAQAQRAWIKFRDAECDFQRSASAGGSVMPMIISMCMDGMTQSRIKDLQNYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGD+ CP  
Sbjct: 121 NCKEGDMSCPVP 132


>gi|110634827|ref|YP_675035.1| hypothetical protein Meso_2486 [Mesorhizobium sp. BNC1]
 gi|110285811|gb|ABG63870.1| protein of unknown function DUF1311 [Chelativorans sp. BNC1]
          Length = 135

 Score =  121 bits (304), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 3/132 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   I+  + ++AI   + A + C+    QA MN+C   +F    +KL   YK++  ++ 
Sbjct: 1   MRTIILATVMMLAIPASAFAQDNCSAAEDQATMNECADAAFREADKKLNELYKQIEARLS 60

Query: 60  KHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                     ++Q  W  +R +EC+F  + A  G+   M+ A C++     R E  E YL
Sbjct: 61  DDAETKNLLVQAQRDWVKFRDAECSFQTASAAGGSVMPMLTATCMESLTQVRVEAFEGYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGDL CP  
Sbjct: 121 NCEEGDLSCPVP 132


>gi|78062503|ref|YP_372411.1| hypothetical protein Bcep18194_B1653 [Burkholderia sp. 383]
 gi|77970388|gb|ABB11767.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 134

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-- 63
           +     +A        NC +   QA M  C   ++     +L  TY+ V  ++   +   
Sbjct: 7   LLCSLALAANVAHAQANCADATDQAAMTACADRAYKKSDGELNRTYQAVTARLRDARPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE G+A SM+ + CL      R E L+ YL+C EGD
Sbjct: 67  DKLVNAQRAWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKARTETLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|296102966|ref|YP_003613112.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057425|gb|ADF62163.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 130

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 68/128 (53%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +++  A   + ++  ++A  C+    Q ++N C+   +    +KL  TY+  +++   
Sbjct: 1   MMKRVFLAGAALLLSASALADECDNATTQLELNTCSAQQYQAADKKLNQTYQSAIKRAAA 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR+L +K+Q AW   R ++C F  SG E G+ Q MI + CL    +ER   L S + C 
Sbjct: 61  PQRDLLKKAQQAWIALRDADCNFIGSGTEGGSVQPMIMSQCLTEKTVEREAFLASLMQCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|217976558|ref|YP_002360705.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
 gi|217501934|gb|ACK49343.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
          Length = 134

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 4/132 (3%)

Query: 2   CRKIIFALTIIAIAF--QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
            R +I AL++ A      + A +C     QA +N C   +      +L A Y+ ++ ++ 
Sbjct: 1   MRPLIVALSLFAALSGMTARAEDCGAAATQAAINDCANTALKNTDAELNAIYRSLIGRLK 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                R+    +Q AW  +R  ECAFAAS  ++G+    I ANC      +R + L  YL
Sbjct: 61  NSDDSRQSLIAAQRAWLQFRDGECAFAASSVKDGSIYPTIVANCRNALTADRVKALGVYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGD+ CP  
Sbjct: 121 NCAEGDMGCPVP 132


>gi|254254013|ref|ZP_04947330.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
 gi|124898658|gb|EAY70501.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
          Length = 138

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--E 64
            ALT+ A    + A NC     QA +  C   ++     +L  TY+ V  ++   +   +
Sbjct: 13  LALTLAADIAHAQA-NCTSATDQATLTACADRAYKKADAELNRTYQAVTARLRDARPLAD 71

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
               +Q AW  YR +EC F+++ AE G+   M+ + CL+     R E L+ YL+C EGDL
Sbjct: 72  KLVNAQRAWIAYRDAECHFSSANAEGGSVYPMVMSTCLEDLTKARTETLKGYLSCEEGDL 131

Query: 125 LCPFI 129
            CP  
Sbjct: 132 ACPVP 136


>gi|213579932|ref|ZP_03361758.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 116

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 61/113 (53%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  QREL +K+Q+AW   
Sbjct: 1   QALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPPQRELLQKAQVAWIAL 60

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 61  RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 113


>gi|17229369|ref|NP_485917.1| hypothetical protein alr1877 [Nostoc sp. PCC 7120]
 gi|17130967|dbj|BAB73576.1| alr1877 [Nostoc sp. PCC 7120]
          Length = 153

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 9/127 (7%)

Query: 1   MCRKI-IFALTIIAIAFQSMA--------LNCNETLMQADMNQCTGNSFALVKEKLEATY 51
           M   I I A + +  +  + A        +NC+    Q ++NQC+  S+    +KL   Y
Sbjct: 24  MKLLIPILACSTLLFSTAASAKPMLLVQNINCDNAQTQLEINQCSTQSYQNADKKLNQAY 83

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           K++L K+++ +++    +Q AW  +R S C F +S  E G+    +Y NCL+    +R +
Sbjct: 84  KQLLPKLQRSRKQKLIAAQQAWIKFRDSSCEFESSQYEGGSIAPSVYLNCLEKLTQQRTQ 143

Query: 112 KLESYLT 118
           +L+ YL 
Sbjct: 144 ELQEYLQ 150


>gi|221196455|ref|ZP_03569502.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221203126|ref|ZP_03576145.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221177060|gb|EEE09488.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221183009|gb|EEE15409.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 135

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++    ++A +      NC     QA +  C  +++      L  TY+ V  ++   +  
Sbjct: 7   VLLCTLMLAASVAHAQANCANASDQATLTACAEHAYRQSDAVLNRTYQTVTARLRDARPV 66

Query: 65  L--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
                 +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|161520803|ref|YP_001584230.1| hypothetical protein Bmul_4257 [Burkholderia multivorans ATCC
           17616]
 gi|189353015|ref|YP_001948642.1| hypothetical protein BMULJ_04249 [Burkholderia multivorans ATCC
           17616]
 gi|160344853|gb|ABX17938.1| protein of unknown function DUF1311 [Burkholderia multivorans ATCC
           17616]
 gi|189337037|dbj|BAG46106.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 135

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++   +  
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARLRDARPV 66

Query: 65  L--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
                 +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|134293579|ref|YP_001117315.1| hypothetical protein Bcep1808_4893 [Burkholderia vietnamiensis G4]
 gi|134136736|gb|ABO57850.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis G4]
          Length = 134

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-- 63
           +     +         NC +   QA M  C   ++     +L  TY+ V  ++   +   
Sbjct: 7   LLCALALTANLAHAQTNCADAADQAAMTACADRAYKKSDAELNRTYQAVTARLRDARPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC+F+++ AE G+  SM+ + CL      R E L+ YL+C EGD
Sbjct: 67  DKLVSAQRAWIAYRDAECSFSSANAEGGSVYSMVVSTCLDDLTKTRTETLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|330810871|ref|YP_004355333.1| hypothetical protein PSEBR_a3936 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378979|gb|AEA70329.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 133

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 2/105 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQRELFEKSQMAWEIYRGSECAFA 84
             Q +MNQC          +L + YK++  +++     +++  K+Q AW  +R +EC F+
Sbjct: 27  TTQGEMNQCAAKENKAADNELNSLYKQITARLKDNPEAKQMLVKAQRAWIGFRDAECNFS 86

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           ASG E G+   +IY+NC+      R E  ++YL C EGDL CP  
Sbjct: 87  ASGVEGGSVYPLIYSNCITTQTKARVEAFKNYLKCKEGDLSCPVP 131


>gi|293607356|ref|ZP_06689695.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814200|gb|EFF73342.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 137

 Score =  117 bits (294), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMA 72
              +  L C+    Q DMN C    +    + L   Y+ V+E+++    +    + +Q A
Sbjct: 18  GVHAQPLKCDNATTQTDMNLCADQDYRKSDKDLNDAYRSVVERLKDDSIKTTKLQAAQKA 77

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
           W  +R +ECAF++ G   G+A  M+ + CL      R ++L +YL C EGD  CP   
Sbjct: 78  WLFFRDAECAFSSGGTSGGSAYPMVLSLCLDKLTQARTKELRAYLQCEEGDTSCPVPG 135


>gi|239834266|ref|ZP_04682594.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
 gi|239822329|gb|EEQ93898.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
          Length = 134

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 45/133 (33%), Positives = 74/133 (55%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M + I  ALT +  +  + A   C+    QA MN+C G  F    +KL + Y+++  ++ 
Sbjct: 1   MLKYIAIALTAMFFSGSASASSECDNAQDQATMNKCAGQGFQKADKKLNSLYQQLERRLA 60

Query: 60  KHQRELFEK-SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  +     SQ AW  +R +EC F++SG E GT Q M+YA C +    +R+++L  +L 
Sbjct: 61  GNDAKKLLTISQRAWIKFRDAECEFSSSGTEGGTVQPMVYAMCRERLTADRSKQLSEHLK 120

Query: 119 CPEGDLLCPFINN 131
           C EGDL CP +++
Sbjct: 121 CEEGDLSCPQLSS 133


>gi|325518758|gb|EGC98359.1| hypothetical protein B1M_42033 [Burkholderia sp. TJI49]
          Length = 133

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 3/131 (2%)

Query: 2   CRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R +   L  + +A  + A  NC     QA M  C   ++      L  TY+ V  ++  
Sbjct: 1   MRVLTGLLCSLVLAANAHAQANCANASDQASMTACAERAYRQSDAVLNRTYQAVTARLRD 60

Query: 61  HQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +   +    +Q AW  YR +EC F+++ AE G+   M+ + CL     ER E L++YL+
Sbjct: 61  ARPLDDKLVAAQRAWIAYRDAECQFSSANAEGGSGYQMVVSTCLDDLTKERTETLKAYLS 120

Query: 119 CPEGDLLCPFI 129
           C +GDL CP  
Sbjct: 121 CEDGDLACPVP 131


>gi|221210087|ref|ZP_03583068.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221170775|gb|EEE03241.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 135

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK--HQ 62
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++      
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARLRDARPA 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|70731472|ref|YP_261213.1| hypothetical protein PFL_4116 [Pseudomonas fluorescens Pf-5]
 gi|68345771|gb|AAY93377.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIY 76
            A  CN    Q DM+ C         ++L A Y+++ ++++           +Q AW  +
Sbjct: 20  QAYECNN-TTQTDMSLCANFQHKAADKELNALYQQINQRLKDQPHSKKLLVSAQRAWVAF 78

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R +EC+F+ SG E G+   + Y+NC+      R E  + YL C EGDL CP  
Sbjct: 79  RDAECSFSTSGVEGGSLYPVAYSNCITALTKTRVESFKQYLQCKEGDLSCPVP 131


>gi|170703718|ref|ZP_02894441.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|170131373|gb|EDS99977.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
          Length = 134

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR- 63
           ++ AL + A    + + NC +   QA M  C   ++     +L  TY+ +  ++   +  
Sbjct: 7   LLCALALTANLAHAQS-NCADVTDQAAMTACADRAYKKSDAELNRTYQAITARLRDAKPL 65

Query: 64  -ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E     Q AW  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVNGQRAWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|171322144|ref|ZP_02911004.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
 gi|171092552|gb|EDT37868.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
          Length = 134

 Score =  116 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR- 63
           ++ AL + A    + A NC +   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCADATDQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 64  -ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ A CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVATCLDDLTRIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|283784819|ref|YP_003364684.1| hypothetical protein ROD_10671 [Citrobacter rodentium ICC168]
 gi|282948273|emb|CBG87844.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 131

 Score =  116 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI  A   + ++  ++A  C     QADMN C    +    +KL  T++  LE+  + 
Sbjct: 1   MKKIFLAGAALLLSASALADECANAATQADMNACAITQYQTADKKLNETFRNALERAAEP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q AW   R ++CA  ASG E G+AQ MI   CL     ER   L S L C E
Sbjct: 61  QRELLKKAQNAWIAVRDADCALIASGTEGGSAQVMIANQCLADKTDEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GD+ CP  
Sbjct: 121 GDMSCPLP 128


>gi|115358523|ref|YP_775661.1| hypothetical protein Bamb_3773 [Burkholderia ambifaria AMMD]
 gi|115283811|gb|ABI89327.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 134

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR- 63
           ++ AL + A    + A NC ET  QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCAETTDQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 64  -ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|119385807|ref|YP_916862.1| hypothetical protein Pden_3085 [Paracoccus denitrificans PD1222]
 gi|119376402|gb|ABL71166.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 135

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 3/132 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   ++ A+        + A  C ++ + QA MN+C   ++      L   + ++ +++ 
Sbjct: 1   MKHIVLAAIFCTLSLSAAQADQCMDKAVDQASMNRCAAQAYEKSDADLNKYFHEIRQRLA 60

Query: 60  KH--QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                R L   SQ AW  +R +ECAFAAS    G+A  M +  CL     +R  +L  YL
Sbjct: 61  DDVDARHLLRDSQRAWITFRDAECAFAASATAGGSAYPMAHDLCLADLTQKRAYELRQYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGD+ CP  
Sbjct: 121 ECEEGDMTCPVP 132


>gi|172063276|ref|YP_001810927.1| hypothetical protein BamMC406_4247 [Burkholderia ambifaria MC40-6]
 gi|171995793|gb|ACB66711.1| protein of unknown function DUF1311 [Burkholderia ambifaria MC40-6]
          Length = 134

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR- 63
           ++ AL + A    + A NC E   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCAEATEQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 64  -ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVSAQRTWLAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|226330097|ref|ZP_03805615.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
 gi|225200892|gb|EEG83246.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
          Length = 129

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 1   MCRKIIFA-----LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M + I+F      +   +I  Q+   +C     Q ++NQC    F    E+L   Y++  
Sbjct: 5   MKKLILFGTISGGILFWSIHLQADNFDCRNAATQTEINQCVYQDFQQKDEELNHIYQQYY 64

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            K+E  +++  +++Q+ W  +R   C + A   + G+   M+Y++CL+    ER   L++
Sbjct: 65  AKLEGVRKDQLKQAQLVWINFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTTERISDLKN 124

Query: 116 YL 117
           Y+
Sbjct: 125 YI 126


>gi|298291881|ref|YP_003693820.1| hypothetical protein Snov_1898 [Starkeya novella DSM 506]
 gi|296928392|gb|ADH89201.1| protein of unknown function DUF1311 [Starkeya novella DSM 506]
          Length = 139

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 3/118 (2%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQM 71
           I+  ++A +C +   Q  ++QC G +F     +L   Y ++  ++      +     +Q 
Sbjct: 20  ISGPALAQDCADP-TQMGLDQCAGAAFKKSDARLNQVYGQIAARLSGDAATKAKLVAAQR 78

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           AW  +R +ECAF A+G E G+  SM    C +     R  +LE  L C EGD  CP  
Sbjct: 79  AWIAFRDAECAFRAAGVEGGSIHSMTVTLCRKDVTDRRVTELEPLLNCEEGDTSCPVP 136


>gi|75910969|ref|YP_325265.1| hypothetical protein Ava_4773 [Anabaena variabilis ATCC 29413]
 gi|75704694|gb|ABA24370.1| Protein of unknown function DUF1311 [Anabaena variabilis ATCC
           29413]
          Length = 135

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 6   IFALTIIAIAFQSMA--------LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           I A + +  +  + A        LNC+    Q ++NQC+  S+    +KL   YK++L K
Sbjct: 12  ILACSTLLSSTVANAKSMLLAQNLNCDNAQTQLEINQCSKQSYQNADKKLNQAYKQLLPK 71

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +++ +++    +Q AW  +R S C F +S  E G+    +Y NCL+    +R ++L+ YL
Sbjct: 72  LQRSRKQKLIAAQQAWIKFRDSSCEFESSQYEGGSIAPSVYLNCLEKLTQQRTQELQEYL 131

Query: 118 T 118
            
Sbjct: 132 Q 132


>gi|197285104|ref|YP_002150976.1| hypothetical protein PMI1245 [Proteus mirabilis HI4320]
 gi|194682591|emb|CAR42652.1| putative exported protein [Proteus mirabilis HI4320]
          Length = 129

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFA------LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF       +   +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YVKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|166368170|ref|YP_001660443.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
 gi|166090543|dbj|BAG05251.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
          Length = 141

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 49/104 (47%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    Q+ MN C   ++     KL   Y+++L K+   +++    +Q AW  +R
Sbjct: 37  AQRPNCNNPQTQSQMNICASIAYQNADRKLNQVYRQLLPKLSAARKQKLITAQQAWIKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            S C F  S  E G+   MIY NCL     +R + L  YL   +
Sbjct: 97  DSSCEFERSAYEGGSIAPMIYGNCLAAVTEQRTKDLRRYLEDSD 140


>gi|159028823|emb|CAO89994.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 141

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 49/104 (47%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    Q++MN C   ++     KL   Y+++L ++   +++    +Q AW  +R
Sbjct: 37  AQRPNCNNPQTQSEMNICASIAYQNADRKLNQVYRQLLPRLSAARKQKLISAQQAWIKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            S C F  S  E G+   MIY  CL     +R + L  YL   +
Sbjct: 97  DSSCEFERSAYEGGSLAPMIYGFCLANVTEQRTKDLRRYLEDSD 140


>gi|227355531|ref|ZP_03839926.1| secreted protein [Proteus mirabilis ATCC 29906]
 gi|227164327|gb|EEI49216.1| secreted protein [Proteus mirabilis ATCC 29906]
          Length = 129

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFA------LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF       +   +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YAKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|295096268|emb|CBK85358.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 131

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 55/108 (50%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
             C++   Q +++ C    +    +KL  TY+  +++    QR+L +K+Q AW   R ++
Sbjct: 20  DECDKATTQTELSACAAEQYQAADKKLNQTYQAAIKRAAAPQRDLLKKAQQAWIALRDAD 79

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           C    SG E GT Q MI   CL     ER   L S + C EG+L CPF
Sbjct: 80  CKLMGSGTEGGTIQPMIINQCLTEKTAEREAFLASLMQCEEGNLSCPF 127


>gi|170748739|ref|YP_001754999.1| hypothetical protein Mrad2831_2321 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655261|gb|ACB24316.1| protein of unknown function DUF1311 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 144

 Score =  111 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 1/126 (0%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +CR +  A T+++ A  + A  C     QAD+N C G  +      L A Y ++ +K+  
Sbjct: 14  LCRGLALAATLLSPAPAAAADPCE-GTTQADLNACAGADYRAADTALNAVYGQLTKKIGP 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             ++    +Q AW  YR + C     G + G+A +M Y  CL+G    R + L+ YL C 
Sbjct: 73  KTKDALRGAQKAWLSYRDATCFLETLGLDGGSAYAMAYNGCLKGLTDARIKVLKGYLDCK 132

Query: 121 EGDLLC 126
             D+ C
Sbjct: 133 ADDVSC 138


>gi|282900925|ref|ZP_06308859.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194194|gb|EFA69157.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 139

 Score =  111 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 59/139 (42%), Gaps = 16/139 (11%)

Query: 1   MCRK----IIFALTIIAIAF---------QSMALNCNETLMQADMNQCTGNSFALVKEKL 47
           M +     I+    ++  +           + + NC   + Q DMN C      +   KL
Sbjct: 1   MKKPFIYIIMIVTGMLGSSALLVEPQLTAIAQSPNCVNRITQYDMNLCASLDAKVADGKL 60

Query: 48  EATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
              YK+V  +     + +L   +Q AW  YR + CAF+    + G+   M+Y  CL+   
Sbjct: 61  NQIYKQVRVRYNANPEAKLLIDAQKAWIKYRDASCAFSRGRFQGGSIVPMVYHGCLERLT 120

Query: 107 IERNEKLESYLTCPEGDLL 125
            ER ++LESYL   EG   
Sbjct: 121 KERTKELESYLQ--EGSFS 137


>gi|290510753|ref|ZP_06550123.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
 gi|289777469|gb|EFD85467.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
          Length = 131

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|288936192|ref|YP_003440251.1| hypothetical protein Kvar_3339 [Klebsiella variicola At-22]
 gi|288890901|gb|ADC59219.1| protein of unknown function DUF1311 [Klebsiella variicola At-22]
          Length = 131

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLISQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|186683924|ref|YP_001867120.1| hypothetical protein Npun_F3792 [Nostoc punctiforme PCC 73102]
 gi|186466376|gb|ACC82177.1| protein of unknown function DUF1311 [Nostoc punctiforme PCC 73102]
          Length = 140

 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 52/103 (50%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    QA +N+C  +S+    ++L   Y+++L  +EK +++    +Q AW  +R
Sbjct: 37  AQKFNCNNPQTQAAINECANSSYQNADKRLNRAYQQLLPTLEKSRKQKLIAAQQAWLKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            + C F  S  E G+    IY  CL+     R ++L+ YL   
Sbjct: 97  DTNCEFERSKYEGGSIAPSIYVGCLENLTKLRTQQLQEYLKSD 139


>gi|206575813|ref|YP_002239339.1| hypothetical protein KPK_3519 [Klebsiella pneumoniae 342]
 gi|206564871|gb|ACI06647.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 72/128 (56%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++ E  
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAEGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLLSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|152969596|ref|YP_001334705.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238894079|ref|YP_002918813.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae NTUH-K2044]
 gi|262043595|ref|ZP_06016706.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150954445|gb|ABR76475.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238546395|dbj|BAH62746.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259039067|gb|EEW40227.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 131

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|13473270|ref|NP_104837.1| hypothetical protein mll3812 [Mesorhizobium loti MAFF303099]
 gi|14024018|dbj|BAB50623.1| mll3812 [Mesorhizobium loti MAFF303099]
          Length = 143

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 3/132 (2%)

Query: 2   CRKIIFALTIIAIAFQSM--ALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            R+I+ +  ++ +A  S+  A  C+ +   Q  MN C G  +     KL A YK ++   
Sbjct: 5   MRRILLSACLVVLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADAKLNAAYKDLISSD 64

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +   + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R ++L +   
Sbjct: 65  DADGKRLLQVAQRAWITFRDAECAHSTAASAGGSIHAMEVSQCLTRLTNDRIKQLAASAN 124

Query: 119 CPEGDLLCPFIN 130
           C EGD  C   N
Sbjct: 125 CQEGDASCASPN 136


>gi|311108538|ref|YP_003981391.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
 gi|310763227|gb|ADP18676.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
          Length = 136

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 52/111 (46%), Gaps = 2/111 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKK--VLEKVEKHQRELFEKSQMAWEIYRGS 79
           +C     Q DM+ C   ++      L A YK+     K ++        +Q AW  +R +
Sbjct: 24  DCGNAATQTDMSLCADQAYRKSDAALNAAYKEVGARLKNDRDATTQLHAAQKAWLFFRDA 83

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
           ECAFA+S    G+A  M  + CL      R ++L +YL C EGDL CP   
Sbjct: 84  ECAFASSSTSGGSAYPMTLSLCLDKLTQARTKELRAYLKCEEGDLSCPVPG 134


>gi|167584243|ref|ZP_02376631.1| hypothetical protein BuboB_02839 [Burkholderia ubonensis Bu]
          Length = 130

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKK--VLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
           QA M+ C   ++     +L   Y+      +  +   E    +Q AW  YR +EC F+++
Sbjct: 26  QASMSACADRAYRKSDAELNRAYEAVTARVRANRPLAEKLVSAQRAWVAYRDAECGFSSA 85

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           GAE G+   M+ + CL      R E L+ YL+C EGDL CP  
Sbjct: 86  GAEGGSVHPMVVSMCLDDLTKARTESLQGYLSCEEGDLACPVP 128


>gi|330014289|ref|ZP_08307866.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
 gi|328533269|gb|EGF60026.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
          Length = 120

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 63/116 (54%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
               ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q+ L +++Q AW
Sbjct: 2   AGGAALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQQTLLKQAQQAW 61

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
              R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +GD  CP  
Sbjct: 62  IALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCEDGDQSCPLP 117


>gi|260461481|ref|ZP_05809728.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259032551|gb|EEW33815.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 139

 Score =  106 bits (265), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 3/131 (2%)

Query: 2   CRKIIFALTIIAIAFQSM--ALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            R+I  +  ++ +A  S+  A  C+ +   Q  MN C G  +     +L A Y+ ++   
Sbjct: 1   MRRIFLSACLVLLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADARLNAAYQDLISSD 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +   + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R  +L +   
Sbjct: 61  DADGKRLLQAAQRAWIAFRDAECAHSTAASAGGSIHAMAVSQCLTRLTDDRTRQLAAAAN 120

Query: 119 CPEGDLLCPFI 129
           C EGD+ C   
Sbjct: 121 CEEGDVSCASP 131


>gi|239946946|ref|ZP_04698699.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921222|gb|EER21246.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 118

 Score =  104 bits (260), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  L Q DM+ C    +  V ++L   Y+++L+ +  
Sbjct: 1   MKKAIIFCWLFLSSISCTFAVDCNNALTQGDMHYCADEEYKKVDKELNQIYQEILKHISD 60

Query: 61  --HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
              Q  L +KSQ  W  YR +EC F +     G+   MI   C       
Sbjct: 61  KQEQVNLLKKSQNLWIKYREAECEFQSFRVYGGSVYPMILLMCFTKKTKS 110


>gi|170736832|ref|YP_001778092.1| hypothetical protein Bcenmc03_4459 [Burkholderia cenocepacia MC0-3]
 gi|254249463|ref|ZP_04942783.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|124875964|gb|EAY65954.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|169819020|gb|ACA93602.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 138

 Score =  104 bits (260), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 2/114 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQMAWE 74
              A +C     Q  MN+C   ++A    +L   Y+ +  +++  +       ++Q AW 
Sbjct: 22  AHAAPDCANPQDQRTMNECASRAYARADAELNRRYRALQSRLKDDRDGARKLTEAQRAWI 81

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            +R +EC F       G+A+ +  A CL+     R+  L+ YL C EGD  CP 
Sbjct: 82  AFRDTECVFQTIRVAGGSAEPLARAACLEETTRSRSAALQRYLECGEGDTNCPV 135


>gi|296283721|ref|ZP_06861719.1| hypothetical protein CbatJ_08869 [Citromicrobium bathyomarinum
           JL354]
          Length = 128

 Score =  104 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 10/124 (8%)

Query: 5   IIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV---- 58
           I+ AL ++  + Q+    ++C+  + Q +MN C G  +     +L A +KK  ++     
Sbjct: 2   ILTALLLMQASAQAAQPQVDCDNAMTQMEMNVCAGREYQAADRELNAVWKKASQRAKSVD 61

Query: 59  ----EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
               +  Q      +Q AW  +R ++C+F A+    G+   +I + CL      R ++L 
Sbjct: 62  KDVGDGTQHRELLAAQRAWLTFRDAQCSFEANQYRGGSIMPLIRSTCLTALTEARTKQLR 121

Query: 115 SYLT 118
            YL 
Sbjct: 122 EYLE 125


>gi|229586281|ref|YP_002844782.1| hypothetical protein RAF_ORF0064 [Rickettsia africae ESF-5]
 gi|228021331|gb|ACP53039.1| Unknown [Rickettsia africae ESF-5]
          Length = 122

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEK--HQRELFEKSQMAWEIYRGSECAFAAS 86
           Q DMN C    +  V +KL   Y+++L+ +     Q  L +KS   W  YR ++C F + 
Sbjct: 3   QGDMNYCVAAEYKKVDKKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDADCEFRSF 62

Query: 87  GAEEGTAQSMIYANCLQGHAIERN---EKLESYLTCPEGDLLCPFI 129
           G   G+   MI   CL  +   R    ++ E+ L C EG+L CPFI
Sbjct: 63  GVYGGSVYPMILLMCLTSYRKNRRAYKKEFEAMLKCEEGNLSCPFI 108


>gi|291569164|dbj|BAI91436.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 219

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN     A+M +C  + +     KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNRNGSMAEMKKCADDDYRAADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L+ Y+
Sbjct: 121 RTAELQGYI 129


>gi|227823040|ref|YP_002827012.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
 gi|227342041|gb|ACP26259.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
          Length = 139

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 49/128 (38%), Gaps = 13/128 (10%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE- 64
           +  +   +   Q   ++C +   Q D+N C    +      L  TY K +  + +  +E 
Sbjct: 10  LLLVLATSAFAQEPEVDCQKAETQMDLNICADREYQAADADLNKTYGKAIAAMRETDKEL 69

Query: 65  ------------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
                         +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R  +
Sbjct: 70  GDIDAAYVGAVEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTAE 129

Query: 113 LESYLTCP 120
           L+  L   
Sbjct: 130 LKELLEAQ 137


>gi|284051526|ref|ZP_06381736.1| hypothetical protein AplaP_08626 [Arthrospira platensis str.
           Paraca]
          Length = 219

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN      +M +C  + +     KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNRNGSMMEMKKCADDDYRAADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L+ Y+
Sbjct: 121 RTAELQGYI 129


>gi|260459744|ref|ZP_05807998.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034546|gb|EEW35803.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 119

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            R ++  +  ++ A  +   +               + F    + L  T+K++ +++   
Sbjct: 1   MRFLLAVIATLSFATTAALAD-------------PASDFKRADQGLNQTFKQIQKRLADD 47

Query: 62  QREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
                   K+Q  W  +R +EC F + G + G+A  M+ A C      +RN++L++YL C
Sbjct: 48  SGGKARLVKAQRTWIAFRNAECTFQSGGDDGGSAAPMVAAACQAELTKDRNKQLKAYLNC 107

Query: 120 PEGDLLCPFI 129
            EGDL CP  
Sbjct: 108 QEGDLACPVP 117


>gi|209527286|ref|ZP_03275796.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
 gi|209492274|gb|EDZ92619.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
          Length = 219

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN     A+M +C  + + +   KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNPKGSMAEMKKCADDDYRVADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L++Y+
Sbjct: 121 RTAELQAYI 129


>gi|300864982|ref|ZP_07109813.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337017|emb|CBN54963.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 227

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + A+ CN      +M +C  +S+A+  +KL   Y++ + K+    +    ++Q AW  +R
Sbjct: 33  AQAVKCNPNGNTLEMRKCASDSYAVADKKLNQVYQQNISKLSGEYKNRLIQAQRAWITFR 92

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            + C F A+ A  GT + ++Y  CL+    ER   L+ Y
Sbjct: 93  DATCNFEAAEALGGTLEPLLYTGCLERVTSERTAYLQRY 131


>gi|282897347|ref|ZP_06305349.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
 gi|281197999|gb|EFA72893.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
          Length = 136

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELF 66
            L +   +  +   +C + + QA +NQC   +     +KL   YKK L   + K Q +L 
Sbjct: 21  ILIVTGTSAIAQFSDCQKAVTQAQLNQCAAINAKTADQKLNDAYKKALAIYKGKPQAKLL 80

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             ++ AW  YR + CAF+ S  E G+   M+Y NCL+    ER ++L  Y
Sbjct: 81  VAAEEAWIKYRDASCAFSRSRVEGGSIMPMVYLNCLERLTKERTQELARY 130


>gi|51245570|ref|YP_065454.1| hypothetical protein DP1718 [Desulfotalea psychrophila LSv54]
 gi|50876607|emb|CAG36447.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 149

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 45/115 (39%), Gaps = 2/115 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV--LEKV 58
           M + II  L + A    +  L+C++     D+N+C        +++++    K       
Sbjct: 11  MIKYIILGLGLFASVASAAELDCSKASNTLDINECAALELEGAEKEMQRYLGKSIKQYSF 70

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +    +  + +Q +W  Y  S C    +   +GT +  +  +C       R  +L
Sbjct: 71  DPAVVDSIKVAQQSWSQYEKSHCDSVYTVWRDGTIRGAMALSCQIRLTERRTHEL 125


>gi|319781594|ref|YP_004141070.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167482|gb|ADV11020.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 119

 Score = 99.5 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 39  SFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
            F    + L  T+K++ +++  +   +  F K+Q AW  +R +EC F +SG + G+A  M
Sbjct: 25  DFKRADQALNQTFKQIQKRLTDDSDGKARFVKAQRAWIAFRNAECTFQSSGDDGGSAAPM 84

Query: 97  IYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           + A C       R ++L++YL C EGDL CP  
Sbjct: 85  VAAACQADLTKARTKQLKAYLNCQEGDLSCPVP 117


>gi|262393949|ref|YP_003285803.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
 gi|262337543|gb|ACY51338.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
          Length = 138

 Score = 99.5 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I  L  ++    +   +++CN  +   ++NQC        + KL+      +E  
Sbjct: 1   MNKCLIIILASLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLDKYLNTSVEHN 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +       + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L E+
Sbjct: 61  SHDPELIAAIKLAQQDWQAYVSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHELWEN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|319781087|ref|YP_004140563.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166975|gb|ADV10513.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 140

 Score = 99.5 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 1/112 (0%)

Query: 16  FQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
             + A  C+ +   Q  MN C G  +     +L   Y+ ++   + + + L + +Q AW 
Sbjct: 17  SVARAQECDRSDDSQQMMNICAGEDYQAADARLNTAYQNLISSDDANGKRLLQVAQRAWI 76

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
            +R +ECA + + +E G+  SM  + CL     +R ++L +   C EGD  C
Sbjct: 77  TFRDAECAHSTAASEGGSIHSMEVSQCLTRLTNDRVKQLAAAANCEEGDGSC 128


>gi|262393946|ref|YP_003285800.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
 gi|262337540|gb|ACY51335.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
          Length = 138

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 54/134 (40%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I  L  ++    +   +++CN  +   ++NQC        + KLE       E  
Sbjct: 1   MSKCLIIILASLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLEKYLSTSFEHN 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +       + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L E+
Sbjct: 61  SHDPELISAIKLAQRDWQAYMSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHELWEN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|330820437|ref|YP_004349299.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
 gi|327372432|gb|AEA63787.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
          Length = 131

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 1/126 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            +    AL + + +  +    C ++   QA MN C   ++      L +TY+ ++ K+ +
Sbjct: 4   LKTSACALLLASSSVFAAQPGCMDKATTQAAMNACAAGAYKQSDAALNSTYRALVAKLGE 63

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             +   +++Q  W  +R ++CAF ASG + G+A  M+ + CL      +   L+S+L C 
Sbjct: 64  PGKTRLKEAQRRWLAWRDAQCAFEASGVDGGSATPMVTSQCLDQLTQAQTRLLDSHLHCQ 123

Query: 121 EGDLLC 126
           EGD+ C
Sbjct: 124 EGDISC 129


>gi|222149549|ref|YP_002550506.1| hypothetical protein Avi_3481 [Agrobacterium vitis S4]
 gi|221736531|gb|ACM37494.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 136

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 47/130 (36%), Gaps = 13/130 (10%)

Query: 2   CRKIIFALTIIAIAFQ---SMALNCNETLMQADMNQCTGNSFALVKEKLEATY------- 51
            R I+ A   +  +     + AL+C +   Q+DM  C    F    + + A +       
Sbjct: 5   SRLIMLAGFGVMSSGHGVLAQALDCKDPKTQSDMTACAVQDFDAADKAMNAQWKITRKVF 64

Query: 52  ---KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
                 L+   K   +   K+Q AW  YR  +C         GT + M  A C       
Sbjct: 65  VEQDATLDDDLKGAEKALLKAQRAWIDYRDGQCEAQGFYVRGGTMEPMEVAACKAEMTKT 124

Query: 109 RNEKLESYLT 118
           R ++L+S   
Sbjct: 125 RTKELKSLAE 134


>gi|163760965|ref|ZP_02168043.1| hypothetical protein HPDFL43_02979 [Hoeflea phototrophica DFL-43]
 gi|162281746|gb|EDQ32039.1| hypothetical protein HPDFL43_02979 [Hoeflea phototrophica DFL-43]
          Length = 138

 Score = 97.5 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 47/136 (34%), Gaps = 18/136 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R++      +  A  +++ +   C     Q  M  C G  +     +L   + +    
Sbjct: 1   MSRRLALFFLGLLYATPALSEDKLDCANPQDQYSMTYCAGVDYENADAELNRVWPQARAA 60

Query: 58  VEKHQRE---------------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
            ++                       +Q AW  +R +EC + +     GT Q MI + CL
Sbjct: 61  AKRQDEYIADDARSRGLLTASEALLAAQRAWLKFRDAECEYQSYAFFGGTGQPMIGSLCL 120

Query: 103 QGHAIERNEKLESYLT 118
                ER E+L   L 
Sbjct: 121 AQLTRERTEQLRQGLN 136


>gi|167624363|ref|YP_001674657.1| hypothetical protein Shal_2440 [Shewanella halifaxensis HAW-EB4]
 gi|167354385|gb|ABZ76998.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 135

 Score = 97.5 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 45/114 (39%), Gaps = 2/114 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           M + I+F L + + A  +  +NC+      ++NQC        K +++    K  E    
Sbjct: 1   MKKYILFTLALASTASFADEINCDTAYSTIEINQCAAMELDAAKAEMQTYLAKSYEHNSY 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +       + +Q  W+ Y  S C    +   +GT + ++  +C       R  +
Sbjct: 61  DPQLINAIKVAQNDWQQYLTSHCDSVYTQWRDGTIRGVMAISCKTRLTKLRTYE 114


>gi|118591404|ref|ZP_01548802.1| probable urease-associated protein [Stappia aggregata IAM 12614]
 gi|118436076|gb|EAV42719.1| probable urease-associated protein [Stappia aggregata IAM 12614]
          Length = 140

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 42/120 (35%), Gaps = 10/120 (8%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL- 65
             L +          NC   + Q++M QC    +     +L A Y+  +EK+ +    L 
Sbjct: 15  LGLVLAGPVAAQETPNCENAMTQSEMTQCANLDWLRADAELNAVYRSAMEKMTETDAYLP 74

Query: 66  ---------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                      ++Q AW  YR   C      A  GT + M+   C       R ++L   
Sbjct: 75  EGLKGAVETLREAQRAWIPYRDKACDAYGFLARGGTMEPMLVYGCRADLTRNRIDELRQL 134


>gi|153833727|ref|ZP_01986394.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
 gi|148870006|gb|EDL68966.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
          Length = 138

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 58/134 (43%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL  ++    +   A++CN  +   ++NQC      + +++L       LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELKVAQKQLNKYLDTSLEHN 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +    +  + +Q  W+ Y  S C    +   EGT + ++  +C      +R  ++ ++
Sbjct: 61  SYDPELIKAIQVAQKDWQAYVTSHCDSVYTQWREGTIRGVMAISCETQLTQQRTHEIWQN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|320156248|ref|YP_004188627.1| hypothetical protein VVM_02724 [Vibrio vulnificus MO6-24/O]
 gi|319931560|gb|ADV86424.1| hypothetical protein VVMO6_01402 [Vibrio vulnificus MO6-24/O]
          Length = 137

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +    ++C+      ++NQC        K +LE   K   +  
Sbjct: 1   MKKSLILALASLSFGVLAGEEPIDCDTAFTTIEVNQCAAIELDAAKTELEKYLKASFDHN 60

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L E+
Sbjct: 61  SFDPKLVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMGISCKTKLTKQRTHELWEN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|261252704|ref|ZP_05945277.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
 gi|260936095|gb|EEX92084.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
          Length = 211

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 54/134 (40%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +    ++C+       +NQC        K +LE   K   E  
Sbjct: 75  MKKSLIIALASLSFGAVADEETIDCDAAFTTIQINQCAAIELDAAKTELEKYLKASFEHN 134

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L E+
Sbjct: 135 SFDSELVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMAISCKTKLTKQRTHELWEN 194

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 195 FLTYM--DSTPPVL 206


>gi|150397585|ref|YP_001328052.1| hypothetical protein Smed_2385 [Sinorhizobium medicae WSM419]
 gi|150029100|gb|ABR61217.1| protein of unknown function DUF1311 [Sinorhizobium medicae WSM419]
          Length = 140

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 51/127 (40%), Gaps = 13/127 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE--- 64
             T  A A Q    +C + + Q D+N C      +   +L  TY+  +  ++   +E   
Sbjct: 13  CCTAFASAQQQPEPDCRKAVTQTDLNICADKDHRMADAELNTTYRLAVAAMQATDKELGE 72

Query: 65  ----------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R ++L 
Sbjct: 73  IDAAYVGALEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTDELR 132

Query: 115 SYLTCPE 121
             +   E
Sbjct: 133 KIVESAE 139


>gi|260551396|ref|ZP_05825596.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260405559|gb|EEW99051.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 132

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 55/123 (44%), Gaps = 1/123 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R     ++ I  +     ++ C+    Q+ +N C+ N      +K+ + Y   ++++  
Sbjct: 5   MRITFLIMSTITCSVTFAGIDKCSNLPNQSALNTCSSNVLNSANQKINSVYANYMKELNP 64

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            ++   +++Q AW  Y+  +C F +S   +G+    ++  CL      R ++L+    C 
Sbjct: 65  TEKLQLKEAQRAWIQYKEKDCQFQSSPVLKGSLYPFVHNACLVEKTENRIKELQDMQECR 124

Query: 121 EGD 123
            G+
Sbjct: 125 SGN 127


>gi|156974420|ref|YP_001445327.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
 gi|156526014|gb|ABU71100.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
          Length = 138

 Score = 96.0 bits (237), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 58/134 (43%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL  ++    +   A++CN  +   ++NQC        +++L    +  LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELEAAQKQLNKYLETSLEHT 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +    +  + +Q  W+ Y  S C    +   EGT + ++  +C      +R  ++ ++
Sbjct: 61  SYDPELIKAIQVAQKDWQAYMTSHCDSVYTKWREGTIRGVMAISCKTQLTQQRTHEIWQN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|254501058|ref|ZP_05113209.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222437129|gb|EEE43808.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 44/122 (36%), Gaps = 10/122 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----- 59
           ++     +  A Q+  +NC E   Q DM  C    +     +L A YK  +  ++     
Sbjct: 10  VVAFGAALPPAVQAQDVNCKEPQTQLDMTICAKKDWEAADAELNAAYKTAMAAMKQTDSY 69

Query: 60  -----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                K   E    +Q AW  +R   C      A  G+ + M+   C      +R  +L+
Sbjct: 70  LSDDLKGAAETLTTAQRAWIPFRDKACESYGFLARGGSMEPMLVLQCRADLTRQRTSQLK 129

Query: 115 SY 116
             
Sbjct: 130 DL 131


>gi|300311203|ref|YP_003775295.1| hypothetical protein Hsero_1878 [Herbaspirillum seropedicae SmR1]
 gi|300073988|gb|ADJ63387.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 132

 Score = 94.8 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 54/110 (49%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            + A +C +   QA+MN C   +       L ATY    +K+++ ++    + Q+AW  Y
Sbjct: 21  AAQAADCTKAATQAEMNACASQTLTQSDADLNATYMAYRDKLDRARQNELREVQLAWLKY 80

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
           R   C F ++ +  G+  + +   CL     +R ++L++   C EGD+ C
Sbjct: 81  RDLSCRFESAASAGGSVAATVRQTCLAEKTRQRTDELKALAGCQEGDVAC 130


>gi|330961297|gb|EGH61557.1| lipoprotein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 128

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++     + +   + A +CN    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLATFIALGVGCSAQAEDCN--TNQASMNKCAANELATLDADLNKQYKAQMAWLQTPEKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++++ CL G    R ++L++Y+ C E 
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVHSQCLAGQTRVRVKQLKAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|148653992|ref|YP_001281085.1| hypothetical protein PsycPRwf_2195 [Psychrobacter sp. PRwf-1]
 gi|148573076|gb|ABQ95135.1| protein of unknown function DUF1311 [Psychrobacter sp. PRwf-1]
          Length = 142

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 51/115 (44%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
            ++    + +    +    CN    QA MNQC    +     KL + YK +   +   ++
Sbjct: 21  PLMLVTLLASTHAMASEEYCNGKYDQASMNQCAQADYKDEDAKLNSAYKTLRSLLNTEEK 80

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +  ++ Q+AW  YR   C F     + G+   ++ ++CL+ H   R +++E  + 
Sbjct: 81  DQLKQVQLAWISYRDKVCDFENRNEKGGSIYPLLTSSCLKKHTEVRRKQIEGEIN 135


>gi|313497188|gb|ADR58554.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 128

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 52/126 (41%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      MN C G    +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMNACIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +   +C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHV-QASGGTLAQLEGGSCIMDMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|26987557|ref|NP_742982.1| hypothetical protein PP_0821 [Pseudomonas putida KT2440]
 gi|24982231|gb|AAN66446.1|AE016274_3 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 136

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      M+ C G    +  ++L   YK
Sbjct: 9   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMSACIGAETQVQDQRLNRVYK 68

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +   +C+     +R  +
Sbjct: 69  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHV-QASGGTLAQLEGGSCIMDMTRDRAAE 127

Query: 113 LESYLT 118
           LE  L+
Sbjct: 128 LERVLS 133


>gi|15966225|ref|NP_386578.1| hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|307308576|ref|ZP_07588278.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
 gi|307317354|ref|ZP_07596794.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|1176943|sp|P42879|Y2472_RHIME RecName: Full=Uncharacterized protein R02472
 gi|545800|gb|AAB30137.1| orf5 3' of ureB [Sinorhizobium meliloti]
 gi|15075495|emb|CAC47051.1| Hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|306896943|gb|EFN27689.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|306900976|gb|EFN31585.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
          Length = 139

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 49/126 (38%), Gaps = 13/126 (10%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE---- 64
                   Q    +C + + Q D+N C    +     +L  TY+ V+  ++   +E    
Sbjct: 13  CCTAPANAQQPEPDCRKAVSQMDLNICADQDYRAADAELNKTYRLVVAAMQATDKELGDI 72

Query: 65  ---------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                      +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R  +L+ 
Sbjct: 73  DAAYAGALEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTAELKE 132

Query: 116 YLTCPE 121
            +   E
Sbjct: 133 LMESAE 138


>gi|239816230|ref|YP_002945140.1| hypothetical protein Vapar_3256 [Variovorax paradoxus S110]
 gi|239802807|gb|ACS19874.1| protein of unknown function DUF1311 [Variovorax paradoxus S110]
          Length = 130

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 37/95 (38%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C     Q  MN C    F      L   Y +V++ +    R      Q  W   R   C
Sbjct: 31  DCRPDGNQQQMNACAVRDFRAADAALNIRYGEVMKTLSPQMRVALRTEQRTWLKGRDPSC 90

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             A+   E G+   +++ +CL+    +R  +L+ +
Sbjct: 91  KRASKANEGGSIWPLVFNSCLEKSTRQRTAELDRW 125


>gi|149910712|ref|ZP_01899348.1| hypothetical protein PE36_01030 [Moritella sp. PE36]
 gi|149806251|gb|EDM66228.1| hypothetical protein PE36_01030 [Moritella sp. PE36]
          Length = 140

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 55/133 (41%), Gaps = 6/133 (4%)

Query: 1   MCRKI-IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKK--VLEK 57
           M + I    +++ + A  + +++C++     ++N C        + +++    K      
Sbjct: 1   MVKVITFLIMSVCSFATMAASVDCDKAFNTLEINYCAKVELDQAEAEMKLYLDKSIAQYI 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESY 116
            + H  E    +Q AW+ Y  S+C    +   +G+ + ++  +C      +R  +L   Y
Sbjct: 61  ADTHVVESINIAQSAWQSYSKSQCDSVFTMFRDGSLRVVMTLSCRTKLTQQRTYELWSQY 120

Query: 117 LTCPEGDLLCPFI 129
           LT    D   P +
Sbjct: 121 LTYM--DSSAPVL 131


>gi|304393298|ref|ZP_07375226.1| urease-associated protein [Ahrensia sp. R2A130]
 gi|303294305|gb|EFL88677.1| urease-associated protein [Ahrensia sp. R2A130]
          Length = 141

 Score = 92.1 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 40/117 (34%), Gaps = 11/117 (9%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE------ 64
           I+     +  ++CN      +M  C           L A +K+ +    +   +      
Sbjct: 20  ILVGGAHAQDVDCNTAGSTVEMKFCAAKELDRADADLNAAWKQAMAGARRDDADWLPQGL 79

Query: 65  -----LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                L   +Q  W  YR + C   A+ A  GT Q ++   CL     +R   L  Y
Sbjct: 80  PARADLLRDAQRKWITYRDAACDAQATMAYGGTLQPLLGTLCLTKLTEQRTADLREY 136


>gi|19070375|gb|AAL83828.1|AF347070_5 urease-associated hypothetical protein [Rhizobium leguminosarum bv.
           viciae]
          Length = 135

 Score = 92.1 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--------- 58
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +         
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHEAADKVLNAQYKKTRAAMVAIDKDLDG 70

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|116253474|ref|YP_769312.1| hypothetical protein RL3733 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258122|emb|CAK09223.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 135

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +         
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHETADKALNAQYKKTRAALAAIDKDLDG 70

Query: 61  ---HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                 +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|148546092|ref|YP_001266194.1| hypothetical protein Pput_0848 [Pseudomonas putida F1]
 gi|148510150|gb|ABQ77010.1| protein of unknown function DUF1311 [Pseudomonas putida F1]
          Length = 128

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 51/126 (40%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      M+ C G    +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMSACIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHV-QASGGTLAQLEGGTCILDMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|330986197|gb|EGH84300.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 128

 Score = 91.4 bits (225), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           I+ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   ILAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|330448040|ref|ZP_08311688.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492231|dbj|GAA06185.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 138

 Score = 91.4 bits (225), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 52/116 (44%), Gaps = 4/116 (3%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++ AL  ++    +    L+C+      ++N+C        + +L   +   LE  
Sbjct: 1   MKKYLLIALVCVSFPTFAAKKVLDCDNPRNTLEINECAAGKLDSAQAELSKYFAASLEHN 60

Query: 59  EKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           ++  +  +  E++Q  WE+Y  ++C+   +   +GT ++++  +C      ER   
Sbjct: 61  KEDPKLVKAIEQAQKDWEVYMKAQCSAVYTQWRDGTIRNVMALDCKTQLTKERTHD 116


>gi|190893132|ref|YP_001979674.1| urease-associated protein [Rhizobium etli CIAT 652]
 gi|190698411|gb|ACE92496.1| probable urease-associated protein [Rhizobium etli CIAT 652]
          Length = 135

 Score = 91.0 bits (224), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 47/125 (37%), Gaps = 10/125 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK- 60
              I  A+ + A +  +  ++C     Q+DM  C         + L A YKK    +   
Sbjct: 5   ICLIGAAMLLAAGSAFAQDIDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAI 64

Query: 61  ---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                       +   K+Q AW  YR +EC      A  GT + M+ A CL      R +
Sbjct: 65  DKDLDGDMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDRRTK 124

Query: 112 KLESY 116
           +L+  
Sbjct: 125 ELKEL 129


>gi|209550629|ref|YP_002282546.1| hypothetical protein Rleg2_3053 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536385|gb|ACI56320.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 135

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 47/125 (37%), Gaps = 10/125 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK- 60
              I  A+ + A +  +  ++C     Q+DM  C         + L   YKK    +   
Sbjct: 5   ICLIGAAMLLSAGSASAQDVDCQNPKTQSDMTSCEAARHDTADKALNVQYKKTRAALAAV 64

Query: 61  ---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                       +   K+Q AW  YR +EC      A  GT + M+ A CL     +R +
Sbjct: 65  DKDLDGDMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTK 124

Query: 112 KLESY 116
           +L+  
Sbjct: 125 ELKEL 129


>gi|325293753|ref|YP_004279617.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
 gi|325061606|gb|ADY65297.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
          Length = 136

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 52/121 (42%), Gaps = 10/121 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-- 63
           +      + AF   A +C     QADM  C G  +    ++L A Y+KV +++ +  +  
Sbjct: 12  VLLSLAASSAFADDAPDCTSPQTQADMTICAGKDYEKADKQLNAAYQKVRKQLAERDKTA 71

Query: 64  --------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                   +    +Q AW  +R + C      A  GT + M+ ++CL   + +R ++L  
Sbjct: 72  DESGKGAVDALVAAQRAWVAFRDANCDAFGFQARGGTMEPMLVSSCLADMSNKRADELRQ 131

Query: 116 Y 116
            
Sbjct: 132 L 132


>gi|218660911|ref|ZP_03516841.1| probable urease-associated protein [Rhizobium etli IE4771]
          Length = 135

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 48/125 (38%), Gaps = 10/125 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK- 60
              I  A+ + A +  +  ++C     Q+DM  C         + L A YKK    +   
Sbjct: 5   ICLIGAAMLLAAGSSFAQDIDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAI 64

Query: 61  ---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                       E   K+Q AW  YR +EC      A  GT + M+ A CL     +R +
Sbjct: 65  DKDLDGDMKGAEEALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTK 124

Query: 112 KLESY 116
           +L+  
Sbjct: 125 ELKEL 129


>gi|71734025|ref|YP_274036.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257484481|ref|ZP_05638522.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71554578|gb|AAZ33789.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|331013253|gb|EGH93309.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 128

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|213967489|ref|ZP_03395637.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|301386451|ref|ZP_07234869.1| lipoprotein, putative [Pseudomonas syringae pv. tomato Max13]
 gi|213927790|gb|EEB61337.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
          Length = 147

 Score = 90.6 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 123


>gi|302131207|ref|ZP_07257197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 143

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 3   LLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 60

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 61  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 119


>gi|241205999|ref|YP_002977095.1| hypothetical protein Rleg_3309 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859889|gb|ACS57556.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 135

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +         
Sbjct: 11  AMLLTAGAASAEDVDCNSPKTQSDMTACEAARHEAADKALNAQYKKTRAVLTAIDKDLDG 70

Query: 61  ---HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                 +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DRKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|302185085|ref|ZP_07261758.1| hypothetical protein Psyrps6_02039 [Pseudomonas syringae pv.
           syringae 642]
          Length = 128

 Score = 90.2 bits (222), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNVQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|330876103|gb|EGH10252.1| lipoprotein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 128

 Score = 90.2 bits (222), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A+  + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAVIALGIGCSAQAEDCD--ANQASMNKCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR-- 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|86358906|ref|YP_470798.1| urease-associated protein [Rhizobium etli CFN 42]
 gi|86283008|gb|ABC92071.1| probable urease-associated protein [Rhizobium etli CFN 42]
          Length = 134

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 44/119 (36%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A+  +     +  ++C     Q+DM  C         + L   YKK    +         
Sbjct: 10  AMLFVVDGASAQDVDCKNPQTQSDMTSCEEARHEAADKALNEQYKKTRAAMAAIDKDLDG 69

Query: 61  ---HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                 +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 70  DMKGAEKALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLAEETDKRTKELKEL 128


>gi|330964620|gb|EGH64880.1| lipoprotein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 128

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAEDCD--ANQASMNKCAANKLAALDANLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR-- 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|261252798|ref|ZP_05945371.1| hypothetical protein VIA_002822 [Vibrio orientalis CIP 102891]
 gi|260936189|gb|EEX92178.1| hypothetical protein VIA_002822 [Vibrio orientalis CIP 102891]
          Length = 137

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +   A++C+       +++C        K +LE   K   E  
Sbjct: 1   MKKSLIIALASLSFGALADEKAIDCDAAFTTIQISRCAAIELDAAKTELEKYLKASFEHN 60

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ES 115
             +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L E+
Sbjct: 61  SFDSELVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMAISCKTKLTKQRTHELWEN 120

Query: 116 YLTCPEGDLLCPFI 129
           +LT    D   P +
Sbjct: 121 FLTYM--DSTPPVL 132


>gi|86135932|ref|ZP_01054511.1| hypothetical protein MED193_17454 [Roseobacter sp. MED193]
 gi|85826806|gb|EAQ47002.1| hypothetical protein MED193_17454 [Roseobacter sp. MED193]
          Length = 133

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 44/123 (35%), Gaps = 11/123 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE------ 59
           + +L  + +   ++A +CN      +M  C    +     +L  TY+     +       
Sbjct: 10  LASLGALLLPGPALA-DCNNPQTTREMRHCAALEYERADTELNKTYQAAQRSMRSLDRDL 68

Query: 60  ----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
               K       ++Q AW  +R S C         GT + ++   C      +R+ +LE 
Sbjct: 69  PNDLKGASASLLRAQRAWIPFRDSACETEGFQFRGGTLEPLMVLTCKTHLTRQRSAQLEE 128

Query: 116 YLT 118
            + 
Sbjct: 129 LIE 131


>gi|289679641|ref|ZP_06500531.1| hypothetical protein PsyrpsF_40462 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 128

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  +    ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLRTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|159185199|ref|NP_355355.2| hypothetical protein Atu2403 [Agrobacterium tumefaciens str. C58]
 gi|159140464|gb|AAK88140.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 139

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 10/122 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           +       + A    A +C     QADM  C G       ++L A Y+K+ +++ +    
Sbjct: 14  LFLTGGAASAALAEEAPDCKAPQTQADMTICAGKDHEKADKELNAAYQKLRKQLAERDKT 73

Query: 63  --------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                    +    +Q AW  +R + CA A   A  G+ + M+ A+CL   + +R ++L 
Sbjct: 74  ADASGKGANDALVMAQRAWVAFRDANCALAGFQARGGSMEPMLIASCLADMSSKRADELR 133

Query: 115 SY 116
             
Sbjct: 134 QL 135


>gi|330897677|gb|EGH29096.1| hypothetical protein PSYJA_08965 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 128

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|289626416|ref|ZP_06459370.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649570|ref|ZP_06480913.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298486368|ref|ZP_07004430.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159096|gb|EFI00155.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866340|gb|EGH01049.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 128

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-R 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++    +
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTSAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|325271594|ref|ZP_08138101.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
 gi|324103274|gb|EGC00614.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
          Length = 128

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           MC++ +  L +  +   ++A +       C ++      M++C G    +  ++L   YK
Sbjct: 1   MCKQYLAGLALTCVLPLAVADDYTAAYVQCMDKASSTVAMSECIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W +YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLVYRDGNCQFHV-QASGGTMAQLEGGTCMMSMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|84385754|ref|ZP_00988784.1| hypothetical protein V12B01_12045 [Vibrio splendidus 12B01]
 gi|84379070|gb|EAP95923.1| hypothetical protein V12B01_12045 [Vibrio splendidus 12B01]
          Length = 140

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 14/117 (11%), Positives = 42/117 (35%), Gaps = 5/117 (4%)

Query: 1   MCRKI---IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + +   +     +  +     ++C   +   ++N C        + +L+       E 
Sbjct: 1   MKKVLTVVLLTCLPLLASASDDVIDCENAMNTIEINHCAAIELESAQAELDKYLAASFEH 60

Query: 58  VEKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
            +         +K+Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 61  NDYDAELVASIKKAQDSWQAYMSAHCNSVYTQWRDGSIRGVMALSCKTTLTKQRTHE 117


>gi|330889878|gb|EGH22539.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 128

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 62/125 (49%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L+  YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLKKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|89054239|ref|YP_509690.1| hypothetical protein Jann_1748 [Jannaschia sp. CCS1]
 gi|88863788|gb|ABD54665.1| protein of unknown function DUF1311 [Jannaschia sp. CCS1]
          Length = 119

 Score = 88.7 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 40/96 (41%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+    Q D+++C     A   E L   Y++V++ ++        ++Q AW  YR   C 
Sbjct: 23  CDPNQPQIDLSECHAREAARWDELLNIIYRRVIQTLDADGEVRLREAQRAWITYRDLTCE 82

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                   G+   MI + C+     +R   LE Y+ 
Sbjct: 83  MERMRYAGGSIAPMIQSQCVARLTEQRTRDLELYMR 118


>gi|170723526|ref|YP_001751214.1| hypothetical protein PputW619_4365 [Pseudomonas putida W619]
 gi|169761529|gb|ACA74845.1| protein of unknown function DUF1311 [Pseudomonas putida W619]
          Length = 128

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 48/126 (38%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M ++ +  L +      +MA +       C ++      M+ C      L   +L   YK
Sbjct: 1   MNKQYLMGLALACCIPVAMAEDNSPSYTQCMDKASSTVAMSSCIQAETQLQDARLNRAYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K+E   ++     Q  W  YR   C F    A  GT   +    C+     ER  +
Sbjct: 61  QLMGKLEAEPKKSLRDVQRQWIAYRDGNCKFHV-QASGGTMAQLEGGMCVLDMTRERAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|28869237|ref|NP_791856.1| lipoprotein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28852478|gb|AAO55551.1| lipoprotein, putative [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 128

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR-- 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|331016932|gb|EGH96988.1| lipoprotein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 124

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 3   LLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 60

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 61  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR-- 118

Query: 123 DLLCP 127
           D  CP
Sbjct: 119 DEGCP 123


>gi|90577411|ref|ZP_01233222.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
 gi|90440497|gb|EAS65677.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
          Length = 141

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M +  +     ++    +    L+C+      ++N C   +    +E+L       +E  
Sbjct: 1   MKKYWLIIFVCLSFPSFAAKKVLDCDNPRNTLEINDCASLTLTSAQEELSKYLAASVEHN 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             +    +  EK+Q  WE+Y  ++C    +   EGT ++++  +C      ER   
Sbjct: 61  KKDPELVKAIEKAQKDWEVYMKAQCNAVYTQWREGTIRNVMALDCKTQLTKERTHD 116


>gi|148975601|ref|ZP_01812472.1| hypothetical protein VSWAT3_03536 [Vibrionales bacterium SWAT-3]
 gi|145965029|gb|EDK30280.1| hypothetical protein VSWAT3_03536 [Vibrionales bacterium SWAT-3]
          Length = 140

 Score = 87.9 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 41/117 (35%), Gaps = 5/117 (4%)

Query: 1   MCRKIIFALTIIAIAFQSM---ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + I   L             A++C+  +   ++N C        + +L+       E 
Sbjct: 1   MKKAIALLLLTYFSGLAHAGEDAVDCDNAMNTLEINHCAALELESAQVELDKYLAASFEH 60

Query: 58  VEKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             +        + +Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 61  NAEDTELVGAIKVAQESWKAYMTTHCDSVYTQWRDGSIRGLMALSCKTKLTKQRTHE 117


>gi|66045087|ref|YP_234928.1| hypothetical protein Psyr_1843 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255794|gb|AAY36890.1| Protein of unknown function DUF1311 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 128

 Score = 87.9 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C +     E+ G+   ++ + CL      R ++L++Y+ C   
Sbjct: 65  QALKDAQRKWIALRDADCLYQTGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRA- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|86145123|ref|ZP_01063454.1| hypothetical protein MED222_04380 [Vibrio sp. MED222]
 gi|85836700|gb|EAQ54820.1| hypothetical protein MED222_04380 [Vibrio sp. MED222]
          Length = 143

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 41/117 (35%), Gaps = 5/117 (4%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + +   L        S + +   C   +   ++N C        + +L+   +   E 
Sbjct: 1   MKKALTVVLLTCLPLLASASDDVVDCENAMNTIEINHCASIELDTAQVELDQYLEASFEH 60

Query: 58  V--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
              +       + +Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 61  NAYDAELVSSIKMAQDSWQAYMTAHCDSVYTQWRDGSIRGLMALSCKTKLTKQRTHE 117


>gi|328541728|ref|YP_004301837.1| urease-associated protein [polymorphum gilvum SL003B-26A1]
 gi|326411480|gb|ADZ68543.1| Probable urease-associated protein [Polymorphum gilvum SL003B-26A1]
          Length = 139

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 54/134 (40%), Gaps = 15/134 (11%)

Query: 4   KIIFALTIIAIAFQSMA---LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +++ A+ ++  A  + A   ++C   L Q ++  C   ++      L A Y++ + ++ +
Sbjct: 5   RLVLAIALLLPAGAARAQETIDCGYPLSQMELTYCAEKAWEAADADLNAAYREAMARMRE 64

Query: 61  HQRE------------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
                             +++Q AW  YR   CA     A  GT +  +   CL    + 
Sbjct: 65  MDANLADMPDLQGAAEALKEAQRAWIPYRDKACAAYGFLARGGTMEPQLIYGCLATLTVR 124

Query: 109 RNEKLESYLTCPEG 122
           R E+L+      EG
Sbjct: 125 RAEELKDLAAGIEG 138


>gi|114570288|ref|YP_756968.1| hypothetical protein Mmar10_1738 [Maricaulis maris MCS10]
 gi|114340750|gb|ABI66030.1| protein of unknown function DUF1311 [Maricaulis maris MCS10]
          Length = 170

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 42/108 (38%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
              I    Q+      E    A M  C G+ +      L  +Y+ + E +         +
Sbjct: 56  TACIGEYAQACEQLAAEGETTAGMLACRGDEYEAWDRWLNESYRDLRESLSDESVVALRE 115

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +Q +W  +R  +C F AS    GT + +  A+CL     ER  +L  +
Sbjct: 116 AQRSWIAHRDQDCLFLASLYAGGTLERVEQASCLTRKTAERAIELLHW 163


>gi|254464354|ref|ZP_05077765.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685262|gb|EDZ45744.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 134

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 44/125 (35%), Gaps = 9/125 (7%)

Query: 1   MCRKIIFALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M R++I  L ++A    +  AL C     Q ++ +C       V+  L       L   E
Sbjct: 8   MLRRVIGVLIVLAQPVSADPALECGNAGSQVEIGECVAKDEERVEAALATALSFALTAAE 67

Query: 60  K--------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                          E  Q AWE YR   CAF  +    G+   +   +C       R +
Sbjct: 68  DLDEATGRSDAVPALEAGQKAWEAYREEHCAFVGATYGGGSGTGIAIRSCRTQLGRARID 127

Query: 112 KLESY 116
           +L  Y
Sbjct: 128 ELMRY 132


>gi|288947728|ref|YP_003445111.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
 gi|288898244|gb|ADC64079.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
          Length = 131

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 51/128 (39%), Gaps = 12/128 (9%)

Query: 2   CRKIIFALTIIAIAFQSMALN---------C--NETLMQADMNQCTGNSFALVKEKLEAT 50
            R++  +  +++    S A N         C      +  +M  C G        +L   
Sbjct: 1   MRRLALSAVLLSTCMISHANNELYTTRYSSCMDQAGGVTVEMLDCIGEELNTQDARLNGA 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           Y+K+  ++   +R+  + +Q  W  YR + C F     E GT   ++ A+C+     ER 
Sbjct: 61  YQKLRAQLSAERRKALQSAQRLWIQYRDANCDF-YLDPEGGTLHRVMAADCVLRETAERA 119

Query: 111 EKLESYLT 118
           ++LE    
Sbjct: 120 KELEGLAE 127


>gi|330973281|gb|EGH73347.1| hypothetical protein PSYAR_22614 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 128

 Score = 87.1 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + C+      R ++L++Y+ C   
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCMAEQTRVRLKQLQAYVACRA- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|254285006|ref|ZP_04959972.1| conserved hypothetical protein, putative [Vibrio cholerae AM-19226]
 gi|150425009|gb|EDN16786.1| conserved hypothetical protein, putative [Vibrio cholerae AM-19226]
          Length = 162

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 44/116 (37%), Gaps = 4/116 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++  L   +    +   +L+C   +   ++NQC   +    + +L    +   E  
Sbjct: 25  MKKWLLIMLASFSSVVSAENESLDCKNAMNTFEINQCASMALDSAQAELTKYLEASFEHN 84

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             +       + +Q  W+ Y  S C    +   +G+ + ++  +C      +R  +
Sbjct: 85  ANDPDLVSAIQVAQKDWQSYMSSHCNSVYTQWRDGSIRGVLAISCKTQLTRQRTHE 140


>gi|94969409|ref|YP_591457.1| hypothetical protein Acid345_2382 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551459|gb|ABF41383.1| protein of unknown function DUF1311 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 140

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 52/133 (39%), Gaps = 20/133 (15%)

Query: 1   MCRKIIFALTIIAIAFQSM-----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M + ++ A   + +   +         C +   QA++NQCT   F     +L   Y+  L
Sbjct: 1   MKKFLLLATLFLPVLSPAQRAKPDEDPCRKIQSQAELNQCTEKKFRTANSQLLKVYQGYL 60

Query: 56  EKVEKHQREL---------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
           + ++K+                    + +Q+AW  YR + C   A     G+ Q  +Y+ 
Sbjct: 61  QLLQKNLESAQTPAAKAQSTKTLDDLKAAQLAWINYREAHCQAEADLYAGGSIQPSMYSA 120

Query: 101 CLQGHAIERNEKL 113
           C++     R  +L
Sbjct: 121 CMETITRYRITQL 133


>gi|167031877|ref|YP_001667108.1| hypothetical protein PputGB1_0862 [Pseudomonas putida GB-1]
 gi|166858365|gb|ABY96772.1| protein of unknown function DUF1311 [Pseudomonas putida GB-1]
          Length = 128

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   ++A +       C ++      M+ C      +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPLAVAEDYTAAYGQCMDKASSTVAMSACINAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K+E  Q++   + Q  W  YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLEAGQQKNLREVQRKWMAYRDGNCQFHV-QASGGTLAQLEGGTCVMSMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|330955391|gb|EGH55651.1| hypothetical protein PSYCIT7_29416 [Pseudomonas syringae Cit 7]
          Length = 128

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    +A MN+C  N  A +  +L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANRASMNRCAANQQAALDAELNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|215481976|ref|YP_002324158.1| hypothetical protein ABBFA_000217 [Acinetobacter baumannii
           AB307-0294]
 gi|213987122|gb|ACJ57421.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
          Length = 132

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 43/119 (36%), Gaps = 2/119 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   I   LT I  A  +M  N         +N+C         +K+   Y      +  
Sbjct: 1   MKILIALILTTIPFATYAMCENERSNGTTISINECYKKEAQKSDKKIMQVYTNYKNTLNT 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
            +++   + Q +W  Y+  +C F  +    GT    ++A C+      R  +L+    C
Sbjct: 61  TEQKNLLEVQRSWISYKMKQCNFEVASY--GTIAGQLHAQCMINMNNRRINELKYMQDC 117


>gi|291569332|dbj|BAI91604.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 215

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 45/101 (44%), Gaps = 3/101 (2%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C     QAD++ C    +     +L +TY+++   +   +R+   ++Q+AW  +R ++C+
Sbjct: 34  CEGMNTQADLSACAIEKYRNADAQLNSTYQRLTSMISADRRQKLVQAQLAWIQFRDNQCS 93

Query: 83  FAASGA---EEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           F +S       G+   +I  +CL      R      Y+   
Sbjct: 94  FVSSATRGGRGGSMSPVIVYSCLTLLTQNRTNDFNHYIQSQ 134



 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 26/74 (35%), Gaps = 6/74 (8%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
               +  + + Y  +   +    +    +SQ +W  +R   C F       GT  S    
Sbjct: 144 LGQSERSMNSMYLTIAMNLSGEAQTNLNRSQSSWFNFRNLNCQFE------GTFASTGQN 197

Query: 100 NCLQGHAIERNEKL 113
            CL   A ER E L
Sbjct: 198 LCLTRMAQERYESL 211


>gi|330981962|gb|EGH80065.1| hypothetical protein PSYAP_25959 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 128

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELF 66
           A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   +++  
Sbjct: 10  AFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKKQAL 67

Query: 67  EKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLL 125
           + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E    
Sbjct: 68  KDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE--EG 125

Query: 126 CP 127
           CP
Sbjct: 126 CP 127


>gi|88800326|ref|ZP_01115892.1| hypothetical protein MED297_00450 [Reinekea sp. MED297]
 gi|88776903|gb|EAR08112.1| hypothetical protein MED297_00450 [Reinekea sp. MED297]
          Length = 322

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 47/129 (36%), Gaps = 16/129 (12%)

Query: 2   CRKIIFAL-TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            + ++  L  ++ +   + + +C   +   +   C  +  + + E+L  +Y++      +
Sbjct: 11  IKSLLIGLSFLVCLDAGAASFDCENAVTSIEKEICRSSELSELDERLAKSYQQARSVSTE 70

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            +     ++Q+AW   R   C+  ++  E           CL      R   L  Y    
Sbjct: 71  DEALSIREAQIAWINDRDETCSEQSNLNE-----------CLIEQYKLRLIDLAVY---- 115

Query: 121 EGDLLCPFI 129
            G L  P +
Sbjct: 116 NGGLTTPVL 124


>gi|332290774|ref|YP_004429383.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332168860|gb|AEE18115.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 370

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 14/130 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVE 59
            + I+  L +          NC     QA+MN+     +    ++L   Y+K+L   +++
Sbjct: 90  MKNILAILILTLT------FNCFS-QTQAEMNKNANKEYRKADKELNIVYQKILSEYQLD 142

Query: 60  KHQRELFEKSQMAWEIYRGSECA----FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
               +  +K+Q  W  YR +E           AE G+   M  +  L+   +ER EKL  
Sbjct: 143 SFFIDRLKKTQRIWNSYRDAELEMKFPADNKQAEYGSVYPMCVSLFLKELTVERTEKLRV 202

Query: 116 YLT-CPEGDL 124
           +L    EG++
Sbjct: 203 WLNGIEEGNM 212


>gi|269104399|ref|ZP_06157095.1| lipoprotein putative [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268161039|gb|EEZ39536.1| lipoprotein putative [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 192

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 43/119 (36%), Gaps = 15/119 (12%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + +L  +     + + +C +     +   C+ N  A +   L   YK+ +      +++ 
Sbjct: 10  LLSLFALPTLAATPSFDCTKASSSVEELICSNNELATLDNTLNTVYKQAMANYPSTEKKQ 69

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE---SYLTCPE 121
            +  Q  W   R  EC  ++              +C+  +  +R  +L+     L  PE
Sbjct: 70  QKAMQRGWIKGRN-ECWKSSD-----------VLSCVADNYRDRILELQITGGLLKAPE 116


>gi|294140893|ref|YP_003556871.1| hypothetical protein SVI_2122 [Shewanella violacea DSS12]
 gi|293327362|dbj|BAJ02093.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 350

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 44/134 (32%), Gaps = 17/134 (12%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           R  IF    +     +  +NC +++ + +   C      L  ++L+  Y  + E      
Sbjct: 17  RLAIFVALCLPFKGFAAGINCEKSVTEIEKLICADQELLLQDDRLDVIYWTLQEDNPNFN 76

Query: 63  RE--LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
                  + Q  W   R  EC          +   +    CL+    +R   L S L  P
Sbjct: 77  FYRTRLRQEQREWLKTRDLECK---------SLDKVKLKYCLEEQYQQRITVLSSLLDAP 127

Query: 121 ------EGDLLCPF 128
                 +G+   PF
Sbjct: 128 IYIKSNDGNYDIPF 141


>gi|319793061|ref|YP_004154701.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
 gi|315595524|gb|ADU36590.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
          Length = 130

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 45/111 (40%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + AL   +    + A +CN    Q  MN C    F     +L   Y  V++ +    R  
Sbjct: 15  VLALLAGSAQAAADADDCNPNGNQQQMNACAARDFRAADAELNIRYGDVMKTLSPQMRVA 74

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               Q AW   R   C  A+   E G+   ++++ CL+    +R  +L+ +
Sbjct: 75  LRNDQRAWLKGRDPACKRASKANEGGSIWPLVFSTCLEKSTRKRTAELDRW 125


>gi|300023292|ref|YP_003755903.1| hypothetical protein Hden_1779 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525113|gb|ADJ23582.1| protein of unknown function DUF1311 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 134

 Score = 85.2 bits (209), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 42/129 (32%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTIIAIAF---QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV--- 54
           M R I   + ++ +A     +  ++C       +MN C    F    + L   Y      
Sbjct: 1   MKRLIATIVLLLPLAPLSAYAQKIDCENASSTVEMNFCAEKDFKAADKDLNVAYANAVAF 60

Query: 55  -------LEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHA 106
                           E    SQ AW  +R ++C    A     GT  +     C+    
Sbjct: 61  IKERKLDKPYDSASFEEALRVSQRAWLAFRDADCKDLIAQEWSGGTGTAAASLECMTAKT 120

Query: 107 IERNEKLES 115
            ER ++L+ 
Sbjct: 121 QERTKELKD 129


>gi|83649633|ref|YP_438068.1| large extracellular alpha-helical protein [Hahella chejuensis KCTC
           2396]
 gi|83637676|gb|ABC33643.1| Large extracellular alpha-helical protein [Hahella chejuensis KCTC
           2396]
          Length = 2040

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 42/119 (35%), Gaps = 14/119 (11%)

Query: 3   RKIIFALTIIAIA----FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           R     L  I+ +        + +C +   Q +   C     A    KL   Y  V++ +
Sbjct: 5   RSGFLFLLAISGSGLSWAGQPSFDCAKASQQVEHIICDSEPLAAQDAKLAKLYGNVMKSL 64

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           E+  ++  +  Q  W   R  +C       E          +CL G   +RN +L + L
Sbjct: 65  EQSAKDKLKSEQREWLRNRNRDCDLNGDAGE----------SCLLGRYRQRNAELSAML 113


>gi|153872634|ref|ZP_02001469.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152070895|gb|EDN68526.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 366

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 39/114 (34%), Gaps = 13/114 (11%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
               II+    + + NC++         C+        E+L   YK++   + K + +  
Sbjct: 22  VLFLIISPPIAAASFNCSKAHTVIKKTICSNTQLNKADEQLGKIYKQLRNSLPKWKFDTI 81

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           +K Q  W   R   C+       +G         CLQ     R  +L + +   
Sbjct: 82  KKEQRQWLKQRNFNCS-------DGNVY------CLQSMNELRIIELRAEIERR 122



 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A QS + +C +     + + C  N  +LV  ++   Y ++ + + + + +L  + Q  W 
Sbjct: 123 AIQSPSFDCAKARTVVEKSICRNNQLSLVDSEMGEIYSQLRQVLPRWEFDLLRREQRHWL 182

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R   C+       +G        +CLQ     R  +L 
Sbjct: 183 KQRNFNCS-------DGDI------SCLQSIYERRITELR 209


>gi|218508661|ref|ZP_03506539.1| urease-associated protein [Rhizobium etli Brasil 5]
          Length = 118

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 10/106 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV----------EKHQRELFEKSQ 70
           ++C     Q+DM  C         + L   YKK    +           K   +   K+Q
Sbjct: 7   IDCQNPKTQSDMTSCEVARHETADKALNEQYKKTRAAMVAIDKDLDGDMKGAEKALVKAQ 66

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            AW  YR ++C      A  GT + M+ A CL     +R ++L+  
Sbjct: 67  RAWIDYRDAQCDAFGFQARGGTMEPMLVAGCLAEETDKRTKELKEL 112


>gi|302058656|ref|ZP_07250197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato K40]
          Length = 131

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEI 75
            + A NC+    QA MN C  N  A +   L   YK  +  ++   +++  + +Q  W  
Sbjct: 3   SAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKKQALKDAQQKWIA 60

Query: 76  YRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 61  LRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 107


>gi|77163935|ref|YP_342460.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|254436262|ref|ZP_05049769.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
 gi|76882249|gb|ABA56930.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|207089373|gb|EDZ66645.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
          Length = 205

 Score = 83.7 bits (205), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 60/113 (53%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + +++    A Q   +  +  + QA+MN   GN++   + KL+A  +++ E +   +  L
Sbjct: 78  VLSISYEEEAKQVREIEMSTAMTQAEMNIVAGNAYQSAERKLDAILEQIKEFLSPEESAL 137

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +++  AW  Y+ S   F+AS  E G+ Q +IYA+ ++   + R  +LE+ L 
Sbjct: 138 LDEANQAWRTYQKSHADFSASQYEGGSIQPLIYASTMETVTVARIVELEAELK 190


>gi|254472834|ref|ZP_05086233.1| conserved hypothetical protein, putative [Pseudovibrio sp. JE062]
 gi|211958298|gb|EEA93499.1| conserved hypothetical protein, putative [Pseudovibrio sp. JE062]
          Length = 160

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 39/86 (45%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C    +A+  ++L A Y ++++    + +   + +Q  W  +R   C+  A   E G
Sbjct: 69  MIYCAVQEYAVWDQRLNAAYYEIMDIASTNVQASLKSAQRNWIKFRDDTCSANALIYEGG 128

Query: 92  TAQSMIYANCLQGHAIERNEKLESYL 117
           T   +  + C+      R+ +LE +L
Sbjct: 129 THAPLTMSVCMGDQTAVRSLQLEQFL 154


>gi|260364947|ref|ZP_05777518.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260879657|ref|ZP_05892012.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260898869|ref|ZP_05907310.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308086629|gb|EFO36324.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308093386|gb|EFO43081.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308111746|gb|EFO49286.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
          Length = 132

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 46/129 (35%), Gaps = 11/129 (8%)

Query: 1   MCRKIIFALTIIAIAFQSM--------ALNC-NETLMQADMNQCTGNSFALVKEKLEATY 51
           M +  +  L + + +  +            C ++    A +  C   +      +L   Y
Sbjct: 1   MKQVFLPLLLLTSFSSFAQIEHPIDVELEACISDNSSTAGIGNCGSKAHEQWDAELNYYY 60

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIER 109
           K ++  ++ +Q+    +SQ +W  YR  E A   S      G+   +   + +     ER
Sbjct: 61  KTLMNVLDSNQKSSLRESQRSWIKYRDLEVANIKSIYGSKRGSMWGLTALSDITEITKER 120

Query: 110 NEKLESYLT 118
              L+ Y  
Sbjct: 121 ALALKKYFE 129


>gi|152992335|ref|YP_001358056.1| hypothetical protein SUN_0740 [Sulfurovum sp. NBC37-1]
 gi|151424196|dbj|BAF71699.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 40/85 (47%)

Query: 33  NQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT 92
            QC  + +    +KL + Y++V  K+ K +      +Q AW  +R +EC   A     G+
Sbjct: 35  MQCAYSEYDYWDKKLNSLYRQVKNKLPKEEIHNLVTAQRAWIKFRDTECYLEAYEMRGGS 94

Query: 93  AQSMIYANCLQGHAIERNEKLESYL 117
           A+  +   C      +R ++L S+L
Sbjct: 95  AEKQLNIGCKISMTEKRVKELYSFL 119


>gi|157411385|gb|ABV54344.1| hypothetical protein [Pseudomonas stutzeri]
          Length = 132

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 54/127 (42%), Gaps = 12/127 (9%)

Query: 2   CRKIIFALTIIAIAFQS---MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            R ++  +   +I+  +     + C +     D+ QC       V+  L   Y+++L+++
Sbjct: 3   LRALLLLIVFFSISANAGEVSEIECEKVFSTLDVEQCIAVELDKVEASLNEAYQRLLKQL 62

Query: 59  EK---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
            +           R+    +Q AW  +R ++C         G+ ++ IY +C +  A +R
Sbjct: 63  TQADTPQDNYTEYRKKLLIAQRAWIKFREADCDTQYEMHRSGSIRNSIYLSCKKQRAEQR 122

Query: 110 NEKLESY 116
             +L SY
Sbjct: 123 INELNSY 129


>gi|78061978|ref|YP_371886.1| hypothetical protein Bcep18194_B1128 [Burkholderia sp. 383]
 gi|77969863|gb|ABB11242.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 462

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 40/117 (34%), Gaps = 15/117 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + R  +  L   A    +  L+C +   Q +   C  N       +L   Y+K+ + + +
Sbjct: 9   LRRTFLLVLLAHAPQAFAAGLDCAQATSQTEKAICASNDLHQDDGRLSVFYRKLSDALPQ 68

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             R     +Q+ W   R  +C                   CL+   + R   L+S L
Sbjct: 69  GHRAALRTAQLGWLKTRD-QCGAD--------------HGCLEQRYLTRIGDLQSQL 110


>gi|312963008|ref|ZP_07777494.1| hypothetical protein PFWH6_4931 [Pseudomonas fluorescens WH6]
 gi|311282777|gb|EFQ61372.1| hypothetical protein PFWH6_4931 [Pseudomonas fluorescens WH6]
          Length = 126

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 44/124 (35%), Gaps = 9/124 (7%)

Query: 1   MCRKIIFA--LTIIAIAFQSMALN-----C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M R       L +      + A N     C +     ADM  C      +   +L   Y+
Sbjct: 1   MIRTTFAVSVLLLALCGTAAAAENPALKKCMDGADTTADMVTCNIKETKVQDTRLNKAYQ 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             L   E ++++  +  Q  W  YR + C F  S A  GT   +    C+      R ++
Sbjct: 61  TALAAQEGNRKQQLQDVQRLWIKYRDANCQFIGS-ATGGTIDQVNGTGCVLDMTQARAQE 119

Query: 113 LESY 116
           LE  
Sbjct: 120 LEDL 123


>gi|255321854|ref|ZP_05363004.1| conserved hypothetical protein [Campylobacter showae RM3277]
 gi|255300958|gb|EET80225.1| conserved hypothetical protein [Campylobacter showae RM3277]
          Length = 148

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 4/109 (3%)

Query: 16  FQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
            Q+    C  +    A M QC    FA+  + L   YKK +  +    ++  +  Q  W 
Sbjct: 42  SQARVDECMQKDSSTAGMIQCIDAEFAIQDKLLNQNYKKAMSVLNDENKKKLKDIQRKWV 101

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            Y+ ++C F       GT  ++  A+C      ER  +L +     EG+
Sbjct: 102 AYKEAKCPFV---PPMGTLYAVTAADCYLQMTKERARELANLAEDFEGN 147


>gi|28898621|ref|NP_798226.1| hypothetical protein VP1847 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28806839|dbj|BAC60110.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
          Length = 152

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 48/130 (36%), Gaps = 13/130 (10%)

Query: 2   CRKIIFALTIIAIAFQSMAL----------NC-NETLMQADMNQCTGNSFALVKEKLEAT 50
           C K +F   ++  +F S A            C ++    A +  C   +      +L   
Sbjct: 20  CMKQVFLPLLLLTSFSSFAQIEHPIDVELEACISDNSSTAGIGNCGSKAHEQWDAELNYY 79

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIE 108
           YK ++  ++ +Q+    +SQ +W  YR  E A   S      G+   +   + +     E
Sbjct: 80  YKTLMNVLDSNQKSSLRESQRSWIKYRDLEVANIKSIYGSKRGSMWGLTALSDITEITKE 139

Query: 109 RNEKLESYLT 118
           R   L+ Y  
Sbjct: 140 RALALKKYFE 149


>gi|221066512|ref|ZP_03542617.1| protein of unknown function DUF1311 [Comamonas testosteroni KF-1]
 gi|220711535|gb|EED66903.1| protein of unknown function DUF1311 [Comamonas testosteroni KF-1]
          Length = 163

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 40/119 (33%), Gaps = 3/119 (2%)

Query: 3   RKIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + +       +++ Q++A    +C         N C    F       +  Y  V+  + 
Sbjct: 40  KLLAALFIAASLSQQALAQAGADCVPGGTTTQTNACAIKDFQQADTDHQILYGDVMRALS 99

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            H+R    K Q  W   R ++C  A    E        Y  CL      R+  L+ +L 
Sbjct: 100 AHERPALRKEQGEWSRQRITQCKQATKAFEAQPDWPSRYHGCLVQQITARDATLKRWLH 158


>gi|119486568|ref|ZP_01620618.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
 gi|119456185|gb|EAW37317.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
          Length = 141

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           + F      +   S  + C E     +M +C  + ++ +  +L  TY+ ++ K++ +QR+
Sbjct: 22  LTFNSFAAPVTQISQTIECREDGSMIEMKKCAQDKYSKIDRQLNQTYQTLMAKLDDNQRK 81

Query: 65  L-FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                +Q +W  +R   C++ AS A  G+ + ++  NCL     +R  +L+ Y++
Sbjct: 82  QRLISAQRSWIQFRDKSCSYEASEALGGSLEGLLLTNCLTRVTDQRTSELKEYVS 136


>gi|118444363|ref|YP_877264.1| lipoprotein [Clostridium novyi NT]
 gi|118134819|gb|ABK61863.1| lipoprotein, putative [Clostridium novyi NT]
          Length = 228

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 32/94 (34%), Gaps = 1/94 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                +M Q     +    + L   Y ++ + + K   E  +K +  W  YR  E    A
Sbjct: 135 AGTTLEMRQAAEEEYMTWDKHLNEIYSELKKDLSKDTMEKLKKEETQWISYRDREAKKDA 194

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
              + G+   +     L     +R  +L   Y+ 
Sbjct: 195 DSFKGGSFMPVQNLLSLGDLTKQRCYELVNKYMD 228


>gi|312114324|ref|YP_004011920.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219453|gb|ADP70821.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 128

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 50/127 (39%), Gaps = 13/127 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYKK 53
            R        +A +  + A         C ++ +  A    C G  F     +L   YK 
Sbjct: 1   MRIFFAFFICMAASSHARAEEVRQPLDACLDKAMSTAATVDCIGRDFERNDAELNRIYKT 60

Query: 54  VLEKVEKHQ-----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
           +LEK          R    +SQ AW  +R + C +  S    GT + +I + C+    I+
Sbjct: 61  LLEKNSSEDDAQEIRGRLIESQRAWLKFRDTNCNWRGSVMLGGTGEKVIVSGCVNQMTID 120

Query: 109 RNEKLES 115
           R ++L++
Sbjct: 121 RVKELKA 127


>gi|152992409|ref|YP_001358130.1| hypothetical protein SUN_0815 [Sulfurovum sp. NBC37-1]
 gi|151424270|dbj|BAF71773.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 2/119 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMAL-NC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M   ++  L++  +  Q      C +      D  QC  + +    ++L A Y+ V   +
Sbjct: 1   MRVVLLILLSVNVLMSQEPDFQKCYDSHPATNDWMQCAYHEYDYRDKQLNAVYRHVKNHL 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            K +     K+Q AW  +R  EC F A     G+A+      C      ER + L + L
Sbjct: 61  PKEEIPNLIKAQRAWITFRDRECCFEAYEMRGGSAEKQFTIGCKIALTRERVQSLRTLL 119


>gi|320353026|ref|YP_004194365.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
 gi|320121528|gb|ADW17074.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
          Length = 130

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 53/125 (42%), Gaps = 13/125 (10%)

Query: 4   KIIFALTIIAIAFQSMALN----------CNETLM--QADMNQCTGNSFALVKEKLEATY 51
           KI  A  ++    +  + +          C +       +M +C G       E+L   Y
Sbjct: 5   KIFMAGLVLCCLARIASADDSGLTKEFAACMDASGGVTVEMIECIGAETKRQDERLNKAY 64

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           K+V+ ++ + +++  + +Q AW  +R + C F A   + GT  ++   +C       R +
Sbjct: 65  KEVMAQLSETRQKQLQDAQRAWIKFRDAHCHFHADP-DGGTMATVRTNDCFLSATASRAQ 123

Query: 112 KLESY 116
           +LE +
Sbjct: 124 ELEGF 128


>gi|104780210|ref|YP_606708.1| hypothetical protein PSEEN0989 [Pseudomonas entomophila L48]
 gi|95109197|emb|CAK13894.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 128

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++      M  C      L  ++L   YK+++ K+E  Q++   + Q +W  YR   CAF
Sbjct: 32  DKASSTLAMGACIQAETKLQDDRLNRVYKQLMSKLEPQQQKDLREVQRSWVKYRDGNCAF 91

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +    G+   +  A CL   + +R  +LE  L+
Sbjct: 92  HGTL-SNGSLYRIEGAMCLMDMSKDRAAELERVLS 125


>gi|213028739|ref|ZP_03343186.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 63

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 32/60 (53%)

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 1   QVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 60


>gi|194290115|ref|YP_002006022.1| hypothetical protein RALTA_A2018 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223950|emb|CAQ69959.1| conserved hypothetical protein, DUF1311 [Cupriavidus taiwanensis
           LMG 19424]
          Length = 134

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 7   FALTIIAIAFQS---MALN---CN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            A+T I +A      ++ +   C  + +  ADM  C      +    L   Y+ +L ++E
Sbjct: 12  LAVTAIPLAAAQNGGLSADYERCTGKAVSTADMLGCAAQEMRVQDAALNGAYQSLLRRLE 71

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +      +Q  W  YR + CAF  S    G+A  +  A+C+      R  +L  +
Sbjct: 72  APRTGQLRVAQRVWLEYRQANCAFV-SNPGGGSAARLAGASCMLEMTAARVRELRGF 127


>gi|293610217|ref|ZP_06692518.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827449|gb|EFF85813.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124395|gb|ADY83918.1| hypothetical protein BDGL_003332 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 124

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 46/121 (38%), Gaps = 9/121 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI FA           A NC+      D   CT   +A     L   Y+ +  K+  
Sbjct: 1   MMKKIFFAFLCSFGVTSVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNT 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTC 119
            Q+ + +KSQ+AW   R +EC          + ++ +   C      ERN  L E    C
Sbjct: 61  AQKNILKKSQLAWIRQRDAECTD--------SNRNSVDVQCRLQTTQERNHWLQERLREC 112

Query: 120 P 120
            
Sbjct: 113 Q 113


>gi|325525409|gb|EGD03237.1| hypothetical protein B1M_17465 [Burkholderia sp. TJI49]
          Length = 332

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 41/110 (37%), Gaps = 13/110 (11%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + AL  + +A ++ + +C+      +   CT    + + E+L+ TY+  L   +      
Sbjct: 15  LVALGCLPVAARAASFDCHAARTSIEQAICTDAELSRLDEQLDDTYRVALGVADGDAATD 74

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              +Q AW   R            +G          LQ    +R  +L++
Sbjct: 75  LRTTQRAWLKAR---------LPADGRIDVRA----LQQAYRQRIAELQA 111


>gi|237755348|ref|ZP_04583977.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692479|gb|EEP61458.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 160

 Score = 80.6 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 54/136 (39%), Gaps = 20/136 (14%)

Query: 1   MCR----KIIFALTIIAIAFQSMALN-------------C--NETLMQADMNQCTGNSFA 41
           M R    +++ A  ++ +     +               C   E    A M  C+  +  
Sbjct: 1   MRRLKISRLLVAFILLILPTVGFSEEKEKKHPIDIWLEKCMERENYTTAGMLSCSSQALD 60

Query: 42  LVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYAN 100
              ++L   YK++++K+   +REL ++SQ+ W  +R +E  F  +     GT   ++   
Sbjct: 61  KWDKELNRIYKELIKKLSPEERELLKQSQLQWVKFRDAEFKFLDNLYLGIGTMIPVMIMG 120

Query: 101 CLQGHAIERNEKLESY 116
                   R + LE+Y
Sbjct: 121 EKLDIVSRRVKMLEAY 136


>gi|75910212|ref|YP_324508.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
 gi|75703937|gb|ABA23613.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
          Length = 417

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 1/97 (1%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
             LNC +   Q  +NQC        +    + Y    E++ K  +  F  +Q  W+ YR 
Sbjct: 253 PELNCVD-ETQIGLNQCAVYWSKTTQFLQSSIYGDWAERLSKQYQPTFGIAQKYWQDYRE 311

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + C       +EG+   M+Y  CL     +R   L+ 
Sbjct: 312 AHCTELVEPFQEGSMAPMLYHRCLARLNNDRIADLKG 348



 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 10/94 (10%), Positives = 27/94 (28%), Gaps = 1/94 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C   +   +   C      +        Y+ V  ++    +     +  +W  ++   C
Sbjct: 69  DCIRQVEAGEYR-CAKRWAEVTHLLKSLVYQDVESQLIPPLQNQLAIANQSWHQFQTQHC 127

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                         +  + CL     +R  +L+ 
Sbjct: 128 QQLTQRLRNTPDFPIATSVCLARLNNDRILELQR 161



 Score = 34.4 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 21/58 (36%), Gaps = 5/58 (8%)

Query: 62  QRELFEKS--QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +     S  Q  WE Y+   C    +     +  ++  A C QG    R  +LE  L
Sbjct: 180 DQLKLRNSSVQRHWEEYQTQYCQIEKALF---SLNTLRLAECHQGLRQARLHQLEELL 234


>gi|299768365|ref|YP_003730391.1| hypothetical protein AOLE_00575 [Acinetobacter sp. DR1]
 gi|298698453|gb|ADI89018.1| hypothetical protein AOLE_00575 [Acinetobacter sp. DR1]
          Length = 119

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 42/121 (34%), Gaps = 7/121 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALN----CNETLMQA-DMNQCTGNSFALVKEKLEATYKKVL 55
           M +KI   +  I I+  + A      C        D+  C    +    + L A Y+K +
Sbjct: 1   MNKKIQTYILTIFISSCAFADKVGSVCIPDSTVFNDILNCYLADYKKNDKILNALYQKKI 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + K  +E   +SQ  W   + + C   A   E G         C      ER   L+ 
Sbjct: 61  SNLSKGNKEKLRESQRDWIKEKEAVC--VADENEYGRESHFEAIKCQTEMTKERIYFLKK 118

Query: 116 Y 116
           Y
Sbjct: 119 Y 119


>gi|213967704|ref|ZP_03395851.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv. tomato
           T1]
 gi|301382341|ref|ZP_07230759.1| hypothetical protein PsyrptM_06897 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062950|ref|ZP_07254491.1| hypothetical protein PsyrptK_23429 [Pseudomonas syringae pv. tomato
           K40]
 gi|302130706|ref|ZP_07256696.1| hypothetical protein PsyrptN_04882 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927480|gb|EEB61028.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv. tomato
           T1]
          Length = 125

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 38/114 (33%), Gaps = 6/114 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI   L  +     + A  C +     D   C GN F+     L   Y  + + +   
Sbjct: 1   MKKIAIVLMAVVFPLGAHAAGCAKPRNAFDQVYCAGNLFSQSDRDLNQEYTALRKHLNPT 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           Q+   +  Q+AW   R ++C+              +  +C       R   L+ 
Sbjct: 61  QQSSLKSGQLAWIKQRDAQCSEEKPS------GYFVNLDCAVDMTQSRLAFLKE 108


>gi|60256941|gb|AAX14947.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 190

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 57/112 (50%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A      A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ F
Sbjct: 74  LATAYEEQAVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAF 133

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           EKS  AW  YR +   F +S    G+ Q +I+A+ L+   I R  +LE  L 
Sbjct: 134 EKSHQAWLQYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELEPLLR 185


>gi|50121103|ref|YP_050270.1| hypothetical protein ECA2175 [Pectobacterium atrosepticum SCRI1043]
 gi|49611629|emb|CAG75077.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 132

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 13/127 (10%)

Query: 1   MCRKIIFALTI--IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--- 55
           M + +I A  +  ++++    A +C      A+++ C        ++ L   + +     
Sbjct: 1   MKKILIAAAMLAGMSVSTSLWAADCANPSASAEVDSCAKQGKEATEQALNKAWSEAKGRI 60

Query: 56  -------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAI 107
                  +K++K  ++    SQ  W  YR S+C   A  AEEG TA   +  NC+     
Sbjct: 61  TTTYKADDKLQKEYQQNLVDSQRGWLKYRDSQCKMQAFLAEEGTTAHDTLTNNCISDIDK 120

Query: 108 ERNEKLE 114
           +R E+L+
Sbjct: 121 QRIEQLK 127


>gi|317405442|gb|EFV85754.1| hypothetical protein HMPREF0005_01558 [Achromobacter xylosoxidans
           C54]
          Length = 227

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 44/134 (32%), Gaps = 18/134 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M       L ++    Q+ + +CN+     +   C+    + +  KL+  YK  L   + 
Sbjct: 1   MKLLFTLGLAMLGTYAQAASFDCNKAASTTEKLICSDAETSALDGKLQGAYKAALAATDA 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTC 119
           + ++   + Q  W  Y    C  +A               CL+     R   L  +    
Sbjct: 61  YGKKALAEEQRNWIKYARGICQDSA---------------CLRQAYTSRIALLARNEKRI 105

Query: 120 PEGDL--LCPFINN 131
             G++   C    N
Sbjct: 106 ANGEVYSDCKLPGN 119


>gi|92118330|ref|YP_578059.1| hypothetical protein Nham_2828 [Nitrobacter hamburgensis X14]
 gi|91801224|gb|ABE63599.1| hypothetical protein Nham_2828 [Nitrobacter hamburgensis X14]
          Length = 557

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 42/122 (34%), Gaps = 7/122 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-EKVE 59
           MC  ++   T +A A      +C +   Q D   C  ++   +  ++   Y K +    +
Sbjct: 11  MCCALMLLPTALANA-SGPGFDCAKATRQIDKAICAWDTVGSLDGRMATAYTKAIAAHND 69

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI-----YANCLQGHAIERNEKLE 114
           +      +  Q AW   R   CA      +EG+   +         CLQ     R  +L 
Sbjct: 70  EAAIASVKADQKAWLSERDRRCALKTVKPKEGSEDGLSPQQFGQLMCLQSIYPPRIAQLM 129

Query: 115 SY 116
             
Sbjct: 130 DL 131


>gi|134094657|ref|YP_001099732.1| hypothetical protein HEAR1434 [Herminiimonas arsenicoxydans]
 gi|133738560|emb|CAL61605.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 134

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 53/131 (40%), Gaps = 10/131 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M +  +  L ++  +  +  ++ C       +M+ C    +     KL++TY+ +  ++ 
Sbjct: 1   MKKITLLFLALLPFSAFAQQIDPCIGKGSAQEMSACAKEEYKKASTKLDSTYQALQAQMP 60

Query: 60  KHQ---------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
                       ++  + +Q AW  +   +C            Q + Y +C++ HA+ R 
Sbjct: 61  AKDVAGIPYPAVKKQLKLAQQAWSGFVEQDCKTINIYNTGSVLQDVEYFSCMRLHAVHRT 120

Query: 111 EKLESYLTCPE 121
             LE +L+  E
Sbjct: 121 ADLEQFLSRRE 131


>gi|254503390|ref|ZP_05115541.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222439461|gb|EEE46140.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 50/126 (39%), Gaps = 13/126 (10%)

Query: 6   IFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-- 60
           +    ++ +   ++A    +C   L  ++   C   +     E L A Y++ LEK+ +  
Sbjct: 8   VLPAVLLGLCAPALADEKIDCGYPLNNSERTYCAEKALDQANEDLTAAYERALEKMTEVD 67

Query: 61  --------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
                         + +Q AW  +R  +C   +     GT  + +Y NC+    ++R + 
Sbjct: 68  TSLPEHLKGSPNALKAAQEAWTDFRDKDCTAYSFPFRGGTRGNELYRNCMIVMTMQRIDD 127

Query: 113 LESYLT 118
           L + + 
Sbjct: 128 LNAMVE 133


>gi|262374117|ref|ZP_06067394.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311128|gb|EEY92215.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 123

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 9/118 (7%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           KII  L +   +  +MA NC++     D   CT   +A     L   Y+++ +K+++ Q+
Sbjct: 3   KIILGLILGVASTFAMANNCDKARNTYDDIYCTNKIYASADADLNKNYQQLRQKLDETQQ 62

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK-LESYLTCP 120
           ++ +KSQ+AW  YR +EC            Q  +   C      ERN   LE    C 
Sbjct: 63  KILKKSQLAWIRYRDAECTDDQ--------QVSVDVQCRLSTTQERNHWLLERLRECQ 112


>gi|34497504|ref|NP_901719.1| hypothetical protein CV_2049 [Chromobacterium violaceum ATCC 12472]
 gi|34103359|gb|AAQ59721.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 128

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 41/102 (40%), Gaps = 9/102 (8%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE---------LFEKSQM 71
             C       ++N C    F    + L   Y+ +L+K+   + +         L  ++Q 
Sbjct: 22  DPCQNANNTLEINDCKQKQFDGRDKLLNERYRALLQKLRADEAQGGAKDKPSALLIQAQR 81

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            W  +R ++C        +G+ ++ ++ +C      +R ++L
Sbjct: 82  KWIAFRDADCNTKYQIYIDGSIRNAVFLDCKIERTEQRIKEL 123


>gi|307824477|ref|ZP_07654702.1| protein of unknown function DUF1311 [Methylobacter tundripaludum
           SV96]
 gi|307734461|gb|EFO05313.1| protein of unknown function DUF1311 [Methylobacter tundripaludum
           SV96]
          Length = 132

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 42/101 (41%), Gaps = 2/101 (1%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
             +  ++    +  + M +C          +L  TYK ++  +   +++  +++Q  W  
Sbjct: 30  TFATCMDQAGGVTPS-MVECMNAETERQDVRLNKTYKDIMAGLSPERKKQLQEAQRLWLK 88

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           YR + C F     + GT   +   +C       R ++LE++
Sbjct: 89  YRKANCDFYYD-PDGGTIARVSANDCFMSATAARAKELEAF 128


>gi|116748689|ref|YP_845376.1| hypothetical protein Sfum_1249 [Syntrophobacter fumaroxidans MPOB]
 gi|116697753|gb|ABK16941.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 315

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 37/120 (30%), Gaps = 20/120 (16%)

Query: 1   MCRKI---IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R +      + ++  A  + + +C +     +   C+    + + + ++  Y K L  
Sbjct: 1   MKRSVSIMAILVAVLPGAAGAASFDCGKAFTLVEKTVCSDRELSGLDDSMQQAYDKALAV 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           V         + Q  W       C                   CL+    +R  +L S L
Sbjct: 61  VPDPGP--LRREQRQWLKSERDACRDVR---------------CLKSRYEKRLGQLNSLL 103


>gi|120602355|ref|YP_966755.1| hypothetical protein Dvul_1310 [Desulfovibrio vulgaris DP4]
 gi|120562584|gb|ABM28328.1| conserved hypothetical protein [Desulfovibrio vulgaris DP4]
          Length = 230

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 43/128 (33%), Gaps = 18/128 (14%)

Query: 2   CRKIIFALTIIAIAFQ-----SMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVL 55
           C++++ A+  + I        + + +C        + + C  +  A++  +++  Y++  
Sbjct: 38  CKRLLLAIATLGIPAHVHAGVAPSFDCTHVEAGSIEADICASDDLAILDRQMDEVYRQAR 97

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +K            Q  W   R  EC  +                C++     R  +L++
Sbjct: 98  QKATDQHPPTLAAEQRGWIKGRN-ECWKSPD-----------RMACIRDQYQLRIAELQA 145

Query: 116 YLTCPEGD 123
                  D
Sbjct: 146 LYRLVASD 153


>gi|221214400|ref|ZP_03587371.1| EF hand domain protein [Burkholderia multivorans CGD1]
 gi|221165657|gb|EED98132.1| EF hand domain protein [Burkholderia multivorans CGD1]
          Length = 238

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 45/119 (37%), Gaps = 6/119 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            R I+    ++       A  C+          C   +    K+ L   YKK+       
Sbjct: 121 MRNIVLLTFLLFPLAS-FAEACDNGGNAYSDLSCVDRALDEAKKDLNEIYKKIYS--STQ 177

Query: 62  QRELFEKSQMAWEIYRGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +  FE+SQ AW  YR  +C     A +   +G   ++I  +CL     +R + L + L
Sbjct: 178 YKSEFEQSQKAWLNYREKQCRGYVAAEASQSQGVGPALITKDCLYAITKQRVDYLRTLL 236


>gi|295133448|ref|YP_003584124.1| hypothetical protein ZPR_1593 [Zunongwangia profunda SM-A87]
 gi|294981463|gb|ADF51928.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 52/129 (40%), Gaps = 14/129 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVE 59
            + +  AL   ++   +          Q ++NQ     FA   ++L   Y+ +L   K +
Sbjct: 1   MKLVFIALFCFSLNAVA--------QTQTELNQDAYAEFAEADKELNNVYQNILKTYKSD 52

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAA---SGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                  + +Q  W  +R +E          +  G++  M  A  L+    ER +KL+ +
Sbjct: 53  SQFISKLKSTQRIWIEFRNAELEMKFPRKDKSYYGSSYPMCKALYLKELTEERTKKLKVW 112

Query: 117 LT-CPEGDL 124
           L+   EGD+
Sbjct: 113 LSGIQEGDV 121


>gi|152993190|ref|YP_001358911.1| hypothetical protein SUN_1604 [Sulfurovum sp. NBC37-1]
 gi|151425051|dbj|BAF72554.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 152

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 51/124 (41%), Gaps = 11/124 (8%)

Query: 6   IFALTIIAIAFQSMA-----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKV 58
            F +  ++    S A     ++     +Q+ MN C    +      L  TYK++L   K 
Sbjct: 21  FFMIVFLSFGVNSYAETHCDMDAANKGIQSAMNICAAEDYHKANRLLNTTYKQLLDIHKK 80

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAE----EGTAQSMIYANCLQGHAIERNEKLE 114
           +K        +Q AW  +R +E     + A+     G+  S++++  +     +R + L+
Sbjct: 81  DKTFTSNLIVAQKAWIKFRDAEVKMILTYADQPGNYGSMNSLLWSMEMLSLTEQRIKVLQ 140

Query: 115 SYLT 118
            Y+ 
Sbjct: 141 GYIK 144


>gi|325522788|gb|EGD01268.1| hypothetical protein B1M_27421 [Burkholderia sp. TJI49]
          Length = 371

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 33/108 (30%), Gaps = 17/108 (15%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL  + IA  +   +C +     +   C   + + +  +L   +K  L   +       +
Sbjct: 36  ALLGLPIAAHAAGFDCAKAASPTEKAICADAALSRLDGELATAWKAAL--AKGGDTGALK 93

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            SQ+ W   R   C                  +CL     ER   L  
Sbjct: 94  ASQLKWLKQRDR-CGADR--------------DCLGDRYRERLASLNG 126


>gi|46580261|ref|YP_011069.1| hypothetical protein DVU1852 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449678|gb|AAS96328.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233754|gb|ADP86608.1| protein of unknown function DUF1311 [Desulfovibrio vulgaris RCH1]
          Length = 203

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 43/128 (33%), Gaps = 18/128 (14%)

Query: 2   CRKIIFALTIIAIAFQ-----SMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVL 55
           C++++ A+  + I        + + +C        + + C  +  A++  +++  Y++  
Sbjct: 11  CKRLLLAIATLGIPAHVHAGVAPSFDCTHVEAGSIEADICASDDLAILDRQMDEVYRQAR 70

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +K            Q  W   R  EC  +                C++     R  +L++
Sbjct: 71  QKATDQHPPTLAAEQRGWIKGRN-ECWKSPD-----------RMACIRDQYQLRIAELQA 118

Query: 116 YLTCPEGD 123
                  D
Sbjct: 119 LYRLVASD 126


>gi|121583505|ref|YP_973931.1| hypothetical protein Pnap_4780 [Polaromonas naphthalenivorans CJ2]
 gi|120596755|gb|ABM40189.1| protein of unknown function DUF1311 [Polaromonas naphthalenivorans
           CJ2]
          Length = 133

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 42/102 (41%), Gaps = 2/102 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +  ++     +   M +C           L   YK ++ ++   ++   +++Q AW  Y
Sbjct: 34  HAACMD-KSGGVTMGMIECITAENHRQDALLNKAYKALMAELPPPRKTQLQEAQRAWIKY 92

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           R + CAF     + GT   +   +C+     +R  +LES+  
Sbjct: 93  RDANCAF-YDDPDGGTLARVNANSCMMAATADRARELESFRQ 133


>gi|217979002|ref|YP_002363149.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
 gi|217504378|gb|ACK51787.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
          Length = 333

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/111 (17%), Positives = 35/111 (31%), Gaps = 9/111 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I        +A  + AL+C +     +   C   +     E +  TY  +   ++   R+
Sbjct: 7   ISVLTAAWLVAAPARALDCAKANTPIETAICANPAALAADEAMTKTYDGLAASLKPEHRQ 66

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
               SQ  W   R + C          + +     +CL     +R   L  
Sbjct: 67  ALLISQRRWLEQRANLCV---------SEEGKAVDSCLVEKTDDRRSFLAG 108


>gi|152981983|ref|YP_001355294.1| hypothetical protein mma_3604 [Janthinobacterium sp. Marseille]
 gi|151282060|gb|ABR90470.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 132

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C++   Q  MN C  + +    + L   YKK++ + E   ++    +Q AW  +R  +C
Sbjct: 30  DCDK--NQLTMNMCASHRYTTADKALNQQYKKLMVQQEAVGKQRLRDAQRAWISFRDKDC 87

Query: 82  -AFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            A      E G+   +++ +CL+ H ++R E L+
Sbjct: 88  LANTGLREESGSIWPLLHYSCLERHTVQRTEDLK 121


>gi|330818529|ref|YP_004362234.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
 gi|327370922|gb|AEA62278.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
          Length = 118

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 7/121 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +  I    ++ I   + A  C       D   CT  + A  K+ L A Y+K+      
Sbjct: 1   MKK--IICSLLLLIPLSAFAETCTGNGTVYDDLTCTNRTLAEAKKNLNAIYQKI--YAST 56

Query: 61  HQRELFEKSQMAWEIYRGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             +  FE+SQ AW  YR  +C     AA+   +G   ++I  +CL     +R + L++ L
Sbjct: 57  QYQAEFEQSQKAWLNYRDQQCNGYLAAAASQSQGEGPALIVRDCLAELTRQRVDYLKTLL 116

Query: 118 T 118
            
Sbjct: 117 E 117


>gi|327439017|dbj|BAK15382.1| hypothetical protein SSIL_0959 [Solibacillus silvestris StLB046]
          Length = 262

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 32/85 (37%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
           Q +M    G  F+     L   Y  + + +  +      + Q  W  YR  +   AA   
Sbjct: 172 QVEMTAAEGEIFSKWDMLLNEIYADLKKTLPPNDMSKLREEQRDWLEYRDEKAKEAALQY 231

Query: 89  EEGTAQSMIYANCLQGHAIERNEKL 113
           + G+ +++ Y +       ER  +L
Sbjct: 232 KGGSMETLQYVSTQAQLTKERCYEL 256


>gi|269121963|ref|YP_003310140.1| hypothetical protein Sterm_3370 [Sebaldella termitidis ATCC 33386]
 gi|268615841|gb|ACZ10209.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 137

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 40/131 (30%), Gaps = 19/131 (14%)

Query: 1   MCRKIIFALTIIAIAFQS-MALNC---------------NETLMQADMNQCTGNSFALVK 44
           M + I+F +  +A++  +    +                +     A+M      +     
Sbjct: 1   MKKFILFLVFTLAVSSFANYESDLLGRMKPVEQKSGSMLDSAQTTAEMINAVSYASNEWD 60

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
            +L   YK ++  + K  +     +Q +W   R       A     GT   +   +    
Sbjct: 61  AELNKIYKLLMSSLSKDGQNSLRNAQRSWIKERD---KKIAGENSGGTIDLVNKNSIFLE 117

Query: 105 HAIERNEKLES 115
              +R  +L  
Sbjct: 118 ETKKRTIELAR 128


>gi|251781148|ref|ZP_04824068.1| putative liporotein [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243085463|gb|EES51353.1| putative liporotein [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 217

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 34/95 (35%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           +     +M       +      L   Y  + +++        +  ++ W   R  +    
Sbjct: 123 KGGSTLEMKSAAKEEYERWDRALNEIYGVLQKQLSSDDMNKLKDEEIKWIAARDEQAKKD 182

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           +   + GTA+++IY   L     ER  +L E Y+ 
Sbjct: 183 SLQYKGGTAETLIYGMSLGQSTKERCYELVEKYMK 217


>gi|170078285|ref|YP_001734923.1| hypothetical protein SYNPCC7002_A1678 [Synechococcus sp. PCC 7002]
 gi|169885954|gb|ACA99667.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 319

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQMAWEIYRGSECAFA 84
             Q +MN+    SF    + +      +L + E+++   EL ++SQ AW IYR  +    
Sbjct: 220 NTQFEMNKFAEKSFREKDKIMNDIIDNLLSEFEENKDLIELIKESQNAWLIYREKQARIW 279

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +   + G+  +MIY N +     +R +++ + +   EG
Sbjct: 280 SEIVKGGSMYAMIYCNHMARLTDQRIDEMNNLIDREEG 317


>gi|126729534|ref|ZP_01745347.1| hypothetical protein SSE37_03650 [Sagittula stellata E-37]
 gi|126709653|gb|EBA08706.1| hypothetical protein SSE37_03650 [Sagittula stellata E-37]
          Length = 174

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 36/109 (33%), Gaps = 12/109 (11%)

Query: 18  SMALNC--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV----------EKHQREL 65
           + A  C          M+ C          +L A Y  V+ +              Q + 
Sbjct: 61  AAAETCMERNGSATVVMSACYDKEAQWWDSRLNAIYSDVMAQARDMDTENGEHAPSQADA 120

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             + Q AW  YR   C++ AS    GT     +  CL     E++  LE
Sbjct: 121 LRRMQRAWIDYRDETCSYEASQWGGGTGAGPAFNACLMRMTAEQSHYLE 169


>gi|299532370|ref|ZP_07045762.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
 gi|298719608|gb|EFI60573.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
          Length = 163

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 34/104 (32%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C      A  N C    F       +  Y  V+  +  H+R    K Q  W 
Sbjct: 55  ALAQAGADCVPGGTTAQTNACAIKDFQQADTDHQILYGDVMRALSAHERPALRKEQGEWS 114

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +R ++C  A    E        Y  CL      RN  L+ +L 
Sbjct: 115 RHRITQCKQATKAFEAQPDWPSRYHGCLVQQITTRNAVLKRWLH 158


>gi|264678920|ref|YP_003278827.1| hypothetical protein CtCNB1_2785 [Comamonas testosteroni CNB-2]
 gi|262209433|gb|ACY33531.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 155

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 33/104 (31%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C      A  N C    F       +  Y  V+  +  H+R    K Q  W 
Sbjct: 47  ALAQAGADCVPGGTTAQTNACAIKDFQQADTDHQILYGDVMRALSAHERPALRKEQGEWS 106

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             R ++C  A    E        Y  CL      R+  L+ +L 
Sbjct: 107 RQRITQCKQATKAFEAQPDWPSRYHGCLVQQITARDAVLKRWLH 150


>gi|60256948|gb|AAX14949.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 183

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 56/110 (50%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A      A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ F
Sbjct: 74  LATAYEEQAVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAF 133

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           EKS  AW  YR +   F +S    G+ Q +I+A+ L+   I R  +LE  
Sbjct: 134 EKSHQAWLQYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELEPL 183


>gi|152982086|ref|YP_001353309.1| hypothetical protein mma_1619 [Janthinobacterium sp. Marseille]
 gi|151282163|gb|ABR90573.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 135

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 55/130 (42%), Gaps = 10/130 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M +  +  LT++ +A  +  ++ C       +MN C   +    +EKL+  YK +L+++ 
Sbjct: 1   MNKITLAFLTLLPVAAFAQQVDPCLSKGTPQEMNACAKEADQKAQEKLDTVYKALLKQIP 60

Query: 60  KHQRE---------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
              +E             +Q  W  +   +C   +   +    + + Y +C + HA +R 
Sbjct: 61  AQDQEGIPYVATKKQLRIAQKEWSKFVEQDCKTVSIYNKGSILKDIEYFSCTRLHAEQRT 120

Query: 111 EKLESYLTCP 120
             LE +L+  
Sbjct: 121 SDLERFLSRR 130


>gi|317048721|ref|YP_004116369.1| hypothetical protein Pat9b_2512 [Pantoea sp. At-9b]
 gi|316950338|gb|ADU69813.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 131

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 48/127 (37%), Gaps = 12/127 (9%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M + II  L    +   + A + C + +   ++  C  ++    ++ L   Y     ++ 
Sbjct: 1   MKKGIIVFLFFGVLQNYANAQDVCGKAVNDGEVFSCFNSAKQAAEKTLNEEYIAAKNRIA 60

Query: 60  KHQ----------RELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIE 108
                             +SQ  W  YR  +C   +  AE+GT     +   C+    +E
Sbjct: 61  AEYSASPADLQSYTSTLTESQRGWLKYRDGQCNLESFMAEKGTVTYDTLKDKCVARVDLE 120

Query: 109 RNEKLES 115
           R E+L++
Sbjct: 121 RVEQLKA 127


>gi|31790362|gb|AAP58619.1| hypothetical protein [uncultured Acidobacteria bacterium]
          Length = 161

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 49/132 (37%), Gaps = 10/132 (7%)

Query: 3   RKIIFALTIIAIAFQSMAL-----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-- 55
           R  +F   ++       ++     +      Q  +N+     +     ++   Y++++  
Sbjct: 22  RLFVFVGAVVMFVLVVPSIVLPFSDATTRQTQLQLNEEACAEYKKADAEMNNVYRRIMKD 81

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECA--FAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            + +       +K+Q+AW  YR ++    F       G+   M     L     +R + L
Sbjct: 82  YRNDAPFIAALKKAQLAWIRYRDADLESIFPGDARSYGSINPMCRCMHLADTTKQRTKVL 141

Query: 114 ESYLT-CPEGDL 124
           + ++    EGD+
Sbjct: 142 QQWIDGVEEGDV 153


>gi|188590029|ref|YP_001921878.1| putative lipoprotein [Clostridium botulinum E3 str. Alaska E43]
 gi|188500310|gb|ACD53446.1| putative lipoprotein [Clostridium botulinum E3 str. Alaska E43]
          Length = 218

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 34/95 (35%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           +     +M       +      L   Y  + +++        +  ++ W   R  +    
Sbjct: 123 KGGSTLEMKSAAKEEYERWDRALNEIYGVLQKQLSSDDMNKLKDEEIKWIASRDEQAKKD 182

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           +   + GTA+++IY   L     ER  +L E Y+ 
Sbjct: 183 SLKYKGGTAETLIYGMSLGQSTKERCYELVEKYMK 217


>gi|260558007|ref|ZP_05830219.1| predicted protein [Acinetobacter baumannii ATCC 19606]
 gi|260408517|gb|EEX01823.1| predicted protein [Acinetobacter baumannii ATCC 19606]
          Length = 117

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 46/118 (38%), Gaps = 6/118 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K++ AL ++          C    + +D+ +C        K K+   Y K++  ++  
Sbjct: 1   MKKLMLALLVLFCGVAHA--ECKTGNIYSDI-ECFEKQLKTDKAKMNKIYNKLVSNLDSE 57

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE---GTAQSMIYANCLQGHAIERNEKLESY 116
            +   E SQ AW  YR  +C+           G    +I  +C      ER  +L+S 
Sbjct: 58  GKASLENSQKAWLDYRTKQCSGLMGYYGAQTLGAGSHLIILSCEADKTKERLNELKSL 115


>gi|325520864|gb|EGC99854.1| hypothetical protein B1M_34534 [Burkholderia sp. TJI49]
          Length = 147

 Score = 76.7 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI F + ++  A    A  C +T    D   C        K+ L + Y+K+       
Sbjct: 29  MKKIAFLVFLMLPATS-FAGTCADTANGHDDFSCVSRELENSKKDLNSIYQKIYS--STQ 85

Query: 62  QRELFEKSQMAWEIYRGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  FE+SQ AW  YR  +C     A +   +GT   +I  +CL     +R + L++ L 
Sbjct: 86  YKREFEQSQKAWLSYREKQCNGYIAAEASQSQGTGPGLITKDCLLTITRQRADYLKTLLE 145


>gi|207738961|ref|YP_002257354.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
 gi|206592332|emb|CAQ59238.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
          Length = 155

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 5/106 (4%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-FEKSQMAWEIYRGSEC 81
           C+       +N C+        + L A Y  +L K+          K+QMAW  +R  +C
Sbjct: 52  CDRDEST--INVCSEYHLVEADQLLNAAYANLLTKMRGTTSYAPLVKAQMAWTRFRDLDC 109

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
            + AS    GT       NC +   + R  ++ESYL C      CP
Sbjct: 110 EYYASSLVGGTMHGQWVMNCQRERTVARTRQIESYLRCEA--SGCP 153


>gi|308186545|ref|YP_003930676.1| type VI secretion system-associated hypothetical protein [Pantoea
           vagans C9-1]
 gi|308057055|gb|ADO09227.1| Putative type VI secretion system-associated hypothetical protein
           [Pantoea vagans C9-1]
          Length = 152

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 48/129 (37%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTIIA--IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M    +    + +   + Q+M+ +C+      ++N+C   +    +  L   YK    ++
Sbjct: 23  MKCYYLLLCVLASYVSSVQAMS-DCSNGNNTQEVNECAEKNKTESELNLNKEYKAAKIRI 81

Query: 59  ----------EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN-CLQGHAI 107
                         R  F  +Q  W  YR S+C   A  A+EG+   +   N C+     
Sbjct: 82  EHLYKGHDQESSQYRSAFVDTQRNWLKYRDSQCRLEAYAADEGSDAYVSVMNFCIDRLDK 141

Query: 108 ERNEKLESY 116
           ER   L+  
Sbjct: 142 ERTAILKQL 150


>gi|229592565|ref|YP_002874684.1| hypothetical protein PFLU5181 [Pseudomonas fluorescens SBW25]
 gi|229364431|emb|CAY52239.1| putative putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 126

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 2/106 (1%)

Query: 12  IAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
            + A  +    C +     ADM  C      +   +L   YK  L   E  +++  +  Q
Sbjct: 19  ASAADNAALKKCMDSANTTADMVSCNAKETKVQDARLNRAYKTALAAQEGARKQQLQDVQ 78

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             W  YR + C FA S A  GT   +  + C+      R ++LE  
Sbjct: 79  RLWIKYRDANCGFAGS-ATGGTLDQVNGSGCVLDMTQTRAQELEDL 123


>gi|117926070|ref|YP_866687.1| hypothetical protein Mmc1_2788 [Magnetococcus sp. MC-1]
 gi|117609826|gb|ABK45281.1| protein of unknown function DUF323 [Magnetococcus sp. MC-1]
          Length = 446

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 36/112 (32%), Gaps = 4/112 (3%)

Query: 5   IIFALTIIAI-AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ A  ++ + A ++ + +C+E     +   C+         +L   Y    +       
Sbjct: 13  MVLAAGMMGVQASEAASFDCSEARAPIEKLICSDTKLFEYDGRLGDAYLIARK--SSDTP 70

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +     Q  W   R   C        + +    I   CL  H   R  +LE 
Sbjct: 71  DKVRDGQREWIKTRNKACPVLTEDLGD-SRLKRILVGCLVPHYEARIGELEK 121


>gi|300698080|ref|YP_003748741.1| hypothetical protein RCFBP_mp30284 [Ralstonia solanacearum
           CFBP2957]
 gi|299074804|emb|CBJ54369.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
          Length = 239

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 5/106 (4%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-FEKSQMAWEIYRGSEC 81
           C+       +N C+        + L A Y  +L K+          K+QMAW  +R  +C
Sbjct: 136 CDRDEAT--INVCSEYHLVEADQLLNAAYTNLLTKMRGTTSYTPLVKAQMAWTRFRDLDC 193

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
            + AS    G        NC +   + R  ++ESYL C      CP
Sbjct: 194 EYYASSLVGGAMHGQWVMNCQRERTVARTRQIESYLRCEA--NGCP 237


>gi|262375777|ref|ZP_06069009.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309380|gb|EEY90511.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 131

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 47/130 (36%), Gaps = 13/130 (10%)

Query: 1   MCRK---IIFALTIIAIAFQSMALNCNETLM---------QADMNQCTGNSFALVKEKLE 48
           M ++   +  ++ I+  A  +   + +               +M  C          +L 
Sbjct: 1   MFKRTALLGLSMFILPPALYAGDNDLSRQYSNCMDRSGGVTVNMLDCIAAETDRQDTRLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             YK+ +  +  ++++  ++ Q  W  YR + C F  +    GT  ++   +C       
Sbjct: 61  NAYKQTMASLNANRKKQLQEVQRLWIRYRDANCDF-YADPNGGTIATVNSNSCYMEATAA 119

Query: 109 RNEKLESYLT 118
           R  +LE+   
Sbjct: 120 RATELENLRE 129


>gi|118591405|ref|ZP_01548803.1| probable urease-associated protein [Stappia aggregata IAM 12614]
 gi|118436077|gb|EAV42720.1| probable urease-associated protein [Stappia aggregata IAM 12614]
          Length = 143

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 51/133 (38%), Gaps = 20/133 (15%)

Query: 3   RKIIFALTIIAIAFQSMA----------LNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
           R +I     + +A    A          ++C   L  A+ + C   +      +++  + 
Sbjct: 4   RGLILPAFALFLAVAGTAGAEEEKVKDNIDCGYPLTNAERSFCADKALKEADARMQEAFD 63

Query: 53  KVLEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
           ++  ++ +                +++Q AW+ Y   +C   +     GT  + +Y NCL
Sbjct: 64  RLRVRLVEIDADLPDHLKGAPASLDEAQTAWKTYADKDCTAYSFPFRGGTRGNELYRNCL 123

Query: 103 QGHAIERNEKLES 115
               ++R E L++
Sbjct: 124 IVLTMKRTEDLDA 136


>gi|241766505|ref|ZP_04764371.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
 gi|241363275|gb|EER58825.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
          Length = 138

 Score = 76.0 bits (185), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 40/118 (33%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   +   +     A       C       + N C   +F     ++   Y  V+  +  
Sbjct: 13  MAFGVACVMLAGTHAHAQAGAACKPGGSVDETNACAVQAFQAADTQMAILYGDVMRALSA 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           H+R    + Q AW+  R + C  A   AE       +Y  CL      R + L  +LT
Sbjct: 73  HERPQLRQEQTAWQRERTTRCKQATRNAESAPHGPRLYHECLAAETQARRKDLMRWLT 130


>gi|284035669|ref|YP_003385599.1| hypothetical protein Slin_0737 [Spirosoma linguale DSM 74]
 gi|283814962|gb|ADB36800.1| protein of unknown function DUF1311 [Spirosoma linguale DSM 74]
          Length = 136

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 53/127 (41%), Gaps = 12/127 (9%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--VEKH 61
           K++ A  ++ +A  S          Q+ +N     +F    + L + Y+K+L++   +K 
Sbjct: 7   KLLIAGFLLIVATASF------GQTQSSLNNEQLQTFQQADKALNSVYQKILKQYSADKE 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAE---EGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +  + +Q  W  +R +E +           G+AQ M  A        +R   L  +LT
Sbjct: 61  FIKNLKIAQRIWVQFRDAEVSMKYPARPAGYYGSAQPMCEAAYRTELTQQRTRTLTVWLT 120

Query: 119 -CPEGDL 124
              EGD+
Sbjct: 121 GIEEGDV 127


>gi|285017822|ref|YP_003375533.1| hypothetical protein XALc_1030 [Xanthomonas albilineans GPE PC73]
 gi|283473040|emb|CBA15545.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 135

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 44/119 (36%), Gaps = 10/119 (8%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAW 73
            ++  + C+    QA ++ C          +L   Y++++ K+  +    +  + +Q  W
Sbjct: 17  ARADNVGCDPAGAQAQIDACAAQDLRKADAELNTVYRQIMAKLVKQPLALDKLKTAQRLW 76

Query: 74  EIYRGSECAFAA-------SGAEEGTAQSMIYANCLQGHAIERNEKLES-YLTCPEGDL 124
              R ++            +    G+    +YA+        R   L + +L   EGDL
Sbjct: 77  VQLRDADLEARYPAGNHRSAQVLYGSMYPTLYASAKAELTAARTAYLRATFLERREGDL 135


>gi|299771697|ref|YP_003733723.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
 gi|298701785|gb|ADI92350.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
          Length = 123

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 45/120 (37%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+ A           A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVLAFLCSFGMTAVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNMA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           Q+ + +KSQ+AW   R ++C          + ++ +   C      ERN  L E    C 
Sbjct: 61  QKNILKKSQLAWIRQRDADCTD--------SNRNSVDVQCRLQTTQERNHWLQERLRECQ 112


>gi|269119181|ref|YP_003307358.1| hypothetical protein Sterm_0554 [Sebaldella termitidis ATCC 33386]
 gi|268613059|gb|ACZ07427.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 293

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 33/89 (37%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              ADM      +      +L   YK ++EK+ K ++      Q  W   R S+   AA+
Sbjct: 200 QSTADMTAAINYASGAWDTELNIIYKLLMEKLSKEEQISLRDKQRNWIKMRDSKINEAAA 259

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLES 115
             E G+   +   +       +R  +L  
Sbjct: 260 EFEGGSMGRVTGRSVFLEETKKRTLELSR 288


>gi|262280845|ref|ZP_06058628.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257745|gb|EEY76480.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 123

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 45/120 (37%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            RKI FA           A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MRKIAFAFLCSLGMTVVYADNCDSARNTYDDIYCTNKIYASADVDLNKNYQALRVKLNTA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           Q+ + +KSQ+AW   R +EC          + ++ +   C      ERN  L E    C 
Sbjct: 61  QKNILKKSQLAWIRQRDAECTD--------SNRNSVDVQCRLQTTQERNHWLQERLRECQ 112


>gi|156932861|ref|YP_001436777.1| hypothetical protein ESA_00658 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531115|gb|ABU75941.1| hypothetical protein ESA_00658 [Cronobacter sakazakii ATCC BAA-894]
          Length = 401

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 40/129 (31%), Gaps = 13/129 (10%)

Query: 2   CRKIIFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R++   +T+   A  +   + +C++     +   C   S   +  K+  +Y +    + 
Sbjct: 10  LRRLALCVTLACGAAPAIGASFDCDKAGTPVEHAICQQTSLGELDSKISDSYLRATSSMT 69

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
                     Q AW   R + CA  AS              CL      R E+LE     
Sbjct: 70  AQDAAALRTEQRAWLKTRNA-CAGNASE----------LNACLMATMKPRAEQLERIARR 118

Query: 120 PEGDLLCPF 128
              D     
Sbjct: 119 ATHDFDAAV 127


>gi|30250366|ref|NP_842436.1| putative periplasmic protein [Nitrosomonas europaea ATCC 19718]
 gi|30181161|emb|CAD86356.1| putative periplasmic protein [Nitrosomonas europaea ATCC 19718]
          Length = 150

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 50/129 (38%), Gaps = 13/129 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVE 59
            R ++F + ++  A             QAD+N     ++    +KL A Y+++L   K +
Sbjct: 24  IRSVVFFVCVLLCAI-------ANAQTQADLNDDACGAYQEADKKLNAIYQQLLEQHKDD 76

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAA----SGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +      K+Q AW  +  +E            E G+   M            R E+L  
Sbjct: 77  ANFTTRLRKAQRAWLAFWDAEMEAIYPADNKREEYGSIYPMCSCLEQAALVNHRIEQLSG 136

Query: 116 YLTCPEGDL 124
           +LT  EGD+
Sbjct: 137 WLTAEEGDV 145


>gi|254440143|ref|ZP_05053637.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
 gi|198255589|gb|EDY79903.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
          Length = 174

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 34/100 (34%), Gaps = 13/100 (13%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVE-------------KHQRELFEKSQMAWE 74
               M  CT   +      L   Y  +++ +               ++ +    +Q AW 
Sbjct: 67  TTVGMMFCTLAEYEAWDRLLNRDYGPMMDGMRRLDAEDAEFFPEFANRADALRDAQRAWI 126

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R ++CA   +    G+ + +  A+CL     +R   L 
Sbjct: 127 PLRDAQCALEYAMWGGGSMRQIAGASCLLDLTAKRTIYLR 166


>gi|121594364|ref|YP_986260.1| hypothetical protein Ajs_2008 [Acidovorax sp. JS42]
 gi|120606444|gb|ABM42184.1| protein of unknown function DUF1311 [Acidovorax sp. JS42]
          Length = 142

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 37/100 (37%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C 
Sbjct: 35  CRPGGTVDETNACAVQRYQEADTATQILYGDVMRALSAHERPALRQDQAAWQRTRAAQCK 94

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            A   AE       +Y +CL  H   R + L  +L   E 
Sbjct: 95  QAQRAAESRPEWPRLYHDCLTVHTQARRDALMHWLHHGEA 134


>gi|115359025|ref|YP_776163.1| hypothetical protein Bamb_4276 [Burkholderia ambifaria AMMD]
 gi|115284313|gb|ABI89829.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 129

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 43/118 (36%), Gaps = 9/118 (7%)

Query: 1   MCRKIIFALTII---AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K + A   +   A+ F + A  C +     D   C+ N F+ +  +L   Y +V + 
Sbjct: 1   MKKKNLLASFALLGLAVPFAAQAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKH 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   + SQ+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKTSQLAWMKQRDDRCSETRDD------GYLVNLQCAIDATQSRLSFLRE 112


>gi|90413313|ref|ZP_01221307.1| hypothetical protein P3TCK_17099 [Photobacterium profundum 3TCK]
 gi|90325714|gb|EAS42177.1| hypothetical protein P3TCK_17099 [Photobacterium profundum 3TCK]
          Length = 510

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/117 (16%), Positives = 43/117 (36%), Gaps = 16/117 (13%)

Query: 2   CRKIIFALTIIAIA----FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            +  + A  +   +      S + +C++   Q +   CT ++ A++  K++  Y++ L+ 
Sbjct: 3   LKLTMLATVLSIFSPFLWATSPSFDCDKASSQVEERICTDDALAVLDIKMKKVYEQALQN 62

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +   +R   +  Q  W   R  EC                   C++     R   L+
Sbjct: 63  IPDSERSTMKAMQRGWIKGRN-ECWKGQDE-----------RACVEYAYKSRIVALQ 107


>gi|145300412|ref|YP_001143253.1| hypothetical protein ASA_3537 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853184|gb|ABO91505.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 198

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 40/116 (34%), Gaps = 14/116 (12%)

Query: 1   MCRKII--FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++       +     + + +C +    A+   C   + A +  +L   Y K L  +
Sbjct: 1   MNKLLLGPLLFAPLLACAATPSFDCAKASGAAETLICKDAALAALDNELATLYPKALANL 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              Q +  +  Q  W   R  +C  A                C++ +  +R  +L+
Sbjct: 61  SPEQLKTEKAMQRGWIKGRN-DCWKAKDL-----------RQCVEENYQQRITELQ 104


>gi|54308436|ref|YP_129456.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
 gi|46912865|emb|CAG19654.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
          Length = 512

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 44/114 (38%), Gaps = 12/114 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   ++   +    A  S + +C++   Q +   CT ++ A++  K+E  Y++ L+ +  
Sbjct: 7   MLVTVLSIFSPFLWATTSPSFDCDKASSQIEERICTDDALAVLDMKMEKVYEQALQNIPD 66

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            +R + +  Q  W   R  EC                   C++     R   L+
Sbjct: 67  SERSIMKSMQRGWIKGRN-ECWKGQDE-----------RACVEYAYKNRIIDLQ 108


>gi|319957069|ref|YP_004168332.1| hypothetical protein Nitsa_1332 [Nitratifractor salsuginis DSM
           16511]
 gi|319419473|gb|ADV46583.1| hypothetical protein Nitsa_1332 [Nitratifractor salsuginis DSM
           16511]
          Length = 157

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 51/139 (36%), Gaps = 15/139 (10%)

Query: 1   MCR-----KIIFALTIIAIAFQSMALN--C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M R     K   A ++I  +    +    C      Q  MN+C   S+     +L   YK
Sbjct: 1   MNRLNIKVKTALAASLILASSLQASKPKSCMERASTQGAMNRCALESYRKADAELNRVYK 60

Query: 53  --KVLEKVEKHQRELFEKSQMAWEIYRGSECAF----AASGAEEGTAQSMIYANCLQGHA 106
             K L K +K   E  +++Q  W   R ++              G+   M  A   +   
Sbjct: 61  RIKALYKDDKLFLEKLKRAQQTWIKLRDADLLLKFPHKGQPGYYGSDFPMCEAMFKRELT 120

Query: 107 IERNEKLESYL-TCPEGDL 124
           +ER   L+ +L    EGDL
Sbjct: 121 LERIRFLKQWLWGAEEGDL 139


>gi|222111005|ref|YP_002553269.1| hypothetical protein Dtpsy_1812 [Acidovorax ebreus TPSY]
 gi|221730449|gb|ACM33269.1| protein of unknown function DUF1311 [Acidovorax ebreus TPSY]
          Length = 142

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 37/100 (37%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C 
Sbjct: 35  CRPGGTVDETNACAVQRYQEADTATQILYGDVMRALSAHERPTLRQDQAAWQRTRAAQCK 94

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            A   AE       +Y +CL  H   R + L  +L   E 
Sbjct: 95  QAQRAAESRPEWPRLYHDCLTVHTQARRDALMHWLHHGEA 134


>gi|262372847|ref|ZP_06066126.1| predicted protein [Acinetobacter junii SH205]
 gi|262312872|gb|EEY93957.1| predicted protein [Acinetobacter junii SH205]
          Length = 115

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 50/117 (42%), Gaps = 3/117 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +K +  LT+   +    A  C ++    +  +C       ++ +L   YKKV ++   
Sbjct: 1   MMKKSLLILTLAMSSEIYAAQICAKSANSFEATECLDKEVKRLRTELNTIYKKVYKQT-- 58

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLESY 116
             R+  + +Q +W  Y+  +C    S     +  +MI+  +C      +R E L+S 
Sbjct: 59  EARKELDTAQKSWSNYKDQQCGDFVSVDSGYSPSTMIFNLDCQVTLLKQRIEFLKSL 115


>gi|260549157|ref|ZP_05823378.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260407885|gb|EEX01357.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 123

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 46/120 (38%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+ AL          A NC+ T    D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKILLALLCSFGVTAVYADNCDTTRNTYDDIYCTNKIYASADADLNKNYQALRAKLNTA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           QR   +KSQ+AW   R +EC          + ++ +   C      ERN  L E    C 
Sbjct: 61  QRNTLKKSQLAWIRQRDAECTD--------SNRNSVDVQCRLQTTQERNHWLQERLRECQ 112


>gi|260556216|ref|ZP_05828435.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|260410271|gb|EEX03570.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
          Length = 122

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 46/120 (38%), Gaps = 10/120 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVFAFLCFGITA-VYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTV 59

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           QR   ++SQ+AW   R +EC          + ++ +   C      ERN  L E    C 
Sbjct: 60  QRNTLKRSQLAWIRQRDAECTD--------SNRNSVDVQCRLQTTQERNHWLQERLRECQ 111


>gi|239503713|ref|ZP_04663023.1| hypothetical protein AbauAB_15497 [Acinetobacter baumannii AB900]
          Length = 117

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 44/118 (37%), Gaps = 6/118 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K++  L ++          C    + +D+ +C        K K+   Y K+   ++  
Sbjct: 1   MKKLMLTLLVLFCGVAHA--ECKTGNVYSDI-ECFEKQLKTDKAKMNKIYNKLASNLDSE 57

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE---GTAQSMIYANCLQGHAIERNEKLESY 116
            +   E SQ AW  YR  +C+           G    +I  +C      ER  +L+S 
Sbjct: 58  GKASLENSQKAWLDYRTKQCSGLMGYYGSQAMGAGSHLIILSCEADKTKERLNELKSL 115


>gi|295688602|ref|YP_003592295.1| hypothetical protein Cseg_1176 [Caulobacter segnis ATCC 21756]
 gi|295430505|gb|ADG09677.1| protein of unknown function DUF1311 [Caulobacter segnis ATCC 21756]
          Length = 144

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 39/107 (36%), Gaps = 8/107 (7%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-------KHQRELFEKSQMAWEI 75
           C +     ++N+C   +      +++  Y+  ++++                ++Q AW  
Sbjct: 18  CPDARTTVEVNECLNETLRGFDGEMKRYYEAAVKRLATEQRPPADDALSGLVRAQEAWRA 77

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCPE 121
           Y  +EC        EGT ++     C       R   L   +LT P+
Sbjct: 78  YSDAECGAVYDYWREGTIRTSFELQCSIRQTRLRTFSLWRDWLTYPD 124


>gi|169797328|ref|YP_001715121.1| hypothetical protein ABAYE3355 [Acinetobacter baumannii AYE]
 gi|184156750|ref|YP_001845089.1| hypothetical protein ACICU_00430 [Acinetobacter baumannii ACICU]
 gi|213155858|ref|YP_002317903.1| hypothetical protein AB57_0499 [Acinetobacter baumannii AB0057]
 gi|215484765|ref|YP_002327000.1| hypothetical protein ABBFA_003114 [Acinetobacter baumannii
           AB307-0294]
 gi|239500848|ref|ZP_04660158.1| hypothetical protein AbauAB_00905 [Acinetobacter baumannii AB900]
 gi|301346431|ref|ZP_07227172.1| hypothetical protein AbauAB0_09302 [Acinetobacter baumannii AB056]
 gi|301511757|ref|ZP_07236994.1| hypothetical protein AbauAB05_09265 [Acinetobacter baumannii AB058]
 gi|301594284|ref|ZP_07239292.1| hypothetical protein AbauAB059_00695 [Acinetobacter baumannii
           AB059]
 gi|332852973|ref|ZP_08434483.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
           6013150]
 gi|332866407|ref|ZP_08436991.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
           6013113]
 gi|332873162|ref|ZP_08441119.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
           6014059]
 gi|169150255|emb|CAM88151.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii AYE]
 gi|183208344|gb|ACC55742.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|213055018|gb|ACJ39920.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988005|gb|ACJ58304.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|322506642|gb|ADX02096.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516517|gb|ADX90898.1| hypothetical protein ABTW07_0461 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332728909|gb|EGJ60264.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
           6013150]
 gi|332734633|gb|EGJ65739.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
           6013113]
 gi|332738674|gb|EGJ69544.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
           6014059]
          Length = 122

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 46/120 (38%), Gaps = 10/120 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVFAFLCFGI-TTVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTA 59

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           QR   +KSQ+AW   R +EC          + ++ +   C      ERN  L E    C 
Sbjct: 60  QRNTLKKSQLAWIRQRDAECTD--------SNRNSVDVQCRLQTTQERNHWLQERLRECQ 111


>gi|218529151|ref|YP_002419967.1| hypothetical protein Mchl_1151 [Methylobacterium chloromethanicum
           CM4]
 gi|218521454|gb|ACK82039.1| protein of unknown function DUF1311 [Methylobacterium
           chloromethanicum CM4]
          Length = 170

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 29/106 (27%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
                    +      M  C      +    L   Y++ +   ++  +   +  Q  W  
Sbjct: 63  VSGPCQETPDGSSTVGMMACFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLK 122

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +R   CA+       GT    +   C+      R   L +     E
Sbjct: 123 FRAQACAWPGRVYPGGTIGGPLSGECIMDQTALRALDLMTIRDSLE 168


>gi|156936788|ref|YP_001436139.1| hypothetical protein VIBHAR_p08272 [Vibrio harveyi ATCC BAA-1116]
 gi|156530035|gb|ABU75119.1| hypothetical protein VIBHAR_p08272 [Vibrio harveyi ATCC BAA-1116]
          Length = 129

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 50/129 (38%), Gaps = 16/129 (12%)

Query: 1   MCRK----------IIFALTIIAIAFQSMALN-C---NETLMQADMNQCTGNSFALVKEK 46
           M +K          I+     IA A  S   + C   +     A + +C     +   + 
Sbjct: 1   MMKKWFYYPMVAAFILLTSFNIAFADYSKEFDQCIDTSGAYSPA-VVKCMNEELSKRDKL 59

Query: 47  LEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           L   YK+ + +++  ++E   K+Q  W  YR ++C       E G+       +CL    
Sbjct: 60  LNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCDMFYHS-ESGSGGLEDLHDCLITET 118

Query: 107 IERNEKLES 115
           I+R ++L  
Sbjct: 119 IQRTKELNE 127


>gi|300312670|ref|YP_003776762.1| hypothetical protein Hsero_3373 [Herbaspirillum seropedicae SmR1]
 gi|125992536|emb|CAM35232.1| probable conserved hypothetical protein [Herbaspirillum
           seropedicae]
 gi|300075455|gb|ADJ64854.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 139

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 50/137 (36%), Gaps = 16/137 (11%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNET------------LMQADMNQCTGNSFALVKEKLE 48
           M +  I    + ++   S A                       M + T  +  +  ++L 
Sbjct: 5   MKKFSIL--LLFSVCATSFAQEKAHPIDIWLQRAIEKDSSTVGMREATNQARQMWDKELN 62

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHA 106
            +Y  ++ ++   Q+E+   SQ AW  +R ++    +    A++GT   +   +      
Sbjct: 63  KSYLHLMSRLPAAQQEVLRASQRAWIKFRDADGEVISRIVAAQQGTIFQLTATSYWMELT 122

Query: 107 IERNEKLESYLTCPEGD 123
             R  +L+ Y    EG+
Sbjct: 123 KARALQLDGYDRSFEGE 139


>gi|16764591|ref|NP_460206.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|62179757|ref|YP_216174.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167991974|ref|ZP_02573073.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264251|ref|ZP_02686224.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197263188|ref|ZP_03163262.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|224584256|ref|YP_002638054.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|16419755|gb|AAL20165.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62127390|gb|AAX65093.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197241443|gb|EDY24063.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205329769|gb|EDZ16533.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347215|gb|EDZ33846.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|224468783|gb|ACN46613.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261246448|emb|CBG24258.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993015|gb|ACY87900.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157777|emb|CBW17270.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912224|dbj|BAJ36198.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223854|gb|EFX48917.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322714227|gb|EFZ05798.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323129506|gb|ADX16936.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332988127|gb|AEF07110.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 109

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/113 (14%), Positives = 36/113 (31%), Gaps = 15/113 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             R   + +Q +W   R  +C                   CL     ER ++L
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQL 98


>gi|115360821|ref|YP_777958.1| hypothetical protein Bamb_6080 [Burkholderia ambifaria AMMD]
 gi|115286149|gb|ABI91624.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 341

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/111 (17%), Positives = 35/111 (31%), Gaps = 17/111 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I+  LTI  +A  +   +C +     +   C   + + +  +L   +KK L   +     
Sbjct: 16  ILAVLTIAPMAAHAAGFDCAKAASPTEKAICADPALSSLDGQLAGAWKKAL--AKGGDTA 73

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + +Q+ W   R   C                   C+     ER   L  
Sbjct: 74  ALKAAQLQWLKQRDR-CGA--------------GVLCVGDRYRERLASLNG 109


>gi|51244878|ref|YP_064762.1| hypothetical protein DP1026 [Desulfotalea psychrophila LSv54]
 gi|50875915|emb|CAG35755.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 137

 Score = 74.8 bits (182), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/135 (14%), Positives = 47/135 (34%), Gaps = 16/135 (11%)

Query: 1   MCRKIIFALTIIAIAFQSMALNC---------------NETLMQADMNQCTGNSFALVKE 45
           M ++I+  + ++  A  + A                  +       M      +   +  
Sbjct: 1   MKKRILLCIFLL-FALPAQAEELITVPPAEKQDWQNFIDGAEDNYSMQARAAEAMHSLDS 59

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           +++    K+   +++    L + +Q AWE    ++C F A     G+ + + Y +C+   
Sbjct: 60  RIDEVVIKINRDLDQQAITLLKSNQTAWEKQICTKCIFLADSYRGGSHKGLAYGDCVIQE 119

Query: 106 AIERNEKLESYLTCP 120
              R  +L+      
Sbjct: 120 QKVRIAELKQMHEYR 134


>gi|254559990|ref|YP_003067085.1| hypothetical protein METDI1503 [Methylobacterium extorquens DM4]
 gi|254267268|emb|CAX23100.1| hypothetical protein METDI1503 [Methylobacterium extorquens DM4]
          Length = 164

 Score = 74.8 bits (182), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 30/106 (28%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
                    +      M  C      +    L   Y++ +   ++  +   +  Q  W  
Sbjct: 57  VSGPCQETPDGSSTVGMMACFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLK 116

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +R   CA+       GT    + A C+      R   L +     E
Sbjct: 117 FRAQACAWPGRVYPGGTIGGPLSAECIMDQTALRALDLMTIRDSLE 162


>gi|204930727|ref|ZP_03221600.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320186|gb|EDZ05390.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|322616612|gb|EFY13521.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619873|gb|EFY16747.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622441|gb|EFY19286.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629441|gb|EFY26218.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632937|gb|EFY29680.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636818|gb|EFY33521.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641382|gb|EFY38021.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645147|gb|EFY41676.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652310|gb|EFY48666.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655662|gb|EFY51964.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660967|gb|EFY57197.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665447|gb|EFY61635.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667576|gb|EFY63737.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673630|gb|EFY69732.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677556|gb|EFY73620.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679779|gb|EFY75818.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687252|gb|EFY83224.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323193056|gb|EFZ78278.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199447|gb|EFZ84540.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203635|gb|EFZ88657.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208824|gb|EFZ93762.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323214162|gb|EFZ98922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217798|gb|EGA02513.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323218891|gb|EGA03402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226639|gb|EGA10839.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229601|gb|EGA13724.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232826|gb|EGA16922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240138|gb|EGA24182.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242875|gb|EGA26896.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246791|gb|EGA30761.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254309|gb|EGA38126.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255575|gb|EGA39334.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259409|gb|EGA43045.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267005|gb|EGA50490.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272109|gb|EGA55523.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 109

 Score = 74.8 bits (182), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R + + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGVLQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|240137518|ref|YP_002961989.1| hypothetical protein MexAM1_META1p0789 [Methylobacterium extorquens
           AM1]
 gi|240007486|gb|ACS38712.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 164

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 29/106 (27%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
                    +      M  C      +    L   Y++ +   ++  +   +  Q  W  
Sbjct: 57  VSGPCQETPDGSSTVGMMTCFDREHTVWDTLLNRAYREAMAGFDEAGKTDLKGVQQTWLK 116

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +R   C +       GT    + A C+      R   L +     E
Sbjct: 117 FRAQACEWPGRVYPGGTIGGPLSAECIMDQTALRALDLMTIRDSLE 162


>gi|302386455|ref|YP_003822277.1| hypothetical protein Closa_2075 [Clostridium saccharolyticum WM1]
 gi|302197083|gb|ADL04654.1| hypothetical protein Closa_2075 [Clostridium saccharolyticum WM1]
          Length = 287

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 30/93 (32%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M         L   +  A Y  + +++    R+  E SQ  W   R ++   AA 
Sbjct: 187 SNTYSMKALVEKELKLWDREQNAIYAAITQELNDEDRKALETSQQEWIKSRDTKAEDAAK 246

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
               G+ + + Y   L      R   L   Y+ 
Sbjct: 247 KYSGGSLEELEYTASLTESTRARAYDLVAEYMN 279


>gi|16760111|ref|NP_455728.1| secreted protein [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142118|ref|NP_805460.1| hypothetical protein t1684 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413778|ref|YP_150853.1| hypothetical protein SPA1614 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|168239143|ref|ZP_02664201.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244310|ref|ZP_02669242.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168467198|ref|ZP_02701040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822343|ref|ZP_02834343.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443121|ref|YP_002040492.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448181|ref|YP_002045238.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194737222|ref|YP_002114243.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250138|ref|YP_002146805.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197362701|ref|YP_002142338.1| hypothetical protein SSPA1499 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198244395|ref|YP_002215899.1| hypothetical protein SeD_A2130 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389311|ref|ZP_03215922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|213052786|ref|ZP_03345664.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213423672|ref|ZP_03356652.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213428088|ref|ZP_03360838.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213580466|ref|ZP_03362292.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612637|ref|ZP_03370463.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648219|ref|ZP_03378272.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213850126|ref|ZP_03381024.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238910945|ref|ZP_04654782.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289828346|ref|ZP_06546259.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25512455|pir||AE0647 probable secreted protein STY1276 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502405|emb|CAD08360.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137747|gb|AAO69309.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128035|gb|AAV77541.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194401784|gb|ACF62006.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406485|gb|ACF66704.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712724|gb|ACF91945.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630448|gb|EDX49074.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197094178|emb|CAR59682.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213841|gb|ACH51238.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197288099|gb|EDY27486.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938911|gb|ACH76244.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199601756|gb|EDZ00302.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205336800|gb|EDZ23564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205341223|gb|EDZ27987.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086323|emb|CBY96096.1| putative lipoprotein lprI Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326623647|gb|EGE29992.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 109

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 38/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|330448459|ref|ZP_08312107.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492650|dbj|GAA06604.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 128

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 47/128 (36%), Gaps = 15/128 (11%)

Query: 1   MCR----KIIFALTIIAIAFQSMAL---------NCNETLMQADMNQCTGNSFALVKEKL 47
           M +     ++ A  +      + A          +       A + +C     +   + L
Sbjct: 1   MKKLFYYPMVVAFILPTFFNSAFADYSKEFDQCIDTLGAYTPA-VVKCMNEELSKRDKLL 59

Query: 48  EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
              YK+ + +++  ++E   K+Q  W  YR ++C       E G+       +C+    I
Sbjct: 60  NTAYKQYMTRIQDFRKEDLRKTQRLWIQYRDAKCGMFYHS-ESGSGGLEDLNDCMIKETI 118

Query: 108 ERNEKLES 115
           +R ++L  
Sbjct: 119 QRTKELNE 126


>gi|254254380|ref|ZP_04947697.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
 gi|124899025|gb|EAY70868.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
          Length = 129

 Score = 74.4 bits (181), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 44/118 (37%), Gaps = 9/118 (7%)

Query: 1   MCRKIIF---ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K +    AL  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ ++
Sbjct: 1   MKKKSLLVCCALAALAVPFAAHAAGCAKPRSAFDQVYCSSNEFSQLDRELNDQYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   +  Q+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKSGQLAWMKQRDDRCSEKRDD------GYLVNLQCAIDATQSRLSFLRE 112


>gi|161503670|ref|YP_001570782.1| hypothetical protein SARI_01754 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865017|gb|ABX21640.1| hypothetical protein SARI_01754 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 109

 Score = 74.4 bits (181), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 39/118 (33%), Gaps = 15/118 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  +   + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLITFALLTPLLVNAASFDCQKAKAADEKTICAHLALNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             R   + +Q +W   R  +C   A+              CL     ER ++L++   
Sbjct: 61  GNRGALQDAQQSWLKQR-QQCKTDAA--------------CLTKAYNERLKQLDALYD 103


>gi|330828395|ref|YP_004391347.1| hypothetical protein B565_0695 [Aeromonas veronii B565]
 gi|328803531|gb|AEB48730.1| hypothetical protein B565_0695 [Aeromonas veronii B565]
          Length = 198

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 43/133 (32%), Gaps = 18/133 (13%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++  L    +   +   + +C +     +   C     A +  +L A Y K +  +
Sbjct: 1   MNKTLLATLLFAPLLASAATPSFDCTKASGSVETLICKDAGLAALDNELAALYPKAIAAL 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              Q +     Q  W   R  +C                   C++ + + R  +L+    
Sbjct: 61  SPEQLKTERAMQRGWIKGRN-DCWK-----------GQDLRQCVEDNYLLRITELQ---- 104

Query: 119 CPEGDLLCPFINN 131
              G L+ P   N
Sbjct: 105 ISGGQLMVPAPVN 117


>gi|156974299|ref|YP_001445206.1| hypothetical protein VIBHAR_02014 [Vibrio harveyi ATCC BAA-1116]
 gi|156525893|gb|ABU70979.1| hypothetical protein VIBHAR_02014 [Vibrio harveyi ATCC BAA-1116]
          Length = 129

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 50/129 (38%), Gaps = 16/129 (12%)

Query: 1   MCRK----------IIFALTIIAIAFQSMALN-CNE---TLMQADMNQCTGNSFALVKEK 46
           M +K          I+     IA A  S   + C +       A + +C     +   + 
Sbjct: 1   MMKKWFYYPMVAAFILLTSFNIAFADYSKEFDQCIDTLGAYSPA-VVKCMNEELSKRDKL 59

Query: 47  LEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           L   YK+ + +++  ++E   K+Q  W  YR ++C       E G+       +CL    
Sbjct: 60  LNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCDMFYHS-ESGSGGLEDLHDCLITET 118

Query: 107 IERNEKLES 115
           I+R ++L  
Sbjct: 119 IQRTKELNE 127


>gi|300725331|ref|YP_003714668.1| hypothetical protein XNC1_4586 [Xenorhabdus nematophila ATCC 19061]
 gi|297631885|emb|CBJ92608.1| putative periplasmic protein [Xenorhabdus nematophila ATCC 19061]
          Length = 108

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 37/120 (30%), Gaps = 15/120 (12%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            + +   L +++    + + NC +  +  +   C+      +  ++   Y  +       
Sbjct: 1   MKYLWLMLFLLSPFSFAASFNCAKAQLPDEKAICSSPKLNDLDVEMSVKYHFLRGLFAMG 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  +Q AW   R   C    +              CL     +R ++L++     E
Sbjct: 61  VSGEMYDNQTAWLKQRKK-CKGDTA--------------CLLQSYHQRIKQLDTLYDSIE 105


>gi|134294050|ref|YP_001117786.1| hypothetical protein Bcep1808_5374 [Burkholderia vietnamiensis G4]
 gi|134137207|gb|ABO58321.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis G4]
          Length = 129

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 44/118 (37%), Gaps = 9/118 (7%)

Query: 1   MCRKIIFA---LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K + A   L  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ ++
Sbjct: 1   MKKKNLLASCALFALAVPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDEYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   +  Q+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKSGQLAWMKQRDDRCSETRDD------GYLVNLQCAIDATQSRLTFLRE 112


>gi|254454818|ref|ZP_05068255.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 238]
 gi|198269224|gb|EDY93494.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 238]
          Length = 174

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 36/103 (34%), Gaps = 13/103 (12%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-------------HQRELFEKSQM 71
           +      M  CT   +      L   Y  +++ ++              ++ +    +Q 
Sbjct: 64  DGQTTVGMMFCTLAEYEAWDRLLNRDYGPIMDGLQAMDDQDVEFFPEFANRADSLRDAQR 123

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           AW   R ++CA   +    G+ + +  A+CL     +R   L 
Sbjct: 124 AWIPLRDTQCALEYAMWGAGSMRQIAGASCLLDLTAKRVIYLR 166


>gi|163850457|ref|YP_001638500.1| hypothetical protein Mext_1024 [Methylobacterium extorquens PA1]
 gi|163662062|gb|ABY29429.1| protein of unknown function DUF1311 [Methylobacterium extorquens
           PA1]
          Length = 164

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 30/106 (28%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
                    +      M  C      +    L   Y++ +   ++  +   +  Q  W  
Sbjct: 57  VSGPCQETPDGSSTVGMMTCFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLK 116

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +R   CA+       GT    + A C+      R   L +     E
Sbjct: 117 FRAQACAWPGRVYPGGTIGGPLSAECIMDQTALRALDLMTIRDSLE 162


>gi|77459785|ref|YP_349292.1| hypothetical protein Pfl01_3563 [Pseudomonas fluorescens Pf0-1]
 gi|77383788|gb|ABA75301.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 339

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 40/110 (36%), Gaps = 17/110 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +     + A A  + + +C       +   C     + + EKL A ++  L +V   Q  
Sbjct: 10  LQLTCLVFATASHAASFDCAGASSPVEKAVCADPYTSSLDEKLGALWQTTLAQVADPQ-- 67

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             +  Q +W   R  +CA  +              +CL+   + R + LE
Sbjct: 68  ALKADQRSWLKQRN-QCAANS--------------SCLRREYLMRLKALE 102


>gi|330821653|ref|YP_004350515.1| hypothetical protein bgla_2g25750 [Burkholderia gladioli BSR3]
 gi|327373648|gb|AEA65003.1| hypothetical protein bgla_2g25750 [Burkholderia gladioli BSR3]
          Length = 347

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 37/112 (33%), Gaps = 22/112 (19%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + +I  L I++ A Q+   +C +     +   C     +   E L+A Y +V        
Sbjct: 13  KLLIATLAILSSAAQAAGFDCAKASSPTEQRICADAQLSKQDETLQALYAQV------PA 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              +   Q AW   R + C   A               CL+    +R   L 
Sbjct: 67  SPDWRADQRAWLARRDA-CGDDA---------------CLRNLYADRIVVLR 102


>gi|224438643|ref|ZP_03659540.1| hypothetical protein HcinC1_11525 [Helicobacter cinaedi CCUG 18818]
          Length = 371

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 47/127 (37%), Gaps = 27/127 (21%)

Query: 1   MCRKIIF--ALTIIAIAFQS-------MALNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I      +++I+  +        + +C +   + +   C  +      +  ++  
Sbjct: 1   MQKILIVLGVFLMLSISVNAQSPQEAKPSFDCAKATTKVEKMICEDSSGELQNLDRQISQ 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +Y+    K++K+ ++    SQ +W   R   C                   CL+     R
Sbjct: 61  SYQDTKAKLDKNAKKALLDSQKSWLKTRER-CE---------------SKECLKESLQSR 104

Query: 110 NEKLESY 116
            ++L+SY
Sbjct: 105 IKELQSY 111


>gi|117621024|ref|YP_856384.1| hypothetical protein AHA_1850 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562431|gb|ABK39379.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 134

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 48/128 (37%), Gaps = 11/128 (8%)

Query: 2   CRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
            +++ FAL  I+++  S    NC+ +    ++  C  +       +L  TY  +   +  
Sbjct: 1   MKRLSFALFFISLSVFSNTDRNCDISAPSTNLAACYESKSKQADAELNKTYNNLKSTLLS 60

Query: 59  -------EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI-YANCLQGHAIERN 110
                  ++       +SQ  W   R ++C    +  E+ +   +I    CL     ER 
Sbjct: 61  SGYDKQSKEKYWSQLVQSQRYWIKLRDAQCYARGAFFEDSSIAQLIEIKKCLMNITKERV 120

Query: 111 EKLESYLT 118
             L + + 
Sbjct: 121 FFLNNEIQ 128


>gi|300715066|ref|YP_003739869.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
 gi|299060902|emb|CAX58009.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 133

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 42/132 (31%), Gaps = 9/132 (6%)

Query: 1   MCRKIIFALTIIAIAFQS-------MALNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M + I     ++A    +           C ++      M QC   +      ++   Y 
Sbjct: 1   MKKTIAITGLLMAFYGHADVSPIDTAQQQCLDKASTTVAMQQCFSAANQAWDSEMNQQYG 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAF-AASGAEEGTAQSMIYANCLQGHAIERNE 111
           K+   +   Q+     +Q AW  YR S      A  ++ GT  S+            +  
Sbjct: 61  KLTATLNSEQKAKLRTAQRAWLKYRDSWLDATKARLSDGGTMASLQVGAQSVSLVKNQAL 120

Query: 112 KLESYLTCPEGD 123
            L+S      G+
Sbjct: 121 ALKSLADGNSGN 132


>gi|168233118|ref|ZP_02658176.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468898|ref|ZP_03074882.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455262|gb|EDX44101.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205332629|gb|EDZ19393.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 109

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++ ++ + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVKAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|289810629|ref|ZP_06541258.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 57

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 28/53 (52%)

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 2   RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 54


>gi|50083715|ref|YP_045225.1| hypothetical protein ACIAD0471 [Acinetobacter sp. ADP1]
 gi|49529691|emb|CAG67403.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 125

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 55/124 (44%), Gaps = 14/124 (11%)

Query: 1   MCR---KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +   K++ A+  + ++  S A NC++T    D   CT   FA   E L   Y+K+  +
Sbjct: 1   MMKLSIKLLSAVIFLVVSGTSYADNCDKTRNTYDDIYCTNKIFASADEDLNRNYQKLRTQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESY 116
           + ++Q+++ +KSQ+AW   R  +C               +   C      +RN+ L E  
Sbjct: 61  LNQNQKQILKKSQLAWIRERDEQCVEDQK----------VDVECRLEKTQQRNQWLVERL 110

Query: 117 LTCP 120
             C 
Sbjct: 111 RECK 114


>gi|167590292|ref|ZP_02382680.1| hypothetical protein BuboB_33462 [Burkholderia ubonensis Bu]
          Length = 129

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 43/118 (36%), Gaps = 9/118 (7%)

Query: 1   MCRKIIFA---LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + ++ A   L  +A+ F + A  C +     D   C+   F+ +  +L   Y ++ ++
Sbjct: 1   MKKHLLAASCALFALAVPFAAHAAGCAKPRGAFDQVYCSSTQFSQLDRELNDQYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   +  Q+AW   R  +C+              +   C       R   L  
Sbjct: 61  LSGDQQASLKTGQLAWLKQRDDKCSTTRDDGYY------VNLECAIDMTQSRLSFLRE 112


>gi|90577512|ref|ZP_01233323.1| hypothetical protein VAS14_10714 [Vibrio angustum S14]
 gi|90440598|gb|EAS65778.1| hypothetical protein VAS14_10714 [Vibrio angustum S14]
          Length = 128

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 51/127 (40%), Gaps = 13/127 (10%)

Query: 1   MCRKI---IFALTII------AIAFQSMALN-CNE--TLMQADMNQCTGNSFALVKEKLE 48
           M ++    + A  I+      A A  S   + C +        + +C     +   + L 
Sbjct: 1   MKKRFYYPMVAAFILQTFFNTAFADYSKEFDQCIDTWGASTPSVVKCMNEELSKRDKLLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             YK+ + +++  ++E   K+Q  W  YR ++C       E G+      ++C+    I+
Sbjct: 61  TAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCGMFYHS-ESGSGGLEDLSDCMITETIQ 119

Query: 109 RNEKLES 115
           R ++L  
Sbjct: 120 RTKELNE 126


>gi|295690840|ref|YP_003594533.1| hypothetical protein Cseg_3485 [Caulobacter segnis ATCC 21756]
 gi|295432743|gb|ADG11915.1| protein of unknown function DUF1311 [Caulobacter segnis ATCC 21756]
          Length = 133

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 46/123 (37%), Gaps = 12/123 (9%)

Query: 5   IIFALTIIAIAFQSMALNCNET----------LMQADMNQCTGNSFALVKEKLEATYKKV 54
           +  ++    +  Q+     +                 M QC      +   +L   Y+  
Sbjct: 8   LCLSILAAPVVGQAAEPKYSPAYDRCLASPEGQSTIGMIQCAAAELKVQDARLNRAYQDA 67

Query: 55  LEKVE-KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +++++   QR   +K+Q AW  YR ++CA      + GT   +    CL  H   R + L
Sbjct: 68  MKRLDQPRQRAALKKAQRAWIAYRDADCASVYD-PDWGTLARIEANACLLDHTARRADAL 126

Query: 114 ESY 116
           E Y
Sbjct: 127 EMY 129


>gi|161614529|ref|YP_001588494.1| hypothetical protein SPAB_02278 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363893|gb|ABX67661.1| hypothetical protein SPAB_02278 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 109

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 40/115 (34%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++ ++ + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVKAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R+  + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRDALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|114707530|ref|ZP_01440426.1| hypothetical protein FP2506_11692 [Fulvimarina pelagi HTCC2506]
 gi|114537089|gb|EAU40217.1| hypothetical protein FP2506_11692 [Fulvimarina pelagi HTCC2506]
          Length = 169

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 38/114 (33%), Gaps = 13/114 (11%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-------------EKH 61
           A+    ++ +E      M  C           L   Y+  + +              +  
Sbjct: 53  AYADACMDTSEGQTTLGMTNCVRAESDAWDAILNENYQASMTEAKAVDADRSVSSSTDSE 112

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  +Q AW  +R +ECA      ++G+ +  + A C+     ER  +L S
Sbjct: 113 AAASLRAAQRAWITFRDAECARIFELYKDGSIRLPLTAGCVNRLTAERALELRS 166


>gi|167589256|ref|ZP_02381644.1| hypothetical protein BuboB_28226 [Burkholderia ubonensis Bu]
          Length = 124

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 42/119 (35%), Gaps = 13/119 (10%)

Query: 13  AIAFQSMALNCNETLMQADMN------QCTGNSFALVKEKLEATYKKVLEKVEKHQ---- 62
             +    A +CN     A         QC          KL   YKK+L  ++       
Sbjct: 1   MFSENIFAADCNHPPGDAGYEGAKINYQCAERDRRAADSKLNQAYKKLLGALKDDPDSGL 60

Query: 63  --RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI-YANCLQGHAIERNEKLESYLT 118
             R     +Q  W  +R +EC F  S +       ++ +A CL     +R + LE YL 
Sbjct: 61  IPRTQIVSAQRTWVAFRDAECDFRTSVSGGAHQWLIVNHAQCLAELTEQRTKVLEDYLK 119


>gi|157962642|ref|YP_001502676.1| hypothetical protein Spea_2822 [Shewanella pealeana ATCC 700345]
 gi|157847642|gb|ABV88141.1| protein of unknown function DUF1176 [Shewanella pealeana ATCC
           700345]
          Length = 485

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 38/113 (33%), Gaps = 6/113 (5%)

Query: 8   ALTIIAIAFQSMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
             T+I     +  ++C   +      M +C     A V+ KL    K +           
Sbjct: 362 VSTVILGDDPAAGIDCQSEQAYNTEGMTKCGQLELANVEWKLTEVIKSISALEHVANNSE 421

Query: 66  FE----KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 ++Q +W  YR   C       E+G+    +   C      +R ++L+
Sbjct: 422 LSTAYGQAQSSWLSYRNDACRAEMLTYEQGSMAIPVLIGCKLDLTEKRLKELQ 474


>gi|188580223|ref|YP_001923668.1| hypothetical protein Mpop_0956 [Methylobacterium populi BJ001]
 gi|179343721|gb|ACB79133.1| protein of unknown function DUF1311 [Methylobacterium populi BJ001]
          Length = 164

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 26/106 (24%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
                 +  +      M  C           L   Y++ +   ++  +   +  Q  W  
Sbjct: 57  VSGPCQDTPDGSSTMGMMACFDRENTAWDALLNRAYREAMSAFDEGGKAYLKGVQHTWLK 116

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +R   C +       GT    +   C       R   L       E
Sbjct: 117 FRAQACDWPGRVYPGGTIGGPLSGECSMEQTALRALDLMEIRDALE 162


>gi|157149610|ref|YP_001456660.1| hypothetical protein CCC13826_0626 [Campylobacter concisus 13826]
 gi|112800193|gb|EAT97537.1| hypothetical protein CCC13826_0626 [Campylobacter concisus 13826]
          Length = 405

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 45/126 (35%), Gaps = 26/126 (20%)

Query: 4   KIIFALTIIAIAF------QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           K+IF  T++  +          + +C++   + +   C+    + V   ++  Y  ++ K
Sbjct: 5   KLIFISTLLITSNLYSNDRIQPSFDCSKAKTRVEKLVCSDEDLSRVDRDMQKAYDLMMGK 64

Query: 58  VE------------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +            K   E  ++SQ+ W  YR   C       E        + +C+   
Sbjct: 65  YDLAYMNEEAKEEIKPYLEKLKQSQIDWVKYRDKRCNAEKDEKE--------FRSCVFSR 116

Query: 106 AIERNE 111
            I R +
Sbjct: 117 YINRIQ 122


>gi|77460483|ref|YP_349990.1| hypothetical protein Pfl01_4262 [Pseudomonas fluorescens Pf0-1]
 gi|77384486|gb|ABA75999.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 479

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 37/118 (31%), Gaps = 19/118 (16%)

Query: 3   RKIIFALTIIAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R I+    ++       + ++C +     +   C       +  ++ A Y+K+++     
Sbjct: 25  RYIVSVCALLFFQQAVASGMDCTKAASAVEKAICADKPLYELDAQMGAAYRKLMKAAPAQ 84

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
                + +Q  W   R   C                  +CL     +R + L   ++ 
Sbjct: 85  A--EVKNAQRQWLKERDR-CGEE--------------VSCLNQRYQDRLQVLHAQWID 125


>gi|197294950|ref|YP_002153491.1| hypothetical protein BCAS0098 [Burkholderia cenocepacia J2315]
 gi|195944429|emb|CAR57031.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 348

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 34/99 (34%), Gaps = 17/99 (17%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +   +C +     +   C   + + +  +L   +K+ L   +       +++Q+ W   
Sbjct: 34  HAAGFDCAKAASPTEKTICANPALSKLDGELSTAWKRAL--AQGGDTAALKQAQLKWLKQ 91

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R  +C         G       A+CL+    ER   L  
Sbjct: 92  RD-QC--------GG------DASCLRDRYRERLASLNG 115


>gi|153870861|ref|ZP_02000170.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152072677|gb|EDN69834.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 143

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 34/97 (35%), Gaps = 2/97 (2%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            +      M +C   +  L   +L   YK +  K+    +   + +Q  W  YR +E A 
Sbjct: 42  EKNQTTMGMIKCEDQAINLWDAELNRVYKALRSKLNTKAKAQLQTAQRQWMKYRDAEFAT 101

Query: 84  AASGAE--EGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +     +GT   ++          +R   L  YL 
Sbjct: 102 IDAIYSSMDGTIWRVVATGARTEIVKQRVLLLTGYLE 138


>gi|160899129|ref|YP_001564711.1| hypothetical protein Daci_3694 [Delftia acidovorans SPH-1]
 gi|160364713|gb|ABX36326.1| protein of unknown function DUF1311 [Delftia acidovorans SPH-1]
          Length = 133

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 37/97 (38%), Gaps = 1/97 (1%)

Query: 23  CNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           C+     A   N C   +F      L   Y  V++++ + +R      Q  W   R + C
Sbjct: 36  CDPASTAAASRNACAVQAFQEADTALNIRYLDVMQQLPQGKRTGLRHDQNGWIKGRTARC 95

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             A   +E       +Y +CL     ER + LE +L 
Sbjct: 96  KAATRDSETQPEGPRLYHDCLTAATQERMQALERWLQ 132


>gi|126736862|ref|ZP_01752597.1| hypothetical protein RSK20926_10544 [Roseobacter sp. SK209-2-6]
 gi|126721447|gb|EBA18150.1| hypothetical protein RSK20926_10544 [Roseobacter sp. SK209-2-6]
          Length = 99

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 33/97 (34%), Gaps = 10/97 (10%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEK----------HQRELFEKSQMAWEIYRGSEC 81
           M  C    +     +L A YK+    ++              E   ++Q AW  +R   C
Sbjct: 1   MRLCASQDYEAADAELNAVYKEARAVMKALDQDLPENLKGAGEALLQAQRAWIPFRDKAC 60

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                    G+ + +   +C      +R+E+L   L 
Sbjct: 61  ESEGFLFRGGSFEPLTVLHCKTELTRQRSEQLRFLLE 97


>gi|89070765|ref|ZP_01158023.1| hypothetical protein OG2516_14356 [Oceanicola granulosus HTCC2516]
 gi|89043664|gb|EAR49870.1| hypothetical protein OG2516_14356 [Oceanicola granulosus HTCC2516]
          Length = 119

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 41/100 (41%), Gaps = 2/100 (2%)

Query: 20  ALNCNET-LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYR 77
           A NC+     Q +MN C    +A     L A + + +         +    +Q AW  +R
Sbjct: 18  AQNCDSAEQTQLEMNNCAAAFYADADADLNAVWPEAMAAARAAGAGDELLAAQRAWLAFR 77

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C   A+    G+   M++A+CL      R + L + L
Sbjct: 78  DAACTAEAAIFAGGSIAPMVHADCLTRLTQTRRDDLYAML 117


>gi|304397311|ref|ZP_07379190.1| protein of unknown function DUF1311 [Pantoea sp. aB]
 gi|304355460|gb|EFM19828.1| protein of unknown function DUF1311 [Pantoea sp. aB]
          Length = 132

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 49/130 (37%), Gaps = 14/130 (10%)

Query: 1   MCR--KIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R  K++     ++++  ++A   C +      + QCT     L ++ L   Y+   ++
Sbjct: 1   MKRISKLVLIGVSLSVSASAIADETCAKQPSDGTLFQCTVQQKTLAEDDLNKAYQTAKKR 60

Query: 58  ----------VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
                     +          +Q  W  YR  +C   A  AEEG+ A ++    C+    
Sbjct: 61  IVQMYGTQKKLADDYVATLVDTQRNWLKYRDGQCRLEAFAAEEGSNASAVATNLCVIRID 120

Query: 107 IERNEKLESY 116
            ER   L+  
Sbjct: 121 KERIALLKQL 130


>gi|149202684|ref|ZP_01879656.1| hypothetical protein RTM1035_08704 [Roseovarius sp. TM1035]
 gi|149143966|gb|EDM32000.1| hypothetical protein RTM1035_08704 [Roseovarius sp. TM1035]
          Length = 158

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 44/153 (28%), Gaps = 39/153 (25%)

Query: 2   CRKIIFALTIIAIAFQS-------------------------MALNCNETL----MQADM 32
            R IIFA  ++ +   +                          A  C            M
Sbjct: 1   MRAIIFAALMLPVPAMAQDLIFDIAPVAACLQSGGGEECAGIAAEACINATPGGYSTVGM 60

Query: 33  NQCTGNSFALVKEKLEATYKKVLEKVE----------KHQRELFEKSQMAWEIYRGSECA 82
             CT    A     L   Y+ +  K +            Q +   + Q AW  +R ++C+
Sbjct: 61  GACTEYERAAWDGWLNEVYQALSTKFKAQDAEAPPYAPKQADALREMQRAWIGFRDAKCS 120

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + AS    GT       +C       +   L+S
Sbjct: 121 YVASQWGGGTGAGPASVSCHLHETARQMLYLQS 153


>gi|77919860|ref|YP_357675.1| hypothetical protein Pcar_2266 [Pelobacter carbinolicus DSM 2380]
 gi|77545943|gb|ABA89505.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 497

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 39/130 (30%), Gaps = 27/130 (20%)

Query: 3   RKIIFALTIIAIAFQS-----MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           R ++  + +      +      + +C +   + +   C     + +  +++  Y   L+ 
Sbjct: 6   RVLLLCIALSFSITCASMAEGPSFDCEKAGTKIEKMICADAELSKLDVRIDEAYAAALQA 65

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            E  +    ++ Q  W   R + C  AA                L      R  +L +  
Sbjct: 66  TEAPE--TLKQQQRLWLKARNA-CDDAAG---------------LSESYTSRLAQLAA-- 105

Query: 118 TCPEGDLLCP 127
                D  C 
Sbjct: 106 --EPADKSCQ 113


>gi|170694696|ref|ZP_02885847.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170140327|gb|EDT08504.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 164

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 20/118 (16%)

Query: 1   MC--RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M   R ++ A  +IA  + Q+ + +C++    A+   C   + + + + L   Y K    
Sbjct: 1   MKIVRPLLIAALLIAHPSAQAASFDCSKGRSLAEKIICNDPALSRLDDTLGRLYWKARRT 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           V   +R     S   W  +R + C  A                CL      R  +LE 
Sbjct: 61  VS-DRRGFIADSDSKW-AWREANCRDAE---------------CLGTWYAARIGELEQ 101


>gi|58040101|ref|YP_192065.1| hypothetical protein GOX1668 [Gluconobacter oxydans 621H]
 gi|58002515|gb|AAW61409.1| Hypothetical protein GOX1668 [Gluconobacter oxydans 621H]
          Length = 131

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 50/116 (43%), Gaps = 6/116 (5%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----F 66
           + +A  ++A          ++  C  +  A  + +L+   +  L +++           F
Sbjct: 1   MLLAQSALAAPVCSGKTTPEIQSCFSSRLAQAEAQLKRYTEAALRRMQGPGITARTQADF 60

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCPE 121
            K + AW  +R +EC   A    +GT ++ +  +C      ER  +L +++LT P+
Sbjct: 61  RKGESAWRAFREAECKAVAGRWSDGTIRTSMELSCRLKLTEERTYELWQNWLTAPD 116


>gi|323526659|ref|YP_004228812.1| hypothetical protein BC1001_2336 [Burkholderia sp. CCGE1001]
 gi|323383661|gb|ADX55752.1| hypothetical protein BC1001_2336 [Burkholderia sp. CCGE1001]
          Length = 195

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 44/120 (36%), Gaps = 20/120 (16%)

Query: 1   MC--RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M   R ++ A  +IA  +  + + +C++    A+   C   + + + + L   Y K   K
Sbjct: 1   MKLVRPVLIAALLIAHSSAHAASFDCSKGRSLAEKIICHDPALSRLDDTLGQLYWKARRK 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           V   +R     S   W  +R + C  AA               CL      R ++L   +
Sbjct: 61  VS-DRRGFITDSDNKW-AWRETHCRDAA---------------CLGTWYATRIDELRQLI 103


>gi|319650736|ref|ZP_08004875.1| hypothetical protein HMPREF1013_01480 [Bacillus sp. 2_A_57_CT2]
 gi|317397593|gb|EFV78292.1| hypothetical protein HMPREF1013_01480 [Bacillus sp. 2_A_57_CT2]
          Length = 218

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 37/103 (35%), Gaps = 1/103 (0%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +  +   +      M +          + L   Y+ + +++ K + E     Q  W  Y
Sbjct: 116 AAAEIRNTDDETTIGMTKSEEEILKKWDQALNEIYQVLEKQLPKSEMEKLRGEQRKWIAY 175

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           R      AA   E GT +S+ Y     G   +R  +L E Y+ 
Sbjct: 176 RDETAKEAAKKYEGGTLESLEYIASQAGTTKDRCYELVEGYMK 218


>gi|291617915|ref|YP_003520657.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
 gi|291152945|gb|ADD77529.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
          Length = 133

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 57/129 (44%), Gaps = 16/129 (12%)

Query: 1   MCRKIIFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + +I  L ++ +       +++ +C++     ++  C   + +  +  L   YK    
Sbjct: 1   MNKILISTLLLVGVQVLNPVYALS-DCSQGNNDQEVYSCAEKNKSETEVMLNKEYKAAKS 59

Query: 57  KVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQGH 105
           +V+               +  ++Q AW  YR ++C  A+  A++G+  S+ Y   C+  H
Sbjct: 60  RVQDIYKGNDEDLNKYINILTEAQRAWLKYRENDCELASFAADKGSDASVSYKNMCISEH 119

Query: 106 AIERNEKLE 114
             +R ++L+
Sbjct: 120 NEQRIKRLK 128


>gi|170698251|ref|ZP_02889328.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|170136832|gb|EDT05083.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
          Length = 341

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 35/111 (31%), Gaps = 17/111 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++  LT+ ++A  +   +C +     +   C     + +  +L   +KK L   +     
Sbjct: 16  MLAVLTMASMAAHAAGFDCTKAASPTEKAICADPGLSSLDGQLATAWKKAL--AKGGDTA 73

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + +Q+ W   R   C                   C+     ER   L  
Sbjct: 74  ALKAAQLQWLKQRDR-CGND--------------VLCVGDRYRERLASLNG 109


>gi|311104521|ref|YP_003977374.1| hypothetical protein AXYL_01321 [Achromobacter xylosoxidans A8]
 gi|310759210|gb|ADP14659.1| hypothetical protein AXYL_01321 [Achromobacter xylosoxidans A8]
          Length = 275

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/112 (13%), Positives = 36/112 (32%), Gaps = 2/112 (1%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           +++    + A+A  + A++C +     +   C+         +L   Y  +L++      
Sbjct: 9   RLLCVAGLFALAAPAYAIDCAKAASAVEKLICSDRKTVSADAELNRAYAALLKQAPDGDI 68

Query: 64  EL-FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 +Q  W   R  E             +    A   +    +R  +L+
Sbjct: 69  RAMLAHNQKRWIAARD-EALANLIQDPGAVPEGKTAAAVARELIRDRTAELQ 119


>gi|268679360|ref|YP_003303791.1| hypothetical protein Sdel_0722 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617391|gb|ACZ11756.1| Uncharacterized protein putative lipoprotein- like protein
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 877

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 42/112 (37%), Gaps = 10/112 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +   + +I I   + + +C       +   CT N  +L+ E+L   YK+  +        
Sbjct: 15  LSLGILLIPIITNAASFDCARASTFVEKTICTDNQLSLMDEELNTLYKEGQQN--SIYAT 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +K+Q+ W I R   C    S   + +        C+      R + L++ 
Sbjct: 73  QRKKTQLLWLIERDK-CNTEFSNDYQKS-------KCVSNAYESRIKDLKTL 116


>gi|262280720|ref|ZP_06058503.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257620|gb|EEY76355.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 117

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M +K+   L + +      + Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNKKLAMCLALFSGIAFTQSLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDAQQQWLKKRNA-CAA--------------GVSCIAKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|293394383|ref|ZP_06638683.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423361|gb|EFE96590.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 263

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 6/114 (5%)

Query: 6   IFALTIIAI---AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + A+T+++    +  + + +C + L + +   C+  + A + + L  TY + L   ++  
Sbjct: 14  VAAMTLLSFTVRSADNPSFDCKKKLNKVEGLICSNPTLAQLDKTLADTYPQTLNAADQAS 73

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA--NCLQGHAIERNEKLE 114
           R   + SQ  W   R   C    S  +    Q +      CLQ     R ++L+
Sbjct: 74  RAKIQASQKQWLQARAGICIAPQS-WQGLFKQPISDNPQRCLQDLYSLRIDELK 126


>gi|91784308|ref|YP_559514.1| hypothetical protein Bxe_A1492 [Burkholderia xenovorans LB400]
 gi|91688262|gb|ABE31462.1| hypothetical protein Bxe_A1492 [Burkholderia xenovorans LB400]
          Length = 222

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 42/118 (35%), Gaps = 18/118 (15%)

Query: 2   CRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R ++ A+ ++A     + + +CN      +   C   + + + + L   Y K   +V  
Sbjct: 31  LRPLLIAVLMLAHPLAHAASFDCNRGRSPTEKMICGDPALSKLDDALGQLYWKARRRV-T 89

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           ++R     S   W  +R + C  AA               CL      R E+L   + 
Sbjct: 90  NRRAFLTDSDGKW-AWREANCRDAA---------------CLGTWYATRIEELRKLVE 131


>gi|310815110|ref|YP_003963074.1| hypothetical protein EIO_0613 [Ketogulonicigenium vulgare Y25]
 gi|308753845|gb|ADO41774.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 123

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 40/96 (41%), Gaps = 1/96 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLE-ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           +C +    +++  C    ++  + +++      V      ++      +Q  W+ +R  E
Sbjct: 24  DCPDASSTSEIVVCLNELYSTAQLEMQVRLDGLVAGMASSNRVAALNAAQAVWKAFRQLE 83

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           C   A  AE GT  +++ A+C      +R   L +Y
Sbjct: 84  CESQALIAEGGTLANVLGASCYLHMTRDRIVALNAY 119


>gi|149913592|ref|ZP_01902125.1| hypothetical protein RAZWK3B_09826 [Roseobacter sp. AzwK-3b]
 gi|149812712|gb|EDM72541.1| hypothetical protein RAZWK3B_09826 [Roseobacter sp. AzwK-3b]
          Length = 1040

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 32/97 (32%), Gaps = 15/97 (15%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C       +   C+  S A    ++  ++    ++++    +   + Q AW   R 
Sbjct: 142 PSFDCARAGTSTEKAICSSASLATYDREIARSFSTARDRLDASAADDLLQGQRAWLRERN 201

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + C         G         CL+    +R   L+ 
Sbjct: 202 A-C--------GGN------RACLESTMRDRAAYLQR 223


>gi|188532785|ref|YP_001906582.1| hypothetical protein ETA_06380 [Erwinia tasmaniensis Et1/99]
 gi|188027827|emb|CAO95684.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 125

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 45/125 (36%), Gaps = 10/125 (8%)

Query: 1   MCRKII-FALTIIAIAFQSMAL-------NC-NETLM-QADMNQCTGNSFALVKEKLEAT 50
           M   I  F   + +   Q+  L        C ++       M  C      +  ++L   
Sbjct: 1   MKIFIATFIALLFSFTVQAKELAYSVSYNQCMDKAGGVTVSMRDCLAGEIIVQDKRLNDN 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           YKK + ++    ++ F  +Q  W  +R  +C   AS    GT  ++I  +C      +R 
Sbjct: 61  YKKFISEMSSDVKKNFIDAQRQWVKFRDLDCNAFASQEAGGTLSAVIADSCYLKMTAQRA 120

Query: 111 EKLES 115
           +    
Sbjct: 121 DDFSQ 125


>gi|78060738|ref|YP_367313.1| hypothetical protein Bcep18194_C7625 [Burkholderia sp. 383]
 gi|77965288|gb|ABB06669.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 334

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 30/99 (30%), Gaps = 17/99 (17%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +   +C +     +   C   + + +   L AT+K+ L   +       + +Q+ W   
Sbjct: 20  HAAGFDCAKAASPTEKAICADATLSKLDGDLAATWKQAL--AKGGDTAALKAAQLKWLKQ 77

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R   C         G         CL     ER   L  
Sbjct: 78  RDR-C--------GGDE------QCLGDRYRERLASLNG 101


>gi|167624844|ref|YP_001675138.1| hypothetical protein Shal_2930 [Shewanella halifaxensis HAW-EB4]
 gi|167354866|gb|ABZ77479.1| protein of unknown function DUF1176 [Shewanella halifaxensis
           HAW-EB4]
          Length = 491

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 38/129 (29%), Gaps = 15/129 (11%)

Query: 1   MCRKIIFALTIIAIAF---------QSMALNC--NETLMQADMNQCTGNSFALVKEKLEA 49
           +CR+I                     +  ++C          M +C     A V+ KL  
Sbjct: 352 LCREIAPGGAWFLPTTVSTVIVGDDPAAGIDCRSEHAYSTEGMTKCALRELASVELKLTE 411

Query: 50  TYKKVLE----KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
             + +               F ++Q +W  YR   C        EGT    +   C    
Sbjct: 412 VIESINALESVTANAELTAAFSQAQASWLTYRNDVCMAERLTYAEGTMGLPVLIGCKLEL 471

Query: 106 AIERNEKLE 114
             +R  +L+
Sbjct: 472 TEKRLRELQ 480


>gi|257093166|ref|YP_003166807.1| hypothetical protein CAP2UW1_1563 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045690|gb|ACV34878.1| protein of unknown function DUF1311 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 213

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 42/124 (33%), Gaps = 10/124 (8%)

Query: 1   MCRKI-----IFALTI---IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +++       A  +   +A+  Q    NC +   + +   C+  S A +  KL+  YK
Sbjct: 1   MKKRVPVVPSFIACALGLPMAVLAQGPTFNCAKATGEVETLICSDASLAALDRKLDEAYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
               K +        + Q  W   R  +C  A        T        C+      R  
Sbjct: 61  AAAAKAKGKLATRLREEQRGWVKGRN-DCWKAQDKTWITATWTVDTVKGCVDAQYRLRTS 119

Query: 112 KLES 115
           +L++
Sbjct: 120 ELQA 123


>gi|92118328|ref|YP_578057.1| twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
 gi|91801222|gb|ABE63597.1| Twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
          Length = 434

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 40/122 (32%), Gaps = 7/122 (5%)

Query: 1   MCRKIIFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           +C  ++      A    +   + +C +     +   C+          L  +Y+     V
Sbjct: 17  LCCVVLLGGLASADPASAVEASFDCKKAASAIEKFICSQAVLRWQDLALSRSYRAASNAV 76

Query: 59  EKHQRELFEKSQMAWEIYRGSEC----AFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
               R+    SQ  W   R   C    +F    A   T ++  Y +CL    ++R   L+
Sbjct: 77  VGAARDDLLVSQRDWVRERDRRCIADRSFKDLSAPSTTLRTQAY-DCLNSVYLDRRRALQ 135

Query: 115 SY 116
             
Sbjct: 136 DL 137


>gi|290473182|ref|YP_003466045.1| hypothetical protein XBJ1_0094 [Xenorhabdus bovienii SS-2004]
 gi|289172478|emb|CBJ79245.1| putative secreted protein [Xenorhabdus bovienii SS-2004]
          Length = 108

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 37/114 (32%), Gaps = 15/114 (13%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            R  +F L I++    + + +C +  +  +   CT +    +  ++   Y  +       
Sbjct: 1   MRYTLFMLLILSPLSLAASFDCAKAKVPDEKAICTDHRLNDLDIEMSVKYHFLRGLFAMG 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  SQ AW   R  +C                   CL     +R  +L++
Sbjct: 61  MSGEMYDSQQAWLKQR-QKCK--------------GDKTCLLQRYHQRINQLDA 99


>gi|194737742|ref|YP_002116674.1| hypothetical protein SeSA_A3939 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197300668|ref|ZP_02660403.2| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194713244|gb|ACF92465.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291262|gb|EDY30614.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 277

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 48/122 (39%), Gaps = 20/122 (16%)

Query: 2   CRKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-EKVE 59
            +K +F L+++A +   + + +CN      +   C+ +  + + + L   YK  +   + 
Sbjct: 6   NKKSLFILSMMACSTSYAASFDCNTVASGVEKMICSDHKLSRLDDYLSQNYKIAMGPDMP 65

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +  +    KSQ+ W   R + C                 A C++    ++ + L  +  C
Sbjct: 66  EEAKSKIRKSQIDWLNKRNA-CTD---------------AQCIERMYSKQMDYL--WNEC 107

Query: 120 PE 121
            +
Sbjct: 108 FD 109


>gi|205353030|ref|YP_002226831.1| hypothetical protein SG1885 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857257|ref|YP_002243908.1| hypothetical protein SEN1813 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205272811|emb|CAR37737.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206709060|emb|CAR33393.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326628109|gb|EGE34452.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 109

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 38/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVDAASFDCQKAQAADEKAICAHLTLNDKNVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|299771822|ref|YP_003733848.1| hypothetical protein AOLE_17955 [Acinetobacter sp. DR1]
 gi|298701910|gb|ADI92475.1| hypothetical protein AOLE_17955 [Acinetobacter sp. DR1]
          Length = 117

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M +K+   L + +      + Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNKKLAMCLVVFSGIAFTQSLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDAQQQWLKKRNA-CAA--------------GVSCISKAYQQRQQQLDA 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|83945480|ref|ZP_00957827.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851056|gb|EAP88914.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 160

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEK----HQRELFEKSQMAWEIYRGSECAF 83
               M +C   +  L  ++L A Y  + ++++      +RE    +Q AW  +R +EC+ 
Sbjct: 62  TTYGMMECAHRATELWDQRLNAAYFALRDRLQAREQLQRRERLLDAQRAWLAFREAECSQ 121

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   E GT   +I  +C       R   LE+ L
Sbjct: 122 QSLAYEGGTLMGVIANSCFNDFTARRALDLEAQL 155


>gi|83748393|ref|ZP_00945416.1| Hypothetical Protein RRSL_01788 [Ralstonia solanacearum UW551]
 gi|83724909|gb|EAP72064.1| Hypothetical Protein RRSL_01788 [Ralstonia solanacearum UW551]
          Length = 120

 Score = 71.7 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 42/99 (42%), Gaps = 3/99 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSE 80
           +C+  +  + M  C    +     +L   Y + +EK ++     L  ++Q AW  YR + 
Sbjct: 22  DCDSGVTPS-MKICASYHWEKEDIRLNRLYARSMEKAKEMGFETLLVQAQRAWLTYRDAV 80

Query: 81  CAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           C +    G   G  + +   +C++    ER + L + L 
Sbjct: 81  CLYEGQIGTGGGAYEGLYMLSCMETLTKERADHLAADLR 119


>gi|326317407|ref|YP_004235079.1| hypothetical protein Acav_2600 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374243|gb|ADX46512.1| protein of unknown function DUF1311 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 140

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 35/98 (35%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            A    E       +Y  CL      R   L  +LT  
Sbjct: 97  QATRATEALPEGPRLYHECLAAETEARRRGLMRWLTLE 134


>gi|163742502|ref|ZP_02149888.1| hypothetical protein RG210_06434 [Phaeobacter gallaeciensis 2.10]
 gi|161384087|gb|EDQ08470.1| hypothetical protein RG210_06434 [Phaeobacter gallaeciensis 2.10]
          Length = 136

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 30/101 (29%), Gaps = 8/101 (7%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK--------HQRELFEKSQMA 72
           + C  T  Q ++  C           L        E                  E +Q +
Sbjct: 31  MECGGTGSQIELRDCLNGDQIRANAALSRALDYAREAAADLDGITGRQSASPALETAQKS 90

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           WE +R + C F  +    G+   +   +C      +R E L
Sbjct: 91  WEAFRDAHCDFVGATFGGGSGTGIAILSCRITLTRDRVEAL 131


>gi|70730700|ref|YP_260441.1| hypothetical protein PFL_3336 [Pseudomonas fluorescens Pf-5]
 gi|68344999|gb|AAY92605.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 343

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 37/110 (33%), Gaps = 17/110 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++FA+   +   Q+ + +C +    ++   C     A +  +L   +K  L K +    +
Sbjct: 14  LLFAVLACSQGVQASSFDCAKAASSSEKALCADPYTASLDSQLGKAWKATLAKAKDP--K 71

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                Q  W   R  +CA                  CL+   + R   L 
Sbjct: 72  ALRLDQREWLKERD-QCAAD--------------LGCLRSKYLSRLVALR 106


>gi|330825433|ref|YP_004388736.1| hypothetical protein Alide2_2872 [Alicycliphilus denitrificans
           K601]
 gi|329310805|gb|AEB85220.1| protein of unknown function DUF1311 [Alicycliphilus denitrificans
           K601]
          Length = 132

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 35/100 (35%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +      L+  Y  V+  +  H+R    +   AW+  R ++C 
Sbjct: 28  CRPGGSVEETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQDHQAWQRARITQCK 87

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            A    E+      +Y  CL      R + L  +L   E 
Sbjct: 88  QAQRAQEQRPEWPRLYHECLVAQTRARRQALMHWLHHGEA 127


>gi|212633155|ref|YP_002309680.1| lipoprotein [Shewanella piezotolerans WP3]
 gi|212554639|gb|ACJ27093.1| Lipoprotein, putative [Shewanella piezotolerans WP3]
          Length = 189

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 38/111 (34%), Gaps = 15/111 (13%)

Query: 5   IIFALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ A+ +   A  +  + +CN+     +   C     A +  +L   Y + L K+   Q+
Sbjct: 7   LVLAIFLSLPALAASPSFDCNKASGSVETLICNDAELATLDRQLAQVYHQALPKIPAAQQ 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              + +Q  W   R  +C  +           +    C       R   L+
Sbjct: 67  P--KATQRGWIKGRN-DCWKS-----------VDVRQCTALSYQSRIIGLQ 103


>gi|120611271|ref|YP_970949.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
 gi|120589735|gb|ABM33175.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
          Length = 140

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 35/98 (35%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            A    E       +Y  CL      R   L  +LT  
Sbjct: 97  QATRATEALPEGPRLYHECLTAETEARRRGLMRWLTLE 134


>gi|294677048|ref|YP_003577663.1| hypothetical protein RCAP_rcc01511 [Rhodobacter capsulatus SB 1003]
 gi|294475868|gb|ADE85256.1| protein of unknown function DUF1311 [Rhodobacter capsulatus SB
           1003]
          Length = 167

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 34/100 (34%), Gaps = 3/100 (3%)

Query: 19  MALNCNETLMQA--DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAWEI 75
            A  C         D   C     A     L A YK    ++      E  + +Q AW  
Sbjct: 63  AAQGCTAAATDTTRDTIACIEAETAAWDGLLNAEYKARRAEMTAPGLAERLQNAQRAWIA 122

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           YR +EC   ++   + T   ++ ANC       R  +L  
Sbjct: 123 YRDAECGLESARWGDATLAGVVGANCRMEMTATRASELRD 162


>gi|167553797|ref|ZP_02347542.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205321845|gb|EDZ09684.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 109

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 37/115 (32%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + +  C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFACQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|169634586|ref|YP_001708322.1| hypothetical protein ABSDF3233 [Acinetobacter baumannii SDF]
 gi|169153378|emb|CAP02503.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii]
          Length = 118

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L + +      + Q+ + +CN      +++ C   S      K+  TY+ VL
Sbjct: 2   MNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTTTELSICKNRSLNDADVKMATTYQIVL 61

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 62  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQKQLDT 106

Query: 116 YLT 118
            L 
Sbjct: 107 ILQ 109


>gi|254497142|ref|ZP_05109959.1| hypothetical protein LDG_1556 [Legionella drancourtii LLAP12]
 gi|254353637|gb|EET12355.1| hypothetical protein LDG_1556 [Legionella drancourtii LLAP12]
          Length = 132

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 37/115 (32%), Gaps = 9/115 (7%)

Query: 7   FALTIIAIAFQSMAL------NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           F +   +IA    A       NC       +   C      L   +L   YK        
Sbjct: 8   FLVVFFSIATSLHAEKYQYNGNCKFIGNVENFKHCLDEELVLYDRELNDLYKSYFNNKPS 67

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  K++ +W  ++  +C + A+    G+   +IY  CL      R   L+ 
Sbjct: 68  KY---LRKAETSWIKFKEDDCDYIAAEVNGGSYYDVIYKACLINKTKVRINDLKR 119


>gi|260550484|ref|ZP_05824694.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260406399|gb|EEW99881.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 117

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTI-----IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L +     +A   Q+ + +CN    + +++ C   S      K+  TY+ VL
Sbjct: 1   MNRKFAIGLALFSGITLAHNAQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L+S
Sbjct: 61  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQQQLDS 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|307826027|ref|ZP_07656240.1| Uncharacterized protein putative lipoprotein-like protein
          [Methylobacter tundripaludum SV96]
 gi|307732866|gb|EFO03730.1| Uncharacterized protein putative lipoprotein-like protein
          [Methylobacter tundripaludum SV96]
          Length = 333

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 34/79 (43%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          IFAL   A    + + +C +  +  +   C+    + + ++L   +++ +EK    ++  
Sbjct: 19 IFALFCAASTVNAASFDCTKAAIDVEKIICSDTFISKLDDRLNINFREEIEKASDEEKTN 78

Query: 66 FEKSQMAWEIYRGSECAFA 84
            K Q  W  +  + C  A
Sbjct: 79 LIKHQKHWLKFTRNRCEDA 97


>gi|319763239|ref|YP_004127176.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
 gi|317117800|gb|ADV00289.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
          Length = 132

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 38/109 (34%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
            A+      C       + N C    +      L+  Y  V+  +  H+R    +  +AW
Sbjct: 19  TAWAQAGGACRPGGSVEETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQDHLAW 78

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  R ++C  A    E+      +Y  CL      R + L  +L   E 
Sbjct: 79  QRARITQCKQAQRAQEQRPEWPRLYHECLVAQTRARRQALMHWLHHGEA 127


>gi|255524897|ref|ZP_05391845.1| protein of unknown function DUF1311 [Clostridium carboxidivorans
           P7]
 gi|255511375|gb|EET87667.1| protein of unknown function DUF1311 [Clostridium carboxidivorans
           P7]
          Length = 228

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              ADM       +      L   Y  +  ++  +  +  +  ++ W   R ++   +AS
Sbjct: 136 GTTADMRTSVNERYKKWDAALNEIYGVLKGQLSANDMKNLQSEEIQWISNRDAKAEKSAS 195

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + G+ +S++Y   L      R  +L E Y+ 
Sbjct: 196 EMKGGSMESVLYTGSLAATTRSRCYELVEKYMH 228


>gi|209519966|ref|ZP_03268746.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209499617|gb|EDZ99692.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 191

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 42/116 (36%), Gaps = 18/116 (15%)

Query: 3   RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R ++ A  ++A     + + +C       +   C  ++ + + + L   Y K   +V   
Sbjct: 5   RPLLIAGLLLAHPYANATSFDCQRGHSPTERMICGDSALSTLDDTLGQLYWKARRRVS-Q 63

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +R   + S   W  +R + C  A                CL+     R ++L+  L
Sbjct: 64  RRAFIDDSDSKW-AWREANCRDAT---------------CLRTWYETRIDELQRLL 103


>gi|296121228|ref|YP_003629006.1| hypothetical protein Plim_0963 [Planctomyces limnophilus DSM 3776]
 gi|296013568|gb|ADG66807.1| protein of unknown function DUF1311 [Planctomyces limnophilus DSM
           3776]
          Length = 129

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 47/125 (37%), Gaps = 10/125 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALN----------CNETLMQADMNQCTGNSFALVKEKLEAT 50
           M  K+ +A+ +  +   ++  +              L Q +MN  +      + +KL   
Sbjct: 1   MQTKLHYAVLMAMVLTSALRADDAKLRDLEAHLQSALTQIEMNIASSKIAEYLDKKLVEK 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
            + V + ++     LF ++   W  YR ++  F A     G+ + +++         ER 
Sbjct: 61  ERDVAKDLDPEALRLFSEASKLWRDYRSAQTTFEADLYRGGSIRPLVHNRTYSRLTQERL 120

Query: 111 EKLES 115
             LE 
Sbjct: 121 SALEG 125


>gi|288960108|ref|YP_003450448.1| hypothetical protein AZL_a03730 [Azospirillum sp. B510]
 gi|288912416|dbj|BAI73904.1| hypothetical protein AZL_a03730 [Azospirillum sp. B510]
          Length = 317

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 37/111 (33%), Gaps = 8/111 (7%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--FEK 68
            +A   ++ + +C +     +   C+          + + YK +L  +   +        
Sbjct: 16  AVAGPAEAASFDCAQARSAEEKLICSTPPLDAADAAMGSAYKALLGDLAADEAGRGFARA 75

Query: 69  SQMAWEIYRGSECAF---AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            Q AW   R   C F   A    E G       A+CL+     R  +L + 
Sbjct: 76  EQRAWSQRRNRACGFGLPAGVEPESGYDNP---ADCLRAETERRAGQLAAL 123


>gi|296273673|ref|YP_003656304.1| hypothetical protein Arnit_2143 [Arcobacter nitrofigilis DSM 7299]
 gi|296097847|gb|ADG93797.1| protein of unknown function DUF1311 [Arcobacter nitrofigilis DSM
           7299]
          Length = 288

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 43/121 (35%), Gaps = 23/121 (19%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETL-MQADMNQCTGNSFALVKEKLEATYKK 53
            + I   L   +    +        + +CN      A+   C     +   ++L   Y +
Sbjct: 1   MKNIFLILIFFSSLIFAENVKFYKPSFDCNNVKKGTAEYIICANEYLSKDDKELNNLYSQ 60

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +L+ V K + EL ++SQ  W   R   C                  +C+    I+R ++L
Sbjct: 61  LLKNVSKEKIELIKESQYKWIRERQRNCNTE---------------SCISMAYIDRKKEL 105

Query: 114 E 114
           +
Sbjct: 106 Q 106


>gi|28872323|ref|NP_794942.1| hypothetical protein PSPTO_5211 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855578|gb|AAO58637.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 48/128 (37%), Gaps = 11/128 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL----- 55
           M     F L + ++ F      C  +    ++++C          +L  +YKK++     
Sbjct: 1   MKINFRFVLVLASLYFLPAHAECINSGTSQEVDECAKAEKNTADARLNGSYKKLIARAQG 60

Query: 56  -----EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAIER 109
                 ++    +   + SQ AW   R + C   A   E G  A      NC+ G ++ER
Sbjct: 61  QYRSDARLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLER 120

Query: 110 NEKLESYL 117
              L+  L
Sbjct: 121 AAYLDKLL 128


>gi|229020922|ref|ZP_04177613.1| hypothetical protein bcere0030_53730 [Bacillus cereus AH1273]
 gi|229026895|ref|ZP_04183219.1| hypothetical protein bcere0029_51600 [Bacillus cereus AH1272]
 gi|228734398|gb|EEL85068.1| hypothetical protein bcere0029_51600 [Bacillus cereus AH1272]
 gi|228740373|gb|EEL90680.1| hypothetical protein bcere0030_53730 [Bacillus cereus AH1273]
          Length = 309

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 33/91 (36%), Gaps = 1/91 (1%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
             +M +     +    + L   Y  + +++   +     + Q  W  YR  +   A + +
Sbjct: 219 TTEMKEGEVKRYDAWDQALNEIYGVLKKQLSTSEMNTLREKQREWIKYRDRKAEEAWNES 278

Query: 89  EEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +GT   +   +       ER  +L E Y+ 
Sbjct: 279 GQGTLSGIATISSKATSTRERCYQLVEQYMK 309


>gi|323525336|ref|YP_004227489.1| hypothetical protein BC1001_0978 [Burkholderia sp. CCGE1001]
 gi|323382338|gb|ADX54429.1| hypothetical protein BC1001_0978 [Burkholderia sp. CCGE1001]
          Length = 145

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 41/132 (31%), Gaps = 14/132 (10%)

Query: 1   MCRKIIFALT-IIAIAFQSMALNCNETL------MQADMNQCTGNSFALVKEKLEATYKK 53
           + R + FA   ++  +   +A +C                 C+  +       + + YK 
Sbjct: 9   LLRLLCFAAFHVLTHSAPVLAGDCAAVSGGIGLESATQSLACSKAALKRDDTLMNSVYKD 68

Query: 54  VLEKVEKHQREL------FEKSQMAWEIYRGSECAFAASGAEEGTAQS-MIYANCLQGHA 106
           +L+ +                +Q AW  +R SEC F  S          +    CL    
Sbjct: 69  LLKVLHDDPSGENFARSGLVSAQRAWIAFRDSECDFRVSLVGGAHQWREVNEVECLSELT 128

Query: 107 IERNEKLESYLT 118
             R   L  YL 
Sbjct: 129 KGRTNMLSEYLK 140


>gi|229593041|ref|YP_002875160.1| hypothetical protein PFLU5667 [Pseudomonas fluorescens SBW25]
 gi|229364907|emb|CAY52989.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 133

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +        C+         +C   +    ++ L+  Y+ +LE+
Sbjct: 1   MKSIFLALALIATGVHAAEDTDSTPCDGIENDKQTLECASYNKTTAEQLLKDNYQGLLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  WE  R ++CA     A  GT A ++   +CL   +
Sbjct: 61  MGSTYGSDKTKLADITARLKDAQQKWEKLRDADCAVDTFPAVNGTKAYAIAQNDCLARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|291613362|ref|YP_003523519.1| hypothetical protein Slit_0894 [Sideroxydans lithotrophicus ES-1]
 gi|291583474|gb|ADE11132.1| Uncharacterized protein putative lipoprotein-like protein
           [Sideroxydans lithotrophicus ES-1]
          Length = 589

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 43/114 (37%), Gaps = 19/114 (16%)

Query: 2   CRKIIFALT--IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R+I++     ++ +  Q+ + +C ++  + +   C+ +  + + + L+  Y+K LE+ +
Sbjct: 1   MRRIVWVALGWLLMLTAQAASFDCRQSSSKVEKLICSDHDLSKLDDALKMAYQKALEQSD 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             Q       Q  W     + C                  +C+     +R   L
Sbjct: 61  SKQ--KVIDEQRQWLKKVRNACQD---------------TSCMNKSYQDRIHDL 97


>gi|28872319|ref|NP_794938.1| hypothetical protein PSPTO_5207 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855573|gb|AAO58633.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 48/129 (37%), Gaps = 11/129 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL----- 55
           M     F L + ++ F      C  +    ++++C          +L  +YKK++     
Sbjct: 1   MKINFRFVLVLASLYFLPAHAECINSDTSQEVDECAKAEKNTADARLNGSYKKIIARAQG 60

Query: 56  -----EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAIER 109
                 ++    +   + SQ AW   R + C   A   E G  A      NC+ G ++ER
Sbjct: 61  QYRSDARLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLER 120

Query: 110 NEKLESYLT 118
              L+  L 
Sbjct: 121 AAYLDKLLH 129


>gi|70733028|ref|YP_262801.1| hypothetical protein PFL_5743 [Pseudomonas fluorescens Pf-5]
 gi|68347327|gb|AAY94933.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 53/132 (40%), Gaps = 15/132 (11%)

Query: 2   CRKIIFALTIIAIAFQSM----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL ++A   Q+     +  C+         +C   +    ++ L    + +LE+
Sbjct: 1   MKPIFLALVLMATGVQAAEETDSSPCDGVENDVQTLECATYNRTTAEQLLGDNVQSLLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  W+  R ++CA  +  A+ GT A ++   +CL   +
Sbjct: 61  LGTLYGSDKGQLADISAKVKNAQQLWQKQRDADCAMESFPAKPGTKAYTIATNDCLARMS 120

Query: 107 IERNEKLESYLT 118
            ER+E +ES   
Sbjct: 121 DERSEFIESIAQ 132


>gi|184156631|ref|YP_001844970.1| hypothetical protein ACICU_00311 [Acinetobacter baumannii ACICU]
 gi|239500970|ref|ZP_04660280.1| hypothetical protein AbauAB_01525 [Acinetobacter baumannii AB900]
 gi|183208225|gb|ACC55623.1| uncharacterized protein conserved in bacteria, putative lipoprotein
           [Acinetobacter baumannii ACICU]
 gi|193076151|gb|ABO10763.2| putative signal peptide [Acinetobacter baumannii ATCC 17978]
          Length = 117

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L + +      + Q+ + +CN    + +++ C   S      K+  TY+ VL
Sbjct: 1   MNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|312963514|ref|ZP_07777996.1| hypothetical protein PFWH6_5438 [Pseudomonas fluorescens WH6]
 gi|311282320|gb|EFQ60919.1| hypothetical protein PFWH6_5438 [Pseudomonas fluorescens WH6]
          Length = 133

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +        C+         +C   +    ++ L+  Y+ +LE+
Sbjct: 1   MKSIFLALALIATGVHAAEDTDSTPCDGIENDKQTLECASYNKTTAEQLLKDNYQALLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  WE  R ++CA     A  GT A ++   +CL   +
Sbjct: 61  MGSTYGHDKTKLADITARLKDAQQKWEKLRDADCAVDTFPAVTGTKAYAIAQNDCLARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|301347361|ref|ZP_07228102.1| hypothetical protein AbauAB0_13958 [Acinetobacter baumannii AB056]
 gi|301512321|ref|ZP_07237558.1| hypothetical protein AbauAB05_12087 [Acinetobacter baumannii AB058]
 gi|301597228|ref|ZP_07242236.1| hypothetical protein AbauAB059_15457 [Acinetobacter baumannii
           AB059]
          Length = 117

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L + +      + Q+ + +C+    + +++ C   S      K+  TY+ VL
Sbjct: 1   MNRKFAMGLALFSGLAFTHSLQAASFSCSAAKTKTELSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|158604905|gb|ABW74729.1| hypothetical protein CCC13826_1937 [Campylobacter concisus 13826]
          Length = 409

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 45/126 (35%), Gaps = 26/126 (20%)

Query: 4   KIIFALTIIAIAF------QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           K+IF  T++  +          + +C++   + +   C+    + V   ++  Y  ++ K
Sbjct: 5   KLIFISTLLITSNLYSSEKIQPSFDCSKAKTRVEKLVCSDEDISRVDRDMQKAYDLMMGK 64

Query: 58  VE------------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +            K   E  ++SQ+ W  YR   C       E        + +C+   
Sbjct: 65  YDLAYMNEEAKEEIKPYLEKLKQSQIDWVKYRDKYCNTKKDEKE--------FNSCVFSR 116

Query: 106 AIERNE 111
            + R +
Sbjct: 117 YVNRIQ 122


>gi|262375141|ref|ZP_06068375.1| predicted protein [Acinetobacter lwoffii SH145]
 gi|262310154|gb|EEY91283.1| predicted protein [Acinetobacter lwoffii SH145]
          Length = 114

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/112 (12%), Positives = 37/112 (33%), Gaps = 15/112 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + + I+   +++  +  + + +C +     +   C          K+  +Y  +   V  
Sbjct: 4   LSQGIVIFFSLLVGSTYAASFDCQKAETVTEKAICEHRLLNDADVKMSTSYHILRRMVPM 63

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             R + ++ Q+ W  +R   C                  +CL      R ++
Sbjct: 64  GTRSVIQRDQVKWLQFRDR-CQ--------------ESVSCLSQVYNMRQQQ 100


>gi|16127221|ref|NP_421785.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|221236022|ref|YP_002518459.1| hypothetical protein CCNA_03086 [Caulobacter crescentus NA1000]
 gi|13424625|gb|AAK24953.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|220965195|gb|ACL96551.1| hypothetical exported protein [Caulobacter crescentus NA1000]
          Length = 184

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIYRGSECAFA 84
                 M  C G    +   +L   Y+  L ++E   Q+   +K+Q AW  +R ++C  A
Sbjct: 90  GQSTYGMIACIGQEVGVQDARLNRAYQAALMRLERPRQKAALQKAQRAWIAFRDADC-AA 148

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               + G+   +    C+     +R E+LE +
Sbjct: 149 YVDEDWGSLARVEANQCVLDRTRQRAEELERF 180


>gi|330940018|gb|EGH43212.1| hypothetical protein PSYPI_12794 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 104

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 45/100 (45%), Gaps = 4/100 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    Q  MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQTSMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCL 102
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCL 104


>gi|254487428|ref|ZP_05100633.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214044297|gb|EEB84935.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 162

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 13/119 (10%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----------- 59
               +      +         M  C     A     L + YK  + + +           
Sbjct: 43  CAGASAGQCMDDTPGGSSTVGMGGCLERELAYWDGLLNSHYKAAMAQAKSLDADRPASMK 102

Query: 60  --KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                       Q AW  +R   CA+ AS    GT Q     +CL     ++   LE +
Sbjct: 103 DLPGAATALRDMQRAWIPFRDKACAYEASLWSGGTGQGPAALSCLLQQTAKQALTLEPW 161


>gi|307730265|ref|YP_003907489.1| hypothetical protein BC1003_2245 [Burkholderia sp. CCGE1003]
 gi|307584800|gb|ADN58198.1| hypothetical protein BC1003_2245 [Burkholderia sp. CCGE1003]
          Length = 118

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 5/105 (4%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            S A  C+++        C   +    K +L A Y+K+        +  FE+SQ AW  Y
Sbjct: 15  SSFAQTCSDSGNVYGDLSCANQALDRAKRELNAIYQKIYTTT--QYKSEFEQSQKAWLNY 72

Query: 77  RGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           R  +C     A +   +G    +I  +CL     +R + L++ L 
Sbjct: 73  REKQCNGYIAAEASQSQGVGPGLITKDCLVTITRQRVDYLKTLLE 117


>gi|217971328|ref|YP_002356079.1| hypothetical protein Sbal223_0115 [Shewanella baltica OS223]
 gi|217496463|gb|ACK44656.1| protein of unknown function DUF1311 [Shewanella baltica OS223]
          Length = 212

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 44/125 (35%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ +L+  A+A  + + +C +      +   C     + +  +L   Y + LEK +  Q 
Sbjct: 24  MVSSLSTGAMAADAPSFDCAKVNAGSIEAMVCKDAGLSQLDNQLAEVYSQALEKAKNEQP 83

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              +  Q  W   R  EC  +                C++     R  +L++       D
Sbjct: 84  PTLKAMQRGWVKGRN-ECWKSDDK-----------HACIEASYQTRIAELQA--QYRLVD 129

Query: 124 LLCPF 128
           +  P 
Sbjct: 130 ITGPV 134


>gi|260556337|ref|ZP_05828556.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|332873037|ref|ZP_08440994.1| hypothetical protein HMPREF0022_00594 [Acinetobacter baumannii
           6014059]
 gi|260410392|gb|EEX03691.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|322506518|gb|ADX01972.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516397|gb|ADX90778.1| hypothetical protein ABTW07_0341 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332738549|gb|EGJ69419.1| hypothetical protein HMPREF0022_00594 [Acinetobacter baumannii
           6014059]
          Length = 118

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L + +      + Q+ + +CN    + +++ C   S      K+  TY+ VL
Sbjct: 2   MNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVL 61

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 62  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQKQLDT 106

Query: 116 YLT 118
            L 
Sbjct: 107 ILQ 109


>gi|293605194|ref|ZP_06687582.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292816379|gb|EFF75472.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 211

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 29/105 (27%), Gaps = 8/105 (7%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           +   A  + + NC +     + + C     +     +   YK +  +++    +     Q
Sbjct: 1   MAGSAAAAPSFNCAKAATPVEKSICANYKLSDQDAAIAQQYKALRGELDAEAVKSLAADQ 60

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +   R       A      T         L      R   L++
Sbjct: 61  RYYLSIRD---KAYAEPYTGSTPF-----AELTSTMRYRLAFLKA 97


>gi|88799406|ref|ZP_01114984.1| hypothetical protein MED297_17408 [Reinekea sp. MED297]
 gi|88777945|gb|EAR09142.1| hypothetical protein MED297_17408 [Reinekea sp. MED297]
          Length = 93

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 2/88 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-- 89
           M  CT  + A   ++L   Y+++  ++ +  R+    +Q  W  Y+ +E     +     
Sbjct: 1   MTNCTNVALAEWDDELNRIYRELRLQLGEGARDSLLIAQRKWIEYKEAEIQNINAIYGSL 60

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYL 117
           +GT    + AN +      R  +L+SYL
Sbjct: 61  DGTMYIPMRANAILTITKSRTLELKSYL 88


>gi|170749429|ref|YP_001755689.1| hypothetical protein Mrad2831_3022 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655951|gb|ACB25006.1| protein of unknown function DUF1311 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 148

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 41/123 (33%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQS---MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + A   ++   ++    A  C           C   +      +L A YKK L  ++   
Sbjct: 19  LLACLAVSTGSRAEPPSAKLCLTETSTPGTTDCMNRALHEADARLNAAYKKALSVIDHDD 78

Query: 63  REL-----------FEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERN 110
           R              EK+Q AW  +R ++C     S    G+  +     CL    ++R 
Sbjct: 79  RTQDPDARALWKTRLEKAQRAWIAFRDADCGDLTFSEWANGSGANPAVPACLYDKTVQRT 138

Query: 111 EKL 113
             L
Sbjct: 139 ADL 141


>gi|237749665|ref|ZP_04580145.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229374739|gb|EEO25130.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 123

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 47/121 (38%), Gaps = 25/121 (20%)

Query: 5   IIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGN--SFALVKEKLEATYKKVL 55
           II  +  ++ +  +        + +C +   + +   C+ +      + ++L  +Y+ + 
Sbjct: 7   IILTMVFLSQSINAQSPKEAKPSFDCAKATTRVEKMICSDSSGELQNLDKQLFESYQAIK 66

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            K++K+ ++    SQ +W   R   C                   CL+     R ++L++
Sbjct: 67  AKLDKNDKKALLDSQKSWLKTREK-CE---------------SKECLKELLQHRIKELQN 110

Query: 116 Y 116
           Y
Sbjct: 111 Y 111


>gi|189499720|ref|YP_001959190.1| hypothetical protein Cphamn1_0757 [Chlorobium phaeobacteroides BS1]
 gi|189495161|gb|ACE03709.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1]
          Length = 208

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 43/113 (38%), Gaps = 14/113 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEKHQ 62
           ++F +    +   S + +C++    A+   C  +  A +  ++   +    +   +   +
Sbjct: 9   LVFMMFSATVQATSPSFDCSKAQSSAEKLVCEDDELASLDLEVARLFDLARDGKYMTPER 68

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R+L   +Q  W   R  +C  A+S             +C+  + + R  +L  
Sbjct: 69  RKLLIATQRGWVKGRD-DCWKASSL-----------RDCVFSNYVIRIHELRQ 109


>gi|171322079|ref|ZP_02910948.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171092607|gb|EDT37914.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
          Length = 341

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 33/111 (29%), Gaps = 17/111 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I+  LTI  +A Q+   +C +     +   C     + +    +          +     
Sbjct: 16  ILAVLTISPMAAQAAGFDCTKAASPTEKAICADPGLSSLDG--QLAAAWKKALAKGGDTA 73

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + +Q+ W   R   C         GT       +C+     ER   L  
Sbjct: 74  ALKAAQLQWLKQRDR-C---------GTD-----VSCVGDRYRERLASLNG 109


>gi|226945132|ref|YP_002800205.1| hypothetical protein Avin_30650 [Azotobacter vinelandii DJ]
 gi|226720059|gb|ACO79230.1| Conserved hypothetical protein DUF1311 [Azotobacter vinelandii DJ]
          Length = 126

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 2/101 (1%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
             +  ++    +  A M  C G   A    +L A Y+ + + +   +R+  +++Q  W  
Sbjct: 27  AYAACMDKAGGVT-AGMIDCIGTELATQDRRLNAAYRTLGQNLTPERRQRLQRTQRLWLQ 85

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           YR + C F  +  + G+   +    C+     ER  +LE  
Sbjct: 86  YRDANCDF-YADPDGGSLARVAANECVLRETTERAAELERL 125


>gi|169797445|ref|YP_001715238.1| hypothetical protein ABAYE3481 [Acinetobacter baumannii AYE]
 gi|213155741|ref|YP_002317786.1| hypothetical protein AB57_0377 [Acinetobacter baumannii AB0057]
 gi|215484882|ref|YP_002327121.1| hypothetical protein ABBFA_003240 [Acinetobacter baumannii
           AB307-0294]
 gi|332854361|ref|ZP_08435313.1| hypothetical protein HMPREF0021_02897 [Acinetobacter baumannii
           6013150]
 gi|332867576|ref|ZP_08437724.1| hypothetical protein HMPREF0020_01337 [Acinetobacter baumannii
           6013113]
 gi|169150372|emb|CAM88269.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii AYE]
 gi|213054901|gb|ACJ39803.1| hypothetical protein AB57_0377 [Acinetobacter baumannii AB0057]
 gi|213987585|gb|ACJ57884.1| hypothetical protein ABBFA_003240 [Acinetobacter baumannii
           AB307-0294]
 gi|332728037|gb|EGJ59428.1| hypothetical protein HMPREF0021_02897 [Acinetobacter baumannii
           6013150]
 gi|332733850|gb|EGJ64996.1| hypothetical protein HMPREF0020_01337 [Acinetobacter baumannii
           6013113]
          Length = 118

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M RK    L + +      + Q+ + +C+    + +++ C   S      K+  TY+ VL
Sbjct: 2   MNRKFAMGLALFSGLAFTHSLQAASFSCSAAKTKTELSICKNRSLNDADVKMATTYQIVL 61

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 62  HALPMGGRDNQKDTQQQWLKKRNA-CAA--------------NVSCISKAYQQRQKQLDT 106

Query: 116 YLT 118
            L 
Sbjct: 107 ILQ 109


>gi|78061672|ref|YP_371580.1| hypothetical protein Bcep18194_B0822 [Burkholderia sp. 383]
 gi|77969557|gb|ABB10936.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 262

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 37/111 (33%), Gaps = 18/111 (16%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  A   ++++  + +++C+    + D   C+  +       L + Y   +      Q  
Sbjct: 8   LTLAAIGLSLSAHADSIDCSRAKTRTDRLICSDKALVSADSALSSAYYDAVGIAADQQ-- 65

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              +SQ  W   R + C  AA               C+     +R   L+ 
Sbjct: 66  AVIQSQRTWLKQRDA-CGDAA---------------CVATAYRDRTAALKQ 100


>gi|313145035|ref|ZP_07807228.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313130066|gb|EFR47683.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 359

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 38/106 (35%), Gaps = 18/106 (16%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGN--SFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           +      + +C +   + +   C  +      +  ++  +Y+    K++K+ ++    SQ
Sbjct: 10  SPQEAKPSFDCAKATTKVEKMICEDSSGELQNLDRQISQSYQDTKAKLDKNAKKALLDSQ 69

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +W   R   C                   CL+     R ++L+SY
Sbjct: 70  KSWLKTRER-CE---------------SKECLKESLQSRIKELQSY 99


>gi|307729171|ref|YP_003906395.1| hypothetical protein BC1003_1125 [Burkholderia sp. CCGE1003]
 gi|307583706|gb|ADN57104.1| hypothetical protein BC1003_1125 [Burkholderia sp. CCGE1003]
          Length = 212

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 44/116 (37%), Gaps = 18/116 (15%)

Query: 3   RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R ++ A  +IA  + Q+ + +C++     +   C   + + + + L   Y K   KV   
Sbjct: 5   RPVMLAALLIAHSSAQATSFDCSKGRSLTEKMICNDPALSRLDDTLGQLYWKARRKVS-D 63

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +R     S   W  +R + C  AA               CL      R ++L+  L
Sbjct: 64  RRAFIADSDSKW-AWREANCRDAA---------------CLGTWYATRIDELQQVL 103


>gi|113868482|ref|YP_726971.1| hypothetical protein H16_A2515 [Ralstonia eutropha H16]
 gi|113527258|emb|CAJ93603.1| Hypothetical protein H16_A2515 [Ralstonia eutropha H16]
          Length = 121

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            + +  AD+  C      +    L + Y+ +L ++E  +      +Q AW  +R + CA+
Sbjct: 23  AKAISTADILGCAAVETRVQDVALNSAYQGLLRRLEAPRTGQLRVAQRAWLEFRQANCAY 82

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            A     GTA  +  A C+   +  R  +L  + T
Sbjct: 83  VA-NPAGGTAARVAGATCMARMSAARVRELRDFAT 116


>gi|325919507|ref|ZP_08181527.1| putative lipoprotein [Xanthomonas gardneri ATCC 19865]
 gi|325550010|gb|EGD20844.1| putative lipoprotein [Xanthomonas gardneri ATCC 19865]
          Length = 389

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 41/113 (36%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A    + + +C +     +   C   +   + ++L+ +Y+ ++E   +       
Sbjct: 15  ALLLGASGAWAASFDCKQASTAVEKRLCAVPALGDLDDQLDESYRALVETTPRSSVASVR 74

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A              +CLQ     R + L   LT  
Sbjct: 75  DQQRAWLRQRNA-CAQDAKL-----------DDCLQRSLKARADVLAKALTAQ 115


>gi|77461786|ref|YP_351293.1| hypothetical protein Pfl01_5565 [Pseudomonas fluorescens Pf0-1]
 gi|77385789|gb|ABA77302.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 251

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 51/124 (41%), Gaps = 11/124 (8%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           R I  +L +++ +       C    +    ++C          KL ++YKK++ + E   
Sbjct: 4   RCIALSLGLLSASAVLAEDTCKVITVSWQYDECVEADRKSADAKLNSSYKKLMARFESRW 63

Query: 63  REL----------FEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNE 111
           +             + SQ AW   R + C   A+  E G+ A +++   C+   ++ER  
Sbjct: 64  KPEPEQGKAYMAMAKDSQRAWIKLRDTTCPLDATDVEPGSQAYTLVLNKCIARMSLERAA 123

Query: 112 KLES 115
            L++
Sbjct: 124 FLDA 127


>gi|83942683|ref|ZP_00955144.1| hypothetical protein EE36_16622 [Sulfitobacter sp. EE-36]
 gi|83846776|gb|EAP84652.1| hypothetical protein EE36_16622 [Sulfitobacter sp. EE-36]
          Length = 163

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 37/121 (30%), Gaps = 13/121 (10%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV---------- 58
           +  + ++      +         M  C         ++L   Y  V+ +           
Sbjct: 41  MACVGVSANQCMEDSPGGSSTYGMGGCLDRELQFWDQRLNDNYAAVMVQAKRMDADAIPG 100

Query: 59  ---EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                   +   + Q AW ++R   C + AS  + GT +     NCL      +   L+ 
Sbjct: 101 PEGSPGVADALREMQRAWIVFRDKACTYEASLWQGGTGRGPAAINCLMQQTARQALSLDV 160

Query: 116 Y 116
           +
Sbjct: 161 W 161


>gi|326536480|ref|YP_004300911.1| hypothetical protein 65p072 [Aeromonas phage 65]
 gi|312262826|gb|ADQ53082.1| conserved hypothetical protein [Aeromonas phage 65]
          Length = 91

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 26/79 (32%), Gaps = 5/79 (6%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M + +I  +    +   + + +C       ++  C     + + E+L   YK        
Sbjct: 1  MKKLMIAVMFAFPMFSHAASFDCANASTTVELTICDDEKLSKLDEELNKVYKLARIHDPS 60

Query: 61 HQRELFEKSQMAWEIYRGS 79
                 KSQ+ W   R  
Sbjct: 61 -----IVKSQIDWVKIRNK 74


>gi|187924611|ref|YP_001896253.1| hypothetical protein Bphyt_2634 [Burkholderia phytofirmans PsJN]
 gi|187715805|gb|ACD17029.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 192

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 43/118 (36%), Gaps = 18/118 (15%)

Query: 2   CRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R ++ A  ++A     + + +CN      +   C   + + + + L   Y K   +V  
Sbjct: 4   IRPLLIAALMLAHPVAHATSFDCNRGRSLTEKMICNNPALSKLDDTLGQLYWKARRRVS- 62

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           ++R     S   W  +R + C  AA               CL      R E+L++ + 
Sbjct: 63  NRRAFLTDSDSKW-AWREANCRDAA---------------CLGTWYATRIEELQTLIE 104


>gi|21243931|ref|NP_643513.1| hypothetical protein XAC3205 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109540|gb|AAM38049.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 389

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 40/113 (35%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 15  ALVLSAGAAWSASFDCKQAGTPVERRLCAVPALGQLDDQLDEAYRGVLDTAPRDSLTAVR 74

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A              +CL+     R + L   L   
Sbjct: 75  DQQRAWLRQRNA-CAQDAK-----------VDDCLRRSLKARVDALGKILDAQ 115


>gi|27382610|ref|NP_774139.1| hypothetical protein blr7499 [Bradyrhizobium japonicum USDA 110]
 gi|27355782|dbj|BAC52764.1| blr7499 [Bradyrhizobium japonicum USDA 110]
          Length = 339

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 42/100 (42%), Gaps = 4/100 (4%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           +  + Q++MN     S+A + E+L+    +V     + + +     Q  W  +R +E   
Sbjct: 244 DYPMTQSEMNDRAAQSYAALNEELDKICAQVRAYTGRDEVDAV---QKLWGEFRNAEAER 300

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            A     GT + M+Y          R ++L  ++  P GD
Sbjct: 301 QAQRHLGGTIRRMLYILAATRITEARIKELRDWIEDP-GD 339


>gi|322434481|ref|YP_004216693.1| hypothetical protein AciX9_0845 [Acidobacterium sp. MP5ACTX9]
 gi|321162208|gb|ADW67913.1| hypothetical protein AciX9_0845 [Acidobacterium sp. MP5ACTX9]
          Length = 272

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 38/109 (34%), Gaps = 13/109 (11%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A +I+A+A  + A +C + +   D   C       +   L   Y  +  ++    +   
Sbjct: 9   IAASILALATVTAAADCTKAITPIDKTVCQTPELTKLDADLNHLYTALRPQLTIGAKARL 68

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q  W   R   CA                A CLQ    +R ++LE+
Sbjct: 69  LTQQRTWLALRDKTCA-------------TADAACLQHQYADRLDQLEA 104


>gi|146291219|ref|YP_001181643.1| hypothetical protein Sputcn32_0108 [Shewanella putrefaciens CN-32]
 gi|145562909|gb|ABP73844.1| conserved hypothetical protein [Shewanella putrefaciens CN-32]
 gi|319428422|gb|ADV56496.1| Protein of unknown function DUF2091, periplasmic [Shewanella
           putrefaciens 200]
          Length = 212

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 40/122 (32%), Gaps = 15/122 (12%)

Query: 8   ALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
           AL+  A+A  + + +C +      +   C       +  +L   Y + LEK +  Q    
Sbjct: 27  ALSAGAMAANAPSFDCTKVNAGSIEDMVCKDAGLNQLDNQLAKVYSQALEKSKNEQPPTL 86

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
           +  Q  W   R  EC                   C+Q     R  +L++     E  +  
Sbjct: 87  KAMQRGWVKGRN-ECWKNDDK-----------HACIQSSYQTRIAELQAQYRLVE--MTG 132

Query: 127 PF 128
           P 
Sbjct: 133 PV 134


>gi|293610096|ref|ZP_06692397.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827328|gb|EFF85692.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124264|gb|ADY83787.1| hypothetical protein BDGL_003201 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 117

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAIAF-----QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M  K+   L +++        Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNNKLAICLALLSGIAFTQNLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + CA                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDTQQQWLKKRNA-CAAN--------------VSCISKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|172065126|ref|YP_001815838.1| hypothetical protein BamMC406_5844 [Burkholderia ambifaria MC40-6]
 gi|171997368|gb|ACB68285.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 341

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/111 (12%), Positives = 29/111 (26%), Gaps = 17/111 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I+  L I  +A  +   +C +     +   C   + + +    +          +     
Sbjct: 16  ILAVLMIAPMAAHAAGFDCTKAASPTEKAICADPALSSLDG--QLAAAWKKALAKGGDTA 73

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + +Q+ W   R   C                   C+     ER   L  
Sbjct: 74  ALKAAQLQWLKQRDR-CGA--------------GVLCVGDRYRERLASLNG 109


>gi|24371712|ref|NP_715754.1| hypothetical protein SO_0112 [Shewanella oneidensis MR-1]
 gi|24345489|gb|AAN53199.1|AE015462_6 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 207

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 43/125 (34%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           +  AL + AIA +S + +C +      +   C       +  +L   Y K  EK +  Q 
Sbjct: 18  LATALCLPAIAAESPSFDCGKVQAGSIEEMVCRDAGLIKLDRQLADVYAKATEKAKNEQP 77

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            + +  Q  W   R  EC  +                C++     R  +L++     E  
Sbjct: 78  PVLKAMQRGWVKGRN-ECWKSEDK-----------RTCVESSYQTRIAQLQAQYRLVE-- 123

Query: 124 LLCPF 128
           +  P 
Sbjct: 124 MTGPV 128


>gi|223934928|ref|ZP_03626847.1| protein of unknown function DUF1311 [bacterium Ellin514]
 gi|223896381|gb|EEF62823.1| protein of unknown function DUF1311 [bacterium Ellin514]
          Length = 138

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 10/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMAL----------NCNETLMQADMNQCTGNSFALVKEKLEAT 50
           M   I F    + +A  +             N ++   Q + N  +         KL  T
Sbjct: 1   MRTIIAFLCLFLTVAALAGEPSDSNLQQLKNNLDQAKTQTETNLTSKAIADFWDAKLLRT 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
            +K+  ++ + + + F +++  W+ YR SE +F A  +E G+ Q +I  +        R 
Sbjct: 61  ERKIESRLNRQEHKKFLQTKKLWQKYRSSEVSFRAGFSEGGSIQPLIANSTYSHITEHRV 120

Query: 111 EKLESY 116
            +LE+ 
Sbjct: 121 IELEAL 126


>gi|126725440|ref|ZP_01741282.1| hypothetical protein RB2150_04528 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704644|gb|EBA03735.1| hypothetical protein RB2150_04528 [Rhodobacterales bacterium
           HTCC2150]
          Length = 133

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 49/124 (39%), Gaps = 10/124 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R ++     I ++    A      +  A+ + C  +    +++++ A Y  +  ++ +
Sbjct: 1   MKRMLVTFFAAIFLSGGVSADENCSGMSNAEKSYCLVDLADFLEKQMVAAYISLDREIAR 60

Query: 61  ----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
                       R+  + SQ+ +E +R   C+F  + A  G    +I   C+     +R 
Sbjct: 61  LEGKSNAFALELRKNLQPSQIGFEAFREPYCSFEIASAMGGNGSGLIRQMCINDMTTQRT 120

Query: 111 EKLE 114
           + L 
Sbjct: 121 KYLR 124


>gi|116625077|ref|YP_827233.1| hypothetical protein Acid_6008 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228239|gb|ABJ86948.1| protein of unknown function DUF1311 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 81

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 43  VKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
               L+A YK++  +++         +Q  W  YR + C         GTA  ++Y  CL
Sbjct: 2   ADSGLDAAYKEIRTRLDGEDATRLNLAQRLWIQYRDANCTAERELYAGGTAAPVVYLACL 61

Query: 103 QGHAIERNEKL 113
           +     R  +L
Sbjct: 62  EVMTRARTREL 72


>gi|317493779|ref|ZP_07952196.1| hypothetical protein HMPREF0864_02964 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918106|gb|EFV39448.1| hypothetical protein HMPREF0864_02964 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 384

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 32/98 (32%), Gaps = 11/98 (11%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C       +   C   S + +   L  +Y+  +  +   Q      +Q  W   R
Sbjct: 8   AASFDCENAGNSIEHAICDTTSLSALDSSLNESYQIAMSNLPTTQANELRTAQRNWIKQR 67

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              CA                 +CLQ    +R+ +L+ 
Sbjct: 68  NG-CAAN----------PERLESCLQKSMAQRDRELQE 94


>gi|149201457|ref|ZP_01878432.1| hypothetical protein RTM1035_17567 [Roseovarius sp. TM1035]
 gi|149145790|gb|EDM33816.1| hypothetical protein RTM1035_17567 [Roseovarius sp. TM1035]
          Length = 186

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/114 (12%), Positives = 26/114 (22%), Gaps = 13/114 (11%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLE-------------ATYKKVLEKVEKHQ 62
                +  +       M  C      L   +L                    +       
Sbjct: 70  SAQACMTTDGGETTIGMIDCLDAELKLWDGRLNAAYAAKMDAARASDAEMASIGASVPSL 129

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                + Q AW  +R + C +  +    GT        C       +  +LE +
Sbjct: 130 ENSLREMQRAWMAFRDAACLYEQAQWMGGTGGGPATMACHMQETAHQALRLEGW 183


>gi|83953922|ref|ZP_00962643.1| hypothetical protein NAS141_06843 [Sulfitobacter sp. NAS-14.1]
 gi|83841867|gb|EAP81036.1| hypothetical protein NAS141_06843 [Sulfitobacter sp. NAS-14.1]
          Length = 163

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 37/121 (30%), Gaps = 13/121 (10%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV---------- 58
           +  + ++      +         M  C         ++L   Y  V+ +           
Sbjct: 41  MACVGVSANQCMEDSPGGSSTYGMGGCLDRELQFWDQRLNDNYAAVMVQAKRMDADAIPG 100

Query: 59  ---EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                   +   + Q AW ++R   C + AS  + GT +     NCL      +   L+ 
Sbjct: 101 PEGSPGVADALREMQRAWIVFRDKACTYEASLWQGGTGRGPAAINCLMQQTARQALSLDV 160

Query: 116 Y 116
           +
Sbjct: 161 W 161


>gi|89096590|ref|ZP_01169482.1| hypothetical protein B14911_13157 [Bacillus sp. NRRL B-14911]
 gi|89088605|gb|EAR67714.1| hypothetical protein B14911_13157 [Bacillus sp. NRRL B-14911]
          Length = 202

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 41/102 (40%), Gaps = 2/102 (1%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + AL   ++   A       + + +  ++L   Y  + E++   + E   + Q  W   R
Sbjct: 102 ADALEAADSSTYALKKV-ENDRWEIWDDRLNEIYGVLQERLPAEEMESLREEQRDWLKER 160

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    A+   E GT + + Y   L     ER  +L E+Y+ 
Sbjct: 161 DARALEASLKYEGGTQEHLEYVAVLADITEERCYELVENYMN 202


>gi|114763747|ref|ZP_01443141.1| hypothetical protein 1100011001335_R2601_16610 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543748|gb|EAU46761.1| hypothetical protein R2601_16610 [Roseovarius sp. HTCC2601]
          Length = 180

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 37/131 (28%), Gaps = 18/131 (13%)

Query: 6   IFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVEKH 61
           + A   +     +   + +C +    A+   C+ ++ A +  +L   +        ++  
Sbjct: 13  LVAFVTLNHGATALEPSFDCAKAQSGAEEAVCSFDALAALDIELARLFTAASTGPNMDPD 72

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLT-- 118
                   Q  W   R + C              M    C       R  +L   Y    
Sbjct: 73  AHATLRAMQRGWIKGRDA-CWT----------SDMGLPLCTANEYAFRISELRQRYADAR 121

Query: 119 CPEGDLLCPFI 129
             EG  L PF 
Sbjct: 122 AEEGASLGPFP 132


>gi|260432257|ref|ZP_05786228.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416085|gb|EEX09344.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 106

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 37/106 (34%), Gaps = 8/106 (7%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--------ELFEKSQMA 72
           + C +   Q ++  C G +   V+  L   +    +  ++              E SQ A
Sbjct: 1   MECTDAGSQVEIGACVGQAETNVEAALVQAFGLAADAAKELDAVTGRTVALPALEASQAA 60

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           W+ YR ++C    +    G+   +   +C       R  +L  +  
Sbjct: 61  WQAYRDAQCEAVGASYGGGSGTGIAITSCRVELGRARVTELLRFAN 106


>gi|260427471|ref|ZP_05781450.1| conserved hypothetical protein, putative [Citreicella sp. SE45]
 gi|260421963|gb|EEX15214.1| conserved hypothetical protein, putative [Citreicella sp. SE45]
          Length = 149

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 31/90 (34%), Gaps = 1/90 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYRGSECAF 83
           +      + +C         E L A +  +  + + +   +    +Q  W   R +ECA 
Sbjct: 54  KDDTTIGIAECIMREQRGWDELLNAWWTPMKARAQANGSWDSLLAAQRQWIKDRDAECAR 113

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               A  G+ + +  A C +     R  + 
Sbjct: 114 RYEEAGGGSIRVIYGAECQRDLTAARAVEF 143


>gi|319653791|ref|ZP_08007886.1| hypothetical protein HMPREF1013_04505 [Bacillus sp. 2_A_57_CT2]
 gi|317394517|gb|EFV75260.1| hypothetical protein HMPREF1013_04505 [Bacillus sp. 2_A_57_CT2]
          Length = 217

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 34/93 (36%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A++ +     +    E+L   Y  + ++++K Q +   + Q  W   R      ++ 
Sbjct: 125 TTTAELVEQEAERYRNWDEELNKIYGLLEDQLDKGQMDQLREEQRIWIQQRDEAAKKSSL 184

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + G+ + + Y         ER   L   Y+ 
Sbjct: 185 KYKGGSMEPLEYVATQASLTRERCYLLVAKYMK 217


>gi|53802861|ref|YP_115354.1| hypothetical protein MCA2965 [Methylococcus capsulatus str. Bath]
 gi|53756622|gb|AAU90913.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 340

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 31/96 (32%), Gaps = 2/96 (2%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C +     +   C+  + A     L   + ++ + +          +Q  W  +  
Sbjct: 23  PSFDCTKAQGSIERAICSDENLADRDRSLAERFARLEKDLSPESFATVRNAQRDWVSWVR 82

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           + C      + E  +     A+CL     ER   L 
Sbjct: 83  AWCG--GKKSAEDASHPSGVADCLNTEYGEREGVLA 116


>gi|84686415|ref|ZP_01014309.1| hypothetical protein 1099457000216_RB2654_01190 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665598|gb|EAQ12074.1| hypothetical protein RB2654_01190 [Rhodobacterales bacterium
           HTCC2654]
          Length = 162

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 45/160 (28%), Gaps = 42/160 (26%)

Query: 1   MCRKIIFALTIIAIAF--------QSMALNCNETL------------------------- 27
           M R +I +  ++A            + + +C                             
Sbjct: 1   MMRFLIASFCLLATPAVAQDLTYDFAHSRDCIAATDDWFEKLQCIGTSANRCMEDTEGGY 60

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR---------ELFEKSQMAWEIYRG 78
                  C    +     +L A Y  + E++    +         +    +Q AW  +R 
Sbjct: 61  STVGTGACIWAEYEDWDAELNALYGPLRERLANDDKVNEMPVSTSDALRDAQRAWIPWRD 120

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           + CAF  S    GT      A CL     ER   L + L 
Sbjct: 121 AACAFERSKWGGGTGGGPAEAGCLMQMTAERALSLRNELE 160


>gi|118588851|ref|ZP_01546259.1| hypothetical protein SIAM614_19134 [Stappia aggregata IAM 12614]
 gi|118438837|gb|EAV45470.1| hypothetical protein SIAM614_19134 [Stappia aggregata IAM 12614]
          Length = 204

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 38/117 (32%), Gaps = 20/117 (17%)

Query: 5   IIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--- 59
           +  A      A  +   A +C +    A+   C+ +    + +KL   Y+  +  V+   
Sbjct: 10  LFVAAVGFVPAAWAAGPAFDCAKAESSAEKLVCSNDDLGALDQKLADVYEGAVGVVKSLD 69

Query: 60  ---KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              + +    +  Q  W   R  +C  +               +C++     R  +L
Sbjct: 70  AGAEEELNTLKAYQRGWVKGRD-DCWKSDDE-----------LSCVRSAYERRIAEL 114


>gi|78063034|ref|YP_372942.1| hypothetical protein Bcep18194_B2187 [Burkholderia sp. 383]
 gi|77970919|gb|ABB12298.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 134

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 42/121 (34%), Gaps = 9/121 (7%)

Query: 5   IIFALTIIAIAFQSMALN------CNETLMQ---ADMNQCTGNSFALVKEKLEATYKKVL 55
           +       A+A  ++A        C         AD+  C    +     +L A YK  +
Sbjct: 13  LTAGALFCAVASSALADEAERAAICKTAEETGYTADIRNCLRLKYEAADRRLNAVYKTKM 72

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +++  +      +  W   R + CA +      GT   + + +C       R + +E+
Sbjct: 73  ANLDEQGKARLRNDERRWLKARDATCAESRQPDAGGTLGLVEHDSCFVDETERRVKVIEA 132

Query: 116 Y 116
           +
Sbjct: 133 F 133


>gi|206563095|ref|YP_002233858.1| hypothetical protein BCAM1242A [Burkholderia cenocepacia J2315]
 gi|198039135|emb|CAR55098.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 146

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 49/120 (40%), Gaps = 10/120 (8%)

Query: 9   LTIIAIAFQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ----- 62
           +   +    + A +C    +  + + Q + +      ++L  TY+KVL+ + + +     
Sbjct: 24  VLTFSGVAAAQAQSCAPDSVAPECLLQRSQDELQQADDELNRTYRKVLKSLSRPRDEYVN 83

Query: 63  ----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
               +  F ++Q  W  +  +EC+      E G  +++    C      +R  +L ++L 
Sbjct: 84  YPALKAKFIEAQRQWLRFIDNECSAWYLINEAGADRNLDLLTCEIERTRDRTRQLNTWLK 143


>gi|323692007|ref|ZP_08106255.1| hypothetical protein HMPREF9475_01118 [Clostridium symbiosum
           WAL-14673]
 gi|323503930|gb|EGB19744.1| hypothetical protein HMPREF9475_01118 [Clostridium symbiosum
           WAL-14673]
          Length = 302

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 4/100 (4%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                 +       + L   +L   Y+ +LE + + + E     +  W   R      AA
Sbjct: 202 GSNTDSLKNVADYEYRLWDTELNRIYQSLLEGMTEEESEALRAEEREWIRTRDLAAKKAA 261

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLE----SYLTCPE 121
           +    GT +S+ Y   L      R  +L      YL   E
Sbjct: 262 AKYGGGTMESLEYTASLSASTRSRAYELLDSYGDYLEQEE 301


>gi|323486960|ref|ZP_08092275.1| hypothetical protein HMPREF9474_04026 [Clostridium symbiosum
           WAL-14163]
 gi|323399732|gb|EGA92115.1| hypothetical protein HMPREF9474_04026 [Clostridium symbiosum
           WAL-14163]
          Length = 302

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 4/100 (4%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                 +       + L   +L   Y+ +LE + + + E     +  W   R      AA
Sbjct: 202 GSNTDSLKNVADYEYRLWDTELNRIYQSLLEGMTEEESEALRAEEREWIRTRDLAAKKAA 261

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLE----SYLTCPE 121
           +    GT +S+ Y   L      R  +L      YL   E
Sbjct: 262 AKYGGGTMESLEYTASLSASTRSRAYELLDSYGDYLEQEE 301


>gi|170699068|ref|ZP_02890124.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|171321523|ref|ZP_02910462.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
 gi|170136026|gb|EDT04298.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|171093195|gb|EDT38404.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
          Length = 129

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R   C+             ++   C       R   L  
Sbjct: 77  MKQRDDRCSETRDD------GYLVNLQCAIDATQSRLSFLRE 112


>gi|172063822|ref|YP_001811473.1| hypothetical protein BamMC406_4803 [Burkholderia ambifaria MC40-6]
 gi|171996339|gb|ACB67257.1| protein of unknown function DUF1311 [Burkholderia ambifaria MC40-6]
          Length = 129

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R   C+             ++   C       R   L  
Sbjct: 77  MKQRDDRCSETRDD------GYLVNLQCAIDATQSRLSFLRE 112


>gi|331092245|ref|ZP_08341073.1| hypothetical protein HMPREF9477_01716 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330401677|gb|EGG81256.1| hypothetical protein HMPREF9477_01716 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 145

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 38/94 (40%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++T  Q +MN+ +   + L  ++L   +K + E++   +     + Q  W   +      
Sbjct: 51  SDTATQMEMNEYSEQLYKLWDDELNRLWKVLKEELSSTEMAKLLEEQRTWIAEKEKAINE 110

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
               +  GTA +M      +    +R  +L  YL
Sbjct: 111 IGEISGGGTATTMNKNMTGEDLTRKRVYELLEYL 144


>gi|15822614|gb|AAK73300.1| Ypar15 [Pseudomonas alcaligenes]
          Length = 132

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 44/127 (34%), Gaps = 17/127 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQC-TGNSFALVKEKLEATYKKVLEKVE 59
           M R I     ++  +  +    C           C   + +    + L  TY+K++ K++
Sbjct: 1   MSRVITLLALLLIPSLTNAESACELPEH-----LCKAQSEYERADKDLNETYQKIIAKIK 55

Query: 60  KHQRE-----------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
               +              +SQ +W  ++   C+        GT+++     C     IE
Sbjct: 56  SGDFDDGLVSRVEITESLRESQRSWLKFKQDNCSAYYKLYSGGTSRNGDLMACQSEMTIE 115

Query: 109 RNEKLES 115
           R   L++
Sbjct: 116 RTNFLKA 122


>gi|34580972|ref|ZP_00142452.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262357|gb|EAA25861.1| unknown [Rickettsia sibirica 246]
          Length = 108

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 31/103 (30%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEK--HQRELFEKSQMAWEIYRGSECAFAAS 86
           Q DMN C    +  V  KL   Y+++L+ +     Q  L +KS   W  YR +       
Sbjct: 3   QGDMNYCVAAEYKKVDTKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDAY------ 56

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
                                   ++ E+ L C EGDL CPFI
Sbjct: 57  -----------------------KKEFEAMLKCEEGDLSCPFI 76


>gi|114045621|ref|YP_736171.1| hypothetical protein Shewmr7_0108 [Shewanella sp. MR-7]
 gi|113887063|gb|ABI41114.1| conserved hypothetical protein [Shewanella sp. MR-7]
          Length = 206

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 43/126 (34%), Gaps = 17/126 (13%)

Query: 6   IFALTIIAIAFQS--MALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           IFA+T+   A  +   + +C++      +   C       + ++L   Y K  EK +  Q
Sbjct: 17  IFAMTLGTPAMAAEKPSFDCSKVRAGSIEELVCQDEGLIKLDQQLAEVYTKATEKAKNEQ 76

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
               +  Q  W   R  EC  +                C++     R  +L++     E 
Sbjct: 77  PPTLKAMQRGWVKGRD-ECWKSEDK-----------RACVESTYQTRIAELQAQYRLVE- 123

Query: 123 DLLCPF 128
            +  P 
Sbjct: 124 -MTGPV 128


>gi|325527862|gb|EGD05124.1| hypothetical protein B1M_07992 [Burkholderia sp. TJI49]
          Length = 129

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 37/102 (36%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+   F+    +L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCAKPHSAFDQVYCSSTQFSQSDRELNDEYGRLRKQLSGDQQAALKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C+   +         ++   C       R   L  
Sbjct: 77  LKQRDAQCSETRNN------GYLVDLQCATDMTQSRLSFLRE 112


>gi|206563929|ref|YP_002234692.1| hypothetical protein BCAM2089 [Burkholderia cenocepacia J2315]
 gi|198039969|emb|CAR55947.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 129

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|254250158|ref|ZP_04943478.1| hypothetical protein BCPG_05042 [Burkholderia cenocepacia PC184]
 gi|124876659|gb|EAY66649.1| hypothetical protein BCPG_05042 [Burkholderia cenocepacia PC184]
          Length = 129

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|302382021|ref|YP_003817844.1| hypothetical protein Bresu_0908 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192649|gb|ADL00221.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 122

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 36/108 (33%), Gaps = 15/108 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL  +    Q+ + +C       ++  C   +      ++  TY  VL+ V    R    
Sbjct: 19  ALVPVGPGAQAASFDCTRARRADEVAICGNRALEDADVRMSTTYTLVLQLVGMGMRGDLR 78

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            SQ AW   R   C         G         C+      R ++LE+
Sbjct: 79  DSQTAWLRER-GRC--------GGNV------TCIARSYRARTQRLEA 111


>gi|317127975|ref|YP_004094257.1| hypothetical protein Bcell_1261 [Bacillus cellulosilyticus DSM
           2522]
 gi|315472923|gb|ADU29526.1| hypothetical protein Bcell_1261 [Bacillus cellulosilyticus DSM
           2522]
          Length = 214

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                + +     + +  + L   Y  + E++   + +   + Q +W  YR      A+ 
Sbjct: 122 SSTYALKEVENTRWDIWDQLLNEIYGVIQEQLTVEEMDQLREKQRSWIKYRDDRALEASE 181

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + GT + + Y + L     ER  +L E Y+ 
Sbjct: 182 IYKGGTQEHLEYVSVLANLTEERCYELVEGYMK 214


>gi|258541597|ref|YP_003187030.1| hypothetical protein APA01_05000 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632675|dbj|BAH98650.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635732|dbj|BAI01701.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638787|dbj|BAI04749.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641841|dbj|BAI07796.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644896|dbj|BAI10844.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647951|dbj|BAI13892.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651004|dbj|BAI16938.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653995|dbj|BAI19922.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 143

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 43/123 (34%), Gaps = 6/123 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV-----LEKVE 59
           ++ +   +    Q+ A +    L   ++  C        ++++                 
Sbjct: 7   LLLSAASVLCTVQARAADKCPGLTTPEIADCQKQGVDKAQKQMARYIAAAEGRIRQSADP 66

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           +H    F  +Q  W  Y+ +EC  A     +GT +  +   C+      R   + + +LT
Sbjct: 67  EHALADFHTAQQHWAQYQKAECNAAYEAWSDGTIRFSMALTCMLRLTHSRTMDIWQMWLT 126

Query: 119 CPE 121
            P+
Sbjct: 127 YPD 129


>gi|300715174|ref|YP_003739977.1| exported protein [Erwinia billingiae Eb661]
 gi|299061010|emb|CAX58117.1| exported protein [Erwinia billingiae Eb661]
          Length = 133

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 53/130 (40%), Gaps = 14/130 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMA---LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +  +F +++ A+     A    NC+   +  +++ C+  +    +  L   Y    ++
Sbjct: 1   MKKFALFLISVTALTVSQFARAEENCSSKTISWEVDNCSVRNKDATEAILNKEYSAAKKR 60

Query: 58  VEKH----------QRELFEKSQMAWEIYRGSECAFAASGA-EEGTAQSMIYANCLQGHA 106
           +E+           Q +   ++Q  W  YR  +C   AS A E+ +A   + + C+    
Sbjct: 61  IEEEYKSDSSIVKFQLKTLLETQRNWLKYREGQCKMEASLADEDSSAHLGMVSICINKLD 120

Query: 107 IERNEKLESY 116
            +R  + +  
Sbjct: 121 KQRIAQFKEM 130


>gi|288871324|ref|ZP_06117227.2| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288863873|gb|EFC96171.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 306

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 31/93 (33%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M         L   ++   Y  +++ +++  R   E  Q  W   R ++   AA 
Sbjct: 206 STTYSMKTLAEKELRLWNIEMNTIYADIIDGLDEEARSKLEGEQQTWTKSRDTKAEEAAR 265

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
               G+ + + Y          R   L E+Y+ 
Sbjct: 266 KYSGGSLEGVEYTASQAESTRTRTYDLVETYIQ 298


>gi|331682200|ref|ZP_08382822.1| hypothetical protein ECOG_05170 [Escherichia coli H299]
 gi|331080624|gb|EGI51800.1| hypothetical protein ECOG_05170 [Escherichia coli H299]
          Length = 232

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 30/77 (38%), Gaps = 1/77 (1%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M   ++ +L + +    + + +C +     +   C     + + E+L + Y   L+   +
Sbjct: 1  MKNILLASLLVASPGAFAASFDCQKASTAIEHKICDNERLSKLDEQLSSAYSSALKGNPE 60

Query: 61 HQRELFEKSQMAWEIYR 77
          +  +  +  Q  W   R
Sbjct: 61 NA-DTLKMVQRQWVNMR 76


>gi|78061663|ref|YP_371571.1| hypothetical protein Bcep18194_B0813 [Burkholderia sp. 383]
 gi|77969548|gb|ABB10927.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 129

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 35/100 (35%), Gaps = 6/100 (6%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           F + A  C +     D   C+   F+     L   Y ++ +++   Q+   +  Q+AW  
Sbjct: 19  FTAHAAGCAKPHSAFDQVYCSSTQFSQTDRDLNDEYGRLRKQLSSDQQATLKTGQLAWLK 78

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            R ++C+   +         ++   C       R   L  
Sbjct: 79  QRDAQCSETRNN------GYLVDLQCATDMTQSRLSFLRE 112


>gi|70732538|ref|YP_262301.1| hypothetical protein PFL_5224 [Pseudomonas fluorescens Pf-5]
 gi|68346837|gb|AAY94443.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 163

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 41/109 (37%), Gaps = 11/109 (10%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV----------EKHQRELFEKS 69
           AL+C    +   +++C           L  +Y+ +L +V          E+      + +
Sbjct: 53  ALDCEHISVSEQVDRCAQQDKERADAALNQSYQALLVRVHNLYPSSLLQEQEYLGKLKNA 112

Query: 70  QMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAIERNEKLESYL 117
           Q AW  YR S C   A   E G  A   +   C+   + ER   LE  L
Sbjct: 113 QRAWIKYRDSTCVLEAFEVEPGKPAHVTLINLCVTRLSTERTRYLEQLL 161


>gi|167622285|ref|YP_001672579.1| hypothetical protein Shal_0344 [Shewanella halifaxensis HAW-EB4]
 gi|167352307|gb|ABZ74920.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 216

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/139 (13%), Positives = 39/139 (28%), Gaps = 39/139 (28%)

Query: 1   MCRKIIFALTIIAIAFQ-------------------------SMALNCNETLMQADMNQC 35
           M + I+    ++  A                           +   +C +   Q +   C
Sbjct: 1   MQKTILLGCLVLLAACSSTVATQIKPTQADSELVVPVSDMHVAPTFDCAKAQGQVETLIC 60

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                A +   +E  YK  +  +   ++   + +Q  W   R  +C  A    E      
Sbjct: 61  HDAELAQLDRLMEQIYKAAVVNIPASEQP--KATQRGWIKGRN-DCWKAQDVRE------ 111

Query: 96  MIYANCLQGHAIERNEKLE 114
                C   +   R  +L+
Sbjct: 112 -----CTLQNYKGRIIELQ 125


>gi|170737747|ref|YP_001779007.1| hypothetical protein Bcenmc03_5390 [Burkholderia cenocepacia MC0-3]
 gi|169819935|gb|ACA94517.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 129

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCAKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|302037308|ref|YP_003797630.1| hypothetical protein NIDE1981 [Candidatus Nitrospira defluvii]
 gi|300605372|emb|CBK41705.1| conserved exported protein of unknown function, COG3755 [Candidatus
           Nitrospira defluvii]
          Length = 135

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 47/113 (41%), Gaps = 4/113 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----K 60
           ++    I  ++      +C  +  Q ++N C       ++ K++  Y +++  +E    K
Sbjct: 13  VVIFSFISLVSANQDQQDCESSQTQLELNACWSQLAGEIEGKVKTAYLEIVRALEQAGEK 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +  +L +++Q  WE YR  +C  A    E G+    + A C       R   L
Sbjct: 73  NALKLLKRAQRYWEQYRDVQCEGARQLYEGGSVAKTVEATCRAKTGRNRIGDL 125


>gi|94312934|ref|YP_586143.1| hypothetical protein Rmet_4006 [Cupriavidus metallidurans CH34]
 gi|93356786|gb|ABF10874.1| conserved hypothetical protein; putative lipoprotein [Cupriavidus
           metallidurans CH34]
          Length = 211

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 38/114 (33%), Gaps = 18/114 (15%)

Query: 7   FALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--VEK 60
            AL ++     +MA     +C     Q +   C  ++ A +  +    Y   L+   +  
Sbjct: 10  VALAMLGTTSVAMAASPSFDCGNAKGQVEQLICKDDTLARLDRETTRLYGMALDARSLPA 69

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            Q++     Q  W   R  +C  A+               C+    +ER  +L 
Sbjct: 70  PQKKTLLAEQRGWIKGRN-DCWKASD-----------AGVCVAASYLERIHELR 111


>gi|237742340|ref|ZP_04572821.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|229429988|gb|EEO40200.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
          Length = 141

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 48/132 (36%), Gaps = 17/132 (12%)

Query: 1   MCRKIIFALTIIAIAF-QSMALNCN----------ETLM------QADMNQCTGNSFALV 43
           M + +   + +  I+   S +   +          +          ADM + T       
Sbjct: 1   MKKFLFTMMILFGISAFSSNSYETDLVGRMKVLEEKVQTKLDSGVTADMREATTELSETW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   E  Q  W   R  +    A  AE GT + +++ + ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKVKLENEQKKWLKNRNIKAKKDAKEAEGGTMEPLLFTSSIK 120

Query: 104 GHAIERNEKLES 115
                R  +L  
Sbjct: 121 DLNEARAIELAK 132


>gi|254464043|ref|ZP_05077454.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206684951|gb|EDZ45433.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 114

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 35/93 (37%), Gaps = 3/93 (3%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSECAF 83
               Q D N C    + +   +L   + +V    +     +     Q AW   R + C  
Sbjct: 23  NGQTQIDANFCAMEKWEIADRELNRLWSQVKPAADARGTGQALLAEQRAWLKRRDAACGP 82

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +    G+A  M Y +C++   + RN+ L + 
Sbjct: 83  EQAS--GGSAAPMFYWDCMEQETLRRNQALRAL 113


>gi|77461447|ref|YP_350954.1| hypothetical protein Pfl01_5226 [Pseudomonas fluorescens Pf0-1]
 gi|77385450|gb|ABA76963.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 133

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +        C+         +C+  S    ++ L+  Y  + E+
Sbjct: 1   MKSIFLALALIATGVHAAEESDNNPCDAVENDIQTLECSTYSRTTAEDLLKDNYASLNER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           ++                 + +Q  W   R ++CA  A  A +G+ A  +   +C+   +
Sbjct: 61  MQTTYGKNPAQLADITARLKAAQQQWLKTRDADCAVEAFPATDGSKAFKIAQNDCVARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|294624512|ref|ZP_06703192.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292601188|gb|EFF45245.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 385

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 40/113 (35%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTAPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A              +CLQ     R + L   L   
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDDCLQRSLKARVDALGKTLDAQ 111


>gi|34499742|ref|NP_903957.1| hypothetical protein CV_4287 [Chromobacterium violaceum ATCC 12472]
 gi|34105593|gb|AAQ61947.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 136

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
            A M  C     A   ++L  TY+K++  +   +++  + +Q  W  YR + C+ A    
Sbjct: 45  TAGMLDCLSAEHARQDKQLNDTYRKLMAALPAKRQQRLQVAQRLWLKYRAANCS-AYVDP 103

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLESY 116
           + G+A+S++ A+C       R  +L   
Sbjct: 104 DGGSAESLVAADCELASTAARAAELSRL 131


>gi|323191114|gb|EFZ76379.1| hypothetical protein ECRN5871_0691 [Escherichia coli RN587/1]
          Length = 241

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 30/77 (38%), Gaps = 1/77 (1%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M   ++ +L + +    + + +C +     +   C     + + E+L + Y   L+   +
Sbjct: 10 MKNILLASLLVASPGAFAASFDCQKASTAIEHKICDNERLSKLDEQLSSAYSSALKGNPE 69

Query: 61 HQRELFEKSQMAWEIYR 77
          +  +  +  Q  W   R
Sbjct: 70 NA-DTLKMVQRQWVNMR 85


>gi|222081857|ref|YP_002541222.1| urease-associated protein [Agrobacterium radiobacter K84]
 gi|221726536|gb|ACM29625.1| urease-associated protein [Agrobacterium radiobacter K84]
          Length = 179

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 46/132 (34%), Gaps = 13/132 (9%)

Query: 5   IIFALTIIAIAFQSMALN--------CN---ETLMQADMNQCTGNSFALVKEKLEATYKK 53
           ++ A  +   A  +   +        C          D   C   + A   +++   Y  
Sbjct: 46  LLLASFVSLPALAADQKDPTDRSLDLCLQDPNNGSTGDQTACETKALASYDKRMNLAYST 105

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EGTAQSMIYANCLQGHAIERNE 111
           +L+++     +  + +Q +W  YR  E     S  E  +G+  + +  +       ER  
Sbjct: 106 LLKELSPPAAQDLKTAQRSWIAYRDLEAKARESFFETRKGSMYAPMEVDAEVALTKERAL 165

Query: 112 KLESYLTCPEGD 123
            LE Y+   + D
Sbjct: 166 LLERYVRVLDID 177


>gi|170697589|ref|ZP_02888678.1| hypothetical protein BamIOP4010DRAFT_0740 [Burkholderia ambifaria
           IOP40-10]
 gi|170137476|gb|EDT05715.1| hypothetical protein BamIOP4010DRAFT_0740 [Burkholderia ambifaria
           IOP40-10]
          Length = 334

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 32/104 (30%), Gaps = 18/104 (17%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
           A      + +C + + + +   C+    A    +L A Y       + +     +  Q  
Sbjct: 249 ATPVIQASFDCGQAVSKIEKLICSTPETADADRRLNAAYSAAR--AKTNDLVGLKDDQRQ 306

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           W   R + C  AA               CL      R ++L + 
Sbjct: 307 WLKARNA-CDDAA---------------CLLNVTQVRIQRLSAM 334


>gi|34762232|ref|ZP_00143238.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|256845668|ref|ZP_05551126.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294785085|ref|ZP_06750373.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
 gi|27888090|gb|EAA25150.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|256719227|gb|EEU32782.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294486799|gb|EFG34161.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
          Length = 141

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 1   MCRKIIFALTIIAIAF-QSMALNCN----------ETLM------QADMNQCTGNSFALV 43
           M + +   + ++ I+   S +   +          +          ADM + T       
Sbjct: 1   MKKILFTMMILLGISAFSSNSYETDLVGRMKVLEEKVQTKLDSGVTADMREATTELSETW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   E  Q  W   R  +    A  AE GT + +++ + ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKVKLENEQKKWLKNRNIKAKKDAKEAEGGTMEPLLFTSSIK 120

Query: 104 GHAIERNEKLES 115
                R  +L  
Sbjct: 121 DLNEARAIELAK 132


>gi|149925321|ref|ZP_01913585.1| putative periplasmic protein [Limnobacter sp. MED105]
 gi|149825438|gb|EDM84646.1| putative periplasmic protein [Limnobacter sp. MED105]
          Length = 130

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 39/128 (30%), Gaps = 8/128 (6%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + +   + +   +  S A          +   CT    A  + +      K  ++ + 
Sbjct: 1   MNKLMFKLVFLGFFSVPSWAF----ASSTVEEEFCTQLKSANAEMEGTLLQIKQRKRDDS 56

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASG---AEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                   SQ  W  Y  +E           + G+   M       G   ER   L+ +L
Sbjct: 57  VFLTALNNSQKQWVQYVDAESLMQFPSQRFIDYGSVLPMCQCITRLGLTQERITTLKQWL 116

Query: 118 T-CPEGDL 124
               EGD+
Sbjct: 117 EPVVEGDV 124


>gi|262370124|ref|ZP_06063451.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315163|gb|EEY96203.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 114

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 38/118 (32%), Gaps = 15/118 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M    +      ++  Q+ + NC++     +   C          K+  TY  +   V  
Sbjct: 4   MLGIGLVCSLAWSMHAQAASFNCDKAKTTTEHTICEHLKINDADVKMATTYSILKRLVPM 63

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             R + +  Q+ W   R   C  +               +CL      R ++LE +L 
Sbjct: 64  GTRGMIQDEQVKWLSLRDR-CGASQ--------------SCLMDVYKMRQQQLELHLD 106


>gi|312878941|ref|ZP_07738741.1| protein of unknown function DUF1311 [Aminomonas paucivorans DSM
           12260]
 gi|310782232|gb|EFQ22630.1| protein of unknown function DUF1311 [Aminomonas paucivorans DSM
           12260]
          Length = 144

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 37/112 (33%), Gaps = 7/112 (6%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   +       A   + +  + A    +L   YK ++ ++    R+  + SQ  W  YR
Sbjct: 32  AYQKDLARDSSTAGTVEASNRAAAKWDRELNRVYKALMAQMGPEARQKLQASQRRWLAYR 91

Query: 78  GSE-------CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +E               E GT   M+ A         R  +L  YL    G
Sbjct: 92  DAERTAVGAMAGDLYEQNEGGTLWGMVAAVRSMEILRARALELTEYLDLYTG 143


>gi|310765177|gb|ADP10127.1| hypothetical protein EJP617_04460 [Erwinia sp. Ejp617]
          Length = 125

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 44/125 (35%), Gaps = 11/125 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALN---------CNETLM--QADMNQCTGNSFALVKEKLEAT 50
            +  I A  ++  +F   A           C +        M  C  +   +  ++L   
Sbjct: 1   MKLFIAAFIVLLFSFTVQAKEGAYSDSYNQCMDKADGVTVSMRHCYVDEIIVQDKRLNDN 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           Y+K +  +    ++ F  +Q     +R ++C   AS    GT  ++I  +C      +R 
Sbjct: 61  YRKFISTMSADVKKNFIDAQRQGVKFRDADCHAFASLEAGGTLSAVIADSCYLKMTAQRA 120

Query: 111 EKLES 115
           +    
Sbjct: 121 DDFSQ 125


>gi|21233231|ref|NP_639148.1| hypothetical protein XCC3803 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770173|ref|YP_244935.1| hypothetical protein XC_3875 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993382|ref|YP_001905392.1| hypothetical protein xccb100_3987 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115074|gb|AAM43049.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575505|gb|AAY50915.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735142|emb|CAP53354.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 183

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 31/98 (31%), Gaps = 5/98 (5%)

Query: 21  LNC--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
             C  N       M  C          +L   YK ++ K++  ++      Q  W   R 
Sbjct: 89  DECITNAAGATPAMLDCISAEHEYQDSRLNNVYKALIAKLDGTEQSKLRDQQRQWIADRD 148

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +C       + G A  +  A C       R  +LES 
Sbjct: 149 EKC---YYDPDSGQAGRVDAAECRLDMTASRAAELESL 183


>gi|325916262|ref|ZP_08178543.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325537556|gb|EGD09271.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 389

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 47/117 (40%), Gaps = 13/117 (11%)

Query: 3   RKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R ++ +  +++ +   + + +C +     +   C   +  L+ ++L+ +Y+ +++   + 
Sbjct: 9   RLLLGSALVLSASGAGAASFDCKQASTPVEQRICAVPALGLLDDQLDESYQALVQTTPRA 68

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                 + Q AW   R + CA  A              +CLQ     R + L   LT
Sbjct: 69  AVTGVREQQGAWLRQRNA-CAQDAKP-----------DDCLQRSLTARADVLAKALT 113


>gi|237808508|ref|YP_002892948.1| hypothetical protein Tola_1752 [Tolumonas auensis DSM 9187]
 gi|237500769|gb|ACQ93362.1| protein of unknown function DUF1311 [Tolumonas auensis DSM 9187]
          Length = 183

 Score = 67.5 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 43/118 (36%), Gaps = 6/118 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI++ L++    + + A  C     Q  M +   N       +L   Y ++   ++  
Sbjct: 1   MKKILYILSVFI--YNANAGEC--VATQCIMAKAIENQHNE-DGQLNKNYAELKLHLKSD 55

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLT 118
              + +  Q  W   R   C+      E+ G   S+    CL      RN +LE+   
Sbjct: 56  DFSVLKAVQKKWIKLRDLVCSDEIYNKEDLGNEASIEKQLCLYNQTKARNIELEALAN 113


>gi|330806680|ref|YP_004351142.1| hypothetical protein PSEBR_a21 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374788|gb|AEA66138.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 124

 Score = 67.5 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 42/115 (36%), Gaps = 10/115 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + ++    +   +  + A++C+      D   C         + +   YKK +  +  
Sbjct: 1   MIKSLLVGTLLAMASASASAMSCDNPRNAYDRTYCASLKMVQSDQDINDQYKKTMSALNP 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            Q++  + +Q+ W   R S C          +   ++Y +C       R   L++
Sbjct: 61  DQKKKVKAAQIQWIKNRDSAC----------SNDGLLYLDCANEKTEARIVILKA 105


>gi|291086876|ref|ZP_06571709.1| putative lipoprotein [Clostridium sp. M62/1]
 gi|291077251|gb|EFE14615.1| putative lipoprotein [Clostridium sp. M62/1]
          Length = 367

 Score = 67.5 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 36/97 (37%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           + +L QA++N+ + N ++L    L   +  + +   + + E     Q  W   +      
Sbjct: 271 DASLDQAELNETSMNLYSLWDFALNQLWDALGKVKTESEMEQLTVRQREWIKEKEEAVRA 330

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           A +  E GT + +           +R  +L   L   
Sbjct: 331 AGAEYEGGTMKPLAANTEAAELTQKRVYELMEELKSR 367


>gi|167586195|ref|ZP_02378583.1| hypothetical protein BuboB_12699 [Burkholderia ubonensis Bu]
          Length = 340

 Score = 67.5 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 37/108 (34%), Gaps = 13/108 (12%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + AL+ +     + + +C       +   C     + + EKL+ TY+  L   E   R  
Sbjct: 22  VAALSWLPAHAVAASFDCRAARTDVEHAICGDAELSRLDEKLDDTYRVALGLTEGETRNG 81

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              +Q AW                   A + +    L+    +R ++L
Sbjct: 82  VRTTQRAWLK-------------SLQPANARVDVRVLKDAYRQRIDEL 116


>gi|254510903|ref|ZP_05122970.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534614|gb|EEE37602.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 106

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 35/106 (33%), Gaps = 8/106 (7%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--------KHQRELFEKSQMA 72
           + C +   Q ++  C  +    V   ++++Y   +   +               E SQ  
Sbjct: 1   MECLDAGSQVEIGTCVSDMETRVNAAIKSSYSLAIGAAQELDDVTGRAVAVPALEASQTT 60

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           W  YR ++C    +    G+   +    C       R ++L  Y  
Sbjct: 61  WAAYRDAQCEAVGASFGGGSGTGIAITACRVDLGRARVDELLRYAN 106


>gi|114562839|ref|YP_750352.1| hypothetical protein Sfri_1663 [Shewanella frigidimarina NCIMB 400]
 gi|114334132|gb|ABI71514.1| protein of unknown function DUF1311 [Shewanella frigidimarina NCIMB
           400]
          Length = 137

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 49/128 (38%), Gaps = 14/128 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALN------------CNETLMQADMNQCTGNSFALVKEKLE 48
           M +  +  L +   +F +MA +            C         N C           L+
Sbjct: 1   MRKFKMLVLLLF--SFTAMAEDDSKQLKKEWNETCRNATSYKHGNYCLLKLEEKAVVLLD 58

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+ +LE ++K  ++    +Q  W  Y  ++C F +  ++EG         C   H ++
Sbjct: 59  KKYQTLLEYLKKPDKDRLVDAQNKWIKYVTADCLFYSPTSKEGDYSYTYNVGCRLTHKLQ 118

Query: 109 RNEKLESY 116
           R EKLE Y
Sbjct: 119 RLEKLEDY 126


>gi|120600746|ref|YP_965320.1| hypothetical protein Sputw3181_3962 [Shewanella sp. W3-18-1]
 gi|120560839|gb|ABM26766.1| conserved hypothetical protein [Shewanella sp. W3-18-1]
          Length = 212

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 42/125 (33%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ AL+  A+A    + +C +      +   C       +  +L   Y + LEK +  Q 
Sbjct: 24  MVSALSAGAMAANEPSFDCAKVNAGSIEDMVCKDAGLNQLDNQLAKVYSQALEKAKNEQP 83

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              +  Q  W   R  EC  +                C+Q     R  +L++     E  
Sbjct: 84  PTLKAMQRGWVKGRN-ECWKSDDK-----------HACIQSSYQTRIAELQAQYRLVE-- 129

Query: 124 LLCPF 128
           +  P 
Sbjct: 130 MTGPV 134


>gi|294666961|ref|ZP_06732190.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603250|gb|EFF46672.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 338

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 40/113 (35%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTAPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A              +CLQ     R + L   L   
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDDCLQRSLKARVDALGKTLDAQ 111


>gi|241664260|ref|YP_002982620.1| hypothetical protein Rpic12D_2677 [Ralstonia pickettii 12D]
 gi|240866287|gb|ACS63948.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 251

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 53/140 (37%), Gaps = 22/140 (15%)

Query: 1   MCR-KIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M R  ++   +++A    + A  +C   +  AD+ +C      +  +KL A Y +VL  +
Sbjct: 100 MTRAPLLLTASVLACGGVAHASTDCGNPVTSADVAECADRENLVTGQKLGAVYSQVLMGL 159

Query: 59  EK---------------HQRELFEKSQMAWEIYRGSECAFAA-----SGAEEGTAQSMIY 98
            K               H  E F  +Q AW  +R   C         S    G   ++  
Sbjct: 160 RKVDKEYGHSYPNRPPLHAAESFAAAQRAWLNFRRQSCHVEELVVRNSNPSRGDQSAIAV 219

Query: 99  ANCLQGHAIERNEKLESYLT 118
           A C    +  R  +LES +T
Sbjct: 220 AACESRLSSARVAELESLVT 239


>gi|325522862|gb|EGD01325.1| hypothetical protein B1M_27114 [Burkholderia sp. TJI49]
          Length = 132

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           +      A    + A +C    +  + + Q + + F    ++L  TY+KVL+ + + +  
Sbjct: 5   VVTALTFAWLTAAQAQSCEPDSVARECLQQRSQDEFQQADDELNRTYQKVLKAMSRPRGE 64

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  +  F ++Q  W  +  +ECA      E G  +++    C      +R  +L++
Sbjct: 65  YVNYPALKVKFVEAQRQWIRFLDNECAAWYLINEAGADRNLDLLTCEIDRTRDRTRQLKA 124

Query: 116 YLT 118
           +L 
Sbjct: 125 WLE 127


>gi|32265800|ref|NP_859832.1| hypothetical protein HH0301 [Helicobacter hepaticus ATCC 51449]
 gi|32261848|gb|AAP76898.1| hypothetical protein HH_0301 [Helicobacter hepaticus ATCC 51449]
          Length = 237

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 46/117 (39%), Gaps = 20/117 (17%)

Query: 4   KIIFALTIIAIAFQ--SMALNCNETLMQADMNQCTGNS--FALVKEKLEATYKKVLEKVE 59
            I+  + + A + Q    + +C +   + +   C   S     +  ++  +Y++   K++
Sbjct: 11  CIVLGIYLNAQSPQESKPSFDCAKATTKVEKMICNDESGNLQNLDRQIFKSYQETKAKLD 70

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           K+ ++ F  SQ +W   R   C                   CL+     R ++L++Y
Sbjct: 71  KNGKKAFLDSQKSWLKTRER-CE---------------SKECLKELLQSRIKELQTY 111


>gi|194367419|ref|YP_002030029.1| hypothetical protein Smal_3647 [Stenotrophomonas maltophilia
           R551-3]
 gi|194350223|gb|ACF53346.1| protein of unknown function DUF1311 [Stenotrophomonas maltophilia
           R551-3]
          Length = 140

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 43/134 (32%), Gaps = 18/134 (13%)

Query: 3   RKIIFALTIIAIAFQSMALN-------CNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           R +   +    I   + A +       C       + + C  +  A    +L   Y +  
Sbjct: 5   RVLASVVLWAGICGAATAFDRKDEGIDCAHPTTTMESDLCASDVAAAADAELNTVYAQAR 64

Query: 56  EKVEKHQR-----------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
           +++                +    +Q AW   R  +C    +   +GTA++     CL  
Sbjct: 65  QQLRTPDHGGSCSYCGEAEQQLVLAQRAWMQLRDHDCNAVYALNSDGTARNGAQMRCLTT 124

Query: 105 HAIERNEKLESYLT 118
            A +R  +L  +  
Sbjct: 125 LARDRTRQLREFYE 138


>gi|325929057|ref|ZP_08190212.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas perforans 91-118]
 gi|325540590|gb|EGD12177.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas perforans 91-118]
          Length = 385

 Score = 66.7 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 39/113 (34%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTTPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A               CLQ     R + L   L   
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDACLQRSLKTRVDALGKTLDAQ 111


>gi|238025688|ref|YP_002909919.1| hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
 gi|237874882|gb|ACR27215.1| Hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
          Length = 118

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 33  NQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA---FAASGAE 89
             CT       K++L   Y+K+        ++  ++SQ AW  YR  EC     A +   
Sbjct: 31  LACTSRDLVASKKELNEIYRKI--YASTQYKDELDRSQKAWLNYREKECNGYVAAEASQS 88

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +G    +I  +CL     +R + L+ +L 
Sbjct: 89  QGAGPGLIVKDCLVTITRQRVDYLKRFLE 117


>gi|78062237|ref|YP_372145.1| hypothetical protein Bcep18194_B1387 [Burkholderia sp. 383]
 gi|77970122|gb|ABB11501.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 132

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 37/115 (32%), Gaps = 22/115 (19%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------ 58
           +   +        + + NC +     +   CT  + + + + L A Y++V++        
Sbjct: 6   VALVVAAGMTGAHAASFNCAKASTFVEREICTNPALSRLDDALNADYQRVVDDFANYPVE 65

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +  +   F  SQ AW   R   C                   CL     +R + L
Sbjct: 66  DPPEYHSFIASQKAWLKTRNR-CT---------------TTQCLIDSYRKRIDVL 104


>gi|317492209|ref|ZP_07950638.1| hypothetical protein HMPREF0864_01402 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919548|gb|EFV40878.1| hypothetical protein HMPREF0864_01402 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 314

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 42/111 (37%), Gaps = 18/111 (16%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++F +  + +   ++A++C++  ++ D+  C   +   +   L   Y    +  +K    
Sbjct: 7   VLFIVVAVGLPASALAMDCSKATLKDDVAICGDTTLMQLDAVLNKNYLSARQHSDKD--- 63

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + +  Q++W   R  +C                   CL    +ER + L  
Sbjct: 64  ILKTQQLSWLKQR-QQCGDDT--------------GCLGNSYVERIKTLAE 99


>gi|152992002|ref|YP_001357723.1| hypothetical protein SUN_0406 [Sulfurovum sp. NBC37-1]
 gi|151423863|dbj|BAF71366.1| hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 263

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 33/101 (32%), Gaps = 15/101 (14%)

Query: 16  FQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
               + +C++     ++   C+ +    +  +L   YK+ L K  +      +  Q  W 
Sbjct: 3   ANQPSFDCSKVEKKSSEGLICSSDELMDIDRELATVYKQALAKASEEDM--LKAHQRGWI 60

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R  +C  A                C+      R ++L+ 
Sbjct: 61  KGRN-DCWKAEDE-----------KACMLDQYQLRIKELKE 89


>gi|295676982|ref|YP_003605506.1| hypothetical protein BC1002_1932 [Burkholderia sp. CCGE1002]
 gi|295436825|gb|ADG15995.1| conserved hypothetical protein [Burkholderia sp. CCGE1002]
          Length = 199

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 44/118 (37%), Gaps = 18/118 (15%)

Query: 1   MCRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + R ++ A  ++A     + + +C      A+   C  ++ + + + L   Y K   +V 
Sbjct: 3   LLRPLLIAGLLLAHPYANATSFDCQRGRSPAERMICGDSALSALDDTLGELYWKARRRVA 62

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           + +    + S   W  +R + C                 A CL+     R ++L+  L
Sbjct: 63  QRRAF-IDDSDSKW-AWREANCRD---------------AGCLRTWYTTRIDELQRLL 103


>gi|93005476|ref|YP_579913.1| hypothetical protein Pcryo_0646 [Psychrobacter cryohalolentis K5]
 gi|92393154|gb|ABE74429.1| protein of unknown function DUF1311 [Psychrobacter cryohalolentis
           K5]
          Length = 138

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 49/123 (39%), Gaps = 9/123 (7%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I+ +   +       A NC++ +   D   C    +    ++L  +Y K+ + +   Q+ 
Sbjct: 17  ILTSAAFMFPMLSWGAQNCDKPVNDFDGLYCLTKVYLEADKELNNSYSKLNKFLSSTQKS 76

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCPEGD 123
             ++ Q+AW   R  +C++     E G   +M   +C     I+R   L E    C  G 
Sbjct: 77  KLKRRQLAWMRDRNDQCSY---HDEGGFYVNM---DCATRTTIKRVNFLNERARECSAG- 129

Query: 124 LLC 126
             C
Sbjct: 130 -SC 131


>gi|225375221|ref|ZP_03752442.1| hypothetical protein ROSEINA2194_00846 [Roseburia inulinivorans DSM
           16841]
 gi|225212888|gb|EEG95242.1| hypothetical protein ROSEINA2194_00846 [Roseburia inulinivorans DSM
           16841]
          Length = 366

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/105 (13%), Positives = 35/105 (33%), Gaps = 1/105 (0%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
            ++ +      +  +Q+ M+      + +    L   +  V     + +       Q  W
Sbjct: 263 ASYDAAEEELKKATLQSRMDDYAMQMYDISDSCLNEIWNLVKYNTSEEKFNEILTEQRKW 322

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              + +          +G++  M  +  +    +ER E+L  YL 
Sbjct: 323 IADKEAAGNEILDQN-DGSSAQMDSSLKMAELTMERCEELADYLK 366


>gi|107025826|ref|YP_623337.1| hypothetical protein Bcen_3470 [Burkholderia cenocepacia AU 1054]
 gi|116692990|ref|YP_838523.1| hypothetical protein Bcen2424_4896 [Burkholderia cenocepacia
           HI2424]
 gi|105895200|gb|ABF78364.1| protein of unknown function DUF1311 [Burkholderia cenocepacia AU
           1054]
 gi|116650990|gb|ABK11630.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           HI2424]
          Length = 129

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 35/102 (34%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F   A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAGHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKTGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|50119078|ref|YP_048245.1| hypothetical protein ECA0117 [Pectobacterium atrosepticum SCRI1043]
 gi|49609604|emb|CAG73037.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 309

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 35/116 (30%), Gaps = 21/116 (18%)

Query: 2   CRKIIFAL--TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R +  A+   +        A++C++     +   C  +    +   L   Y+  ++K +
Sbjct: 1   MRYLSLAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNKAYQGYVKKAD 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           K Q     + Q  W   R   C                   CL    + R + L  
Sbjct: 61  KAQA---RQEQRTWLAERDR-CKDDV---------------CLGNEMVSRIQALSG 97


>gi|227328032|ref|ZP_03832056.1| hypothetical protein PcarcW_12150 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 309

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 32/116 (27%), Gaps = 21/116 (18%)

Query: 2   CRKIIFAL--TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R +  A+   +        A++C++     +   C  +    +   L   Y      V+
Sbjct: 1   MRYLSLAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNKAY---QGYVK 57

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           K  +    + Q  W   R   C                   CL    + R + L  
Sbjct: 58  KEDKAQARQEQRTWLAERDR-CKDDV---------------CLGNEMVSRIQALSG 97


>gi|134291977|ref|YP_001115746.1| hypothetical protein Bcep1808_6597 [Burkholderia vietnamiensis G4]
 gi|134135166|gb|ABO59491.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 347

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 30/103 (29%), Gaps = 17/103 (16%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
            +A  +   +C +     +   C       +  +L   ++K     +       + +Q+ 
Sbjct: 30  PMAAHAAGFDCAKAASPTEHAICADARLFALDGQLATAWQKAR--AKGGDTAAPKAAQLK 87

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           W   R   C         G       A+C+     ER   L  
Sbjct: 88  WLAQRDR-C--------GG------DASCIADRYRERLAILNG 115


>gi|187930640|ref|YP_001901127.1| hypothetical protein Rpic_3576 [Ralstonia pickettii 12J]
 gi|187727530|gb|ACD28695.1| protein of unknown function DUF1311 [Ralstonia pickettii 12J]
          Length = 152

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
                A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A  
Sbjct: 57  RGETTAGMTECTHTAYQAYDRQMNTLYQAVMRKSDPVSREAIRNAQRAWLAYRNAQKAAD 116

Query: 85  ASGA--EEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    + G+  S             R  +LE Y
Sbjct: 117 NAPWRADSGSMASPDIEGLNVEAIRARIAELEYY 150


>gi|46204364|ref|ZP_00050089.2| COG4461: Uncharacterized protein conserved in bacteria, putative
           lipoprotein [Magnetospirillum magnetotacticum MS-1]
          Length = 113

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 39/116 (33%), Gaps = 16/116 (13%)

Query: 4   KIIFALTIIAIA-FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
            +I AL ++A +   + + +C +     +   C   +   +  ++   +  + + +    
Sbjct: 5   CLILALGVLAASPATAASFSCAKAETPDEKTICDTRALNDLDVEMAVRFDILKDLLPMGN 64

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           R   ++ Q AW   R + C                   CL      R + L   L+
Sbjct: 65  RTKMQEDQEAWLKDRRA-CGTE--------------VACLTAAYEGRLKVLRGVLS 105


>gi|262373988|ref|ZP_06067265.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262310999|gb|EEY92086.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 116

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 35/113 (30%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
                +   + ++ +  C++     +   C          KL  TY+ +L  +    R+ 
Sbjct: 10  FILFPLFISSVEAASFPCHQAKSTVEHQICNQRELNDADVKLATTYQIILHALPMGVRDA 69

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  Q  W   R   C                   CL    ++R ++L+  L 
Sbjct: 70  EKDKQFQWLKQRNR-CGAKTL--------------CLSKAYLQRQQQLDRILQ 107


>gi|302670090|ref|YP_003830050.1| hypothetical protein bpr_I0725 [Butyrivibrio proteoclasticus B316]
 gi|302394563|gb|ADL33468.1| hypothetical protein bpr_I0725 [Butyrivibrio proteoclasticus B316]
          Length = 396

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/100 (14%), Positives = 37/100 (37%), Gaps = 1/100 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR-GSECA 82
           ++   Q +MN      F +   +L + + +  E  +   +E   + Q  W   +  +   
Sbjct: 191 DQDSTQVEMNMAASLYFQVWDAELNSLWNRFSESADAQTKERVLEDQRHWNAMKQDAALE 250

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
                 + G+   ++Y + ++     R  +L   +   +G
Sbjct: 251 ALGPQDQGGSIYPLLYDSFMEESTKGRCYELAKEIAAAKG 290


>gi|157963738|ref|YP_001503772.1| hypothetical protein Spea_3927 [Shewanella pealeana ATCC 700345]
 gi|157848738|gb|ABV89237.1| conserved hypothetical protein [Shewanella pealeana ATCC 700345]
          Length = 214

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/100 (13%), Positives = 33/100 (33%), Gaps = 14/100 (14%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A  + + +C +   + +   C     A +  ++   Y++ +  +    +   + +Q  W 
Sbjct: 38  ATITPSFDCAKAQGKVETLICDDAELAKLDREMAQVYQQAMVNIPPSAQP--KATQRGWI 95

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R  +C  A                C   +   R  +L+
Sbjct: 96  KGRN-DCWKAQD-----------VRQCTLDNYQIRLIELQ 123


>gi|78048885|ref|YP_365060.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037315|emb|CAJ25060.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 384

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 39/113 (34%), Gaps = 12/113 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTTPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             Q AW   R + CA  A               CLQ     R + L   L   
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDACLQRSLKTRVDALGKTLDAQ 111


>gi|160939115|ref|ZP_02086466.1| hypothetical protein CLOBOL_04009 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438078|gb|EDP15838.1| hypothetical protein CLOBOL_04009 [Clostridium bolteae ATCC
           BAA-613]
          Length = 321

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 33/98 (33%), Gaps = 7/98 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 L + +L + Y  ++E + +         Q  W   R +  A  +SG   G+ + 
Sbjct: 222 AETELKLWEGELNSIYNALMEMLSQEDAAKLASEQQEWLKNRDAR-AAESSGRNSGSMEG 280

Query: 96  MIYANCLQGHAIERNEKLESYLT------CPEGDLLCP 127
           + YA  L     +R  +L             E D   P
Sbjct: 281 ISYAATLASLTRDRAYELAGRYEEANGVFYEEEDSSQP 318


>gi|23097713|ref|NP_691179.1| hypothetical protein OB0258 [Oceanobacillus iheyensis HTE831]
 gi|22775936|dbj|BAC12214.1| hypothetical protein [Oceanobacillus iheyensis HTE831]
          Length = 211

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 30/83 (36%), Gaps = 1/83 (1%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                +    L   Y  +++++   + E     Q  W  YR +    A+   E GT + +
Sbjct: 129 DRYDNIWDGLLNEIYGVLVDQLSSEEMEALRVEQREWLEYRDNTAKEASLVYENGTMEQL 188

Query: 97  IYANCLQGHAIERNEKL-ESYLT 118
            Y         ER  +L E Y+ 
Sbjct: 189 EYVTVQNNLTEERCFQLVEEYMK 211


>gi|160873242|ref|YP_001552558.1| hypothetical protein Sbal195_0116 [Shewanella baltica OS195]
 gi|160858764|gb|ABX47298.1| conserved hypothetical protein [Shewanella baltica OS195]
 gi|315265467|gb|ADT92320.1| Protein of unknown function DUF2091, periplasmic [Shewanella
           baltica OS678]
          Length = 212

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 43/125 (34%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNET-LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ +L+  A+A    + +C +  +   +   C     + +   L   Y + LEK +  Q 
Sbjct: 24  MVSSLSTGAMAADVPSFDCTKVDVGSIEAMVCKDAGLSQLDNNLAEVYSQALEKAKNEQP 83

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              +  Q  W   R  EC  +                C++     R  +L++       D
Sbjct: 84  PTLKAMQRGWVKGRN-ECWKSDDK-----------HACIEASYQTRIAELQA--QYRLVD 129

Query: 124 LLCPF 128
           +  P 
Sbjct: 130 MTGPV 134


>gi|126736654|ref|ZP_01752393.1| hypothetical protein RCCS2_02575 [Roseobacter sp. CCS2]
 gi|126713769|gb|EBA10641.1| hypothetical protein RCCS2_02575 [Roseobacter sp. CCS2]
          Length = 168

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 32/106 (30%), Gaps = 13/106 (12%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF-------------EKSQ 70
            +      M  C  +   +  + L   Y +     ++                    ++Q
Sbjct: 58  ADGHTTTGMMFCLSDEAGVWDDLLNEEYAQSRAFAQRWDESDLSTSPQFAVRDNQVLQAQ 117

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            AW  +R + C  A      GT + +  A C      ER  +L  Y
Sbjct: 118 RAWIAFRDANCTMAYGRHGAGTLRQVSGAACQMRMTAERVFELARY 163


>gi|152998664|ref|YP_001364345.1| hypothetical protein Shew185_0111 [Shewanella baltica OS185]
 gi|151363282|gb|ABS06282.1| conserved hypothetical protein [Shewanella baltica OS185]
          Length = 212

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 42/125 (33%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           ++ +L+  A+A    + +C +      +   C     + +   L   Y + LEK +  Q 
Sbjct: 24  MVSSLSTGAMAADVPSFDCTKVDAGSIEAMVCKDAGLSQLDNNLAEVYSQALEKAKNEQP 83

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              +  Q  W   R  EC  +                C++     R  +L++       D
Sbjct: 84  PTLKAMQRGWVKGRN-ECWKSDDK-----------HACIEASYQTRIAELQA--QYRLVD 129

Query: 124 LLCPF 128
           +  P 
Sbjct: 130 MTGPV 134


>gi|262037412|ref|ZP_06010876.1| putative urease-associated protein [Leptotrichia goodfellowii
           F0264]
 gi|261748574|gb|EEY35949.1| putative urease-associated protein [Leptotrichia goodfellowii
           F0264]
          Length = 145

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 40/105 (38%), Gaps = 10/105 (9%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK----------HQRELFEKSQMAW 73
            +T   A+       ++    +++   YKK++ K+E+            +    K+Q +W
Sbjct: 36  KDTESTAEAVDAQVKTYEAWDKEMNIVYKKLINKIEEIEKKYGEEYKGFKASLIKTQKSW 95

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +R +E  F+      G+   +I A        +R  +L  Y  
Sbjct: 96  VEFRDNEADFSQRPFGRGSMGRVIRAGTRAEMTKDRALELAEYYD 140


>gi|317048638|ref|YP_004116286.1| hypothetical protein Pat9b_2429 [Pantoea sp. At-9b]
 gi|316950255|gb|ADU69730.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 271

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 29/99 (29%), Gaps = 15/99 (15%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
             + + +CN      +   C     + + E L   Y + +  +        ++SQ  W  
Sbjct: 21  ALAASFDCNRASTPQEKLICQTPQLSSLDETLANVYHQKMSGLAAADAVQLKQSQREWLK 80

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              S           GT       + LQ    +R   L 
Sbjct: 81  QLRSH----------GTD-----VDQLQTAYQQRIAALN 104


>gi|84687965|ref|ZP_01015829.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84663997|gb|EAQ10497.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 200

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 39/130 (30%), Gaps = 22/130 (16%)

Query: 2   CRKIIFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            R +IF +         A +    +C +   +A++  C     A +  +L  TY   L  
Sbjct: 1   MRSVIFTVFACCPGVVLAQEGPTFDCAKATHEAEIAICENAELAALDRRLAETYGAALAM 60

Query: 58  VE------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
            E      K      +  Q  W   R + C   +               C+    + R  
Sbjct: 61  AEGLDAGAKTAVAELKAYQRGWIGGRDA-CWKDSD-----------IVACISDAYLRREA 108

Query: 112 KLESYLTCPE 121
           +L +     E
Sbjct: 109 ELVAMWMLEE 118


>gi|226944379|ref|YP_002799452.1| lipoprotein [Azotobacter vinelandii DJ]
 gi|226719306|gb|ACO78477.1| lipoprotein [Azotobacter vinelandii DJ]
          Length = 221

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 32/102 (31%), Gaps = 13/102 (12%)

Query: 15  AFQSMALNCNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           A ++    C E L  A +   CT      +  K+   Y               E+ Q  W
Sbjct: 29  AGEAPPYECGENLSDALEKTICTDQDLTALDRKMAEVYAAARNGDSAGNPAGLEEQQRDW 88

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R + C  +A   E           CLQ     R  +L++
Sbjct: 89  IESRDA-CEKSAEPPE-----------CLQESYRRRIAELQA 118


>gi|119773641|ref|YP_926381.1| hypothetical protein Sama_0501 [Shewanella amazonensis SB2B]
 gi|119766141|gb|ABL98711.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 196

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 35/102 (34%), Gaps = 15/102 (14%)

Query: 17  QSMALNCNE---TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           Q  + +C +       A+   CT    A +  +L   Y+ ++ +       LF+  Q  W
Sbjct: 21  QPPSFDCGKLPGNAPSAEKLVCTDLELAALDRQLNEVYQTIVARAGDGLPPLFKAEQRGW 80

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R  EC  +              A C+      R  +L++
Sbjct: 81  IKGRN-ECWKSEDL-----------AACVAKSYRSRTAELQA 110


>gi|16127224|ref|NP_421788.1| hypothetical protein CC_2994 [Caulobacter crescentus CB15]
 gi|221236025|ref|YP_002518462.1| hypothetical protein CCNA_03089 [Caulobacter crescentus NA1000]
 gi|13424628|gb|AAK24956.1| hypothetical protein CC_2994 [Caulobacter crescentus CB15]
 gi|220965198|gb|ACL96554.1| hypothetical protein CCNA_03089 [Caulobacter crescentus NA1000]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 49/136 (36%), Gaps = 19/136 (13%)

Query: 1   MCRKIIFALTII---AIAFQSMALN----------CNET---LMQADMNQCTGNSFALVK 44
           + R ++ A  ++    +A Q+ A +          C E         + +C         
Sbjct: 2   LLRTMMIAAALLCLAPVAAQAQAEDGVSFSPDYDRCREKPENDNTPGILRCGDAEIKFQD 61

Query: 45  EKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
            +L   YK  +  +      +    K+Q AW  +R ++CA   +    GT + +   +C 
Sbjct: 62  ARLNKAYKADMADLKDSPAAKAALLKAQRAWIAFRDADCATVQAL-SGGTIRPIYVQSCY 120

Query: 103 QGHAIERNEKLESYLT 118
             H   R + LE  L 
Sbjct: 121 LKHTARRAQALEELLQ 136


>gi|218890779|ref|YP_002439643.1| hypothetical protein PLES_20401 [Pseudomonas aeruginosa LESB58]
 gi|218771002|emb|CAW26767.1| hypothetical protein PLES_20401 [Pseudomonas aeruginosa LESB58]
          Length = 128

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 10/119 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + +  AL   +    +        C       D   C    F+    +L   +  + +
Sbjct: 1   MNKPLATALPATSSLLLADGALAADACGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRK 60

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +   Q+ L +KSQ+AW   R + C+ +            +  +C      +R + L  
Sbjct: 61  HLNDGQKALLKKSQIAWIKERDAACSESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|218554465|ref|YP_002387378.1| hypothetical protein ECIAI1_1964 [Escherichia coli IAI1]
 gi|300904764|ref|ZP_07122592.1| hypothetical protein HMPREF9536_02833 [Escherichia coli MS 84-1]
 gi|301306902|ref|ZP_07212948.1| hypothetical protein HMPREF9347_05498 [Escherichia coli MS 124-1]
 gi|331668573|ref|ZP_08369421.1| conserved hypothetical protein [Escherichia coli TA271]
 gi|218361233|emb|CAQ98817.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|300403278|gb|EFJ86816.1| hypothetical protein HMPREF9536_02833 [Escherichia coli MS 84-1]
 gi|300837877|gb|EFK65637.1| hypothetical protein HMPREF9347_05498 [Escherichia coli MS 124-1]
 gi|315257290|gb|EFU37258.1| conserved hypothetical protein [Escherichia coli MS 85-1]
 gi|323186347|gb|EFZ71697.1| hypothetical protein ECOK1357_0296 [Escherichia coli 1357]
 gi|324017958|gb|EGB87177.1| hypothetical protein HMPREF9542_03358 [Escherichia coli MS 117-3]
 gi|324118937|gb|EGC12826.1| hypothetical protein ERBG_01046 [Escherichia coli E1167]
 gi|331063767|gb|EGI35678.1| conserved hypothetical protein [Escherichia coli TA271]
          Length = 162

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 153


>gi|88859453|ref|ZP_01134093.1| putative periplasmic protein [Pseudoalteromonas tunicata D2]
 gi|88818470|gb|EAR28285.1| putative periplasmic protein [Pseudoalteromonas tunicata D2]
          Length = 121

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 7/105 (6%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKV--LEKVEKHQRELFEKSQMAWEIYRGSECAF- 83
           + Q DMNQC G  +   + +L     ++  L K E+      EKSQ  WE     +    
Sbjct: 1   MSQRDMNQCAGIDYKKAESELFRVITEINKLYKDEEKFLVNLEKSQRNWEAQLELDLDLK 60

Query: 84  ---AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCPEGDL 124
              A      G+   M Y+       ++R   L+ +L    EG++
Sbjct: 61  FPRAGDPMYYGSIFPMCYSGYKTRLTLQRIAFLKEWLIGSREGEV 105


>gi|292489482|ref|YP_003532370.1| putative type VI secretion system-associated protein [Erwinia
           amylovora CFBP1430]
 gi|292898305|ref|YP_003537674.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291198153|emb|CBJ45258.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291554917|emb|CBA22864.1| putative type VI secretion system-associated hypothetical protein
           [Erwinia amylovora CFBP1430]
          Length = 135

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 55/129 (42%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTIIAI--AFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R +  ++ II +  +F + A+ +C++      +  C  N+  + ++ L   Y    ++
Sbjct: 3   MNRLLSLSIYIITLQASFSAYAINDCSKETSDPAVFTCAENNKDVAEKNLNHEYLAAKKR 62

Query: 58  VEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +E                F +SQ  W  YR  +C   A  A++ +    +   +C+    
Sbjct: 63  IEDLFSHEADVKKEYLTNFIESQRGWLKYRDGQCKLYAHVADKNSNPYIVFTNHCIAQLD 122

Query: 107 IERNEKLES 115
            +R+++L+ 
Sbjct: 123 EDRSKQLKE 131


>gi|158321018|ref|YP_001513525.1| putative lipoprotein [Alkaliphilus oremlandii OhILAs]
 gi|158141217|gb|ABW19529.1| lipoprotein, putative [Alkaliphilus oremlandii OhILAs]
          Length = 202

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 37/95 (38%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G S+ +  + L   Y  + +++     +  +  Q+ W   + +    
Sbjct: 106 SDAGVTNAMKNYYGKSYDMYDQALNEIYSLLKKELSPEIMKNLQTEQVKWIEQKEAAADK 165

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYL 117
            AS  + GT + + Y   L     +R  +L   Y+
Sbjct: 166 EASQYKGGTFEFVAYKVSLYESTKKRCYELVREYM 200


>gi|83951670|ref|ZP_00960402.1| hypothetical protein ISM_13945 [Roseovarius nubinhibens ISM]
 gi|83836676|gb|EAP75973.1| hypothetical protein ISM_13945 [Roseovarius nubinhibens ISM]
          Length = 235

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 26/97 (26%), Gaps = 15/97 (15%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q  + NC +     +   C     + + +++   YK     +    R      Q +W   
Sbjct: 27  QQPSFNCAKAGTPTEHAICASPLLSALDQEIAEAYKAKRATLGNEARAALLAEQRSWLKT 86

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R   C                   C+      R  +L
Sbjct: 87  RDL-CGDV--------------VACISAQMQHRQAQL 108


>gi|323499234|ref|ZP_08104211.1| hypothetical protein VISI1226_03410 [Vibrio sinaloensis DSM 21326]
 gi|323315622|gb|EGA68656.1| hypothetical protein VISI1226_03410 [Vibrio sinaloensis DSM 21326]
          Length = 134

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 46/130 (35%), Gaps = 16/130 (12%)

Query: 2   CRKIIFALTIIAIAFQSM---ALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            +K++  LT+++    +       CN +         C          +L  TY++ + +
Sbjct: 1   MKKLLMCLTLVSAPLLAADGVEDPCNMQGGGVMAGYLCVEQKLKAADAELNKTYQQAIIR 60

Query: 58  VEKHQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           + + +  L            F  SQ AW  ++ +EC F    +     Q +    C    
Sbjct: 61  IREEETALRKTWSETELVEPFRASQRAWLKFKDAECEFVGLSSTPSPWQGVQIEECKLEM 120

Query: 106 AIERNEKLES 115
            +ER E  + 
Sbjct: 121 ILERIEYFKG 130


>gi|126728412|ref|ZP_01744228.1| hypothetical protein SSE37_20517 [Sagittula stellata E-37]
 gi|126711377|gb|EBA10427.1| hypothetical protein SSE37_20517 [Sagittula stellata E-37]
          Length = 211

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 37/111 (33%), Gaps = 15/111 (13%)

Query: 7   FALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVEKHQR 63
            A+T   +A  +  A +C +     +   C  +  A +  ++   Y   +    + + + 
Sbjct: 13  LAMTAPGMAPAADPAFDCGKASGTVEEMICANDGLAELDREMARLYGLAVNDPDLGQERL 72

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +  +  Q  W   R  +C  A S              C+  +   R  +L 
Sbjct: 73  DRLKAMQRGWIKGRN-DCWKADS-----------VEGCVAENYAMRMHELR 111


>gi|24113255|ref|NP_707765.1| hypothetical protein SF1918 [Shigella flexneri 2a str. 301]
 gi|110805850|ref|YP_689370.1| hypothetical protein SFV_1915 [Shigella flexneri 5 str. 8401]
 gi|24052257|gb|AAN43472.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110615398|gb|ABF04065.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281601318|gb|ADA74302.1| hypothetical protein SFxv_2142 [Shigella flexneri 2002017]
 gi|332757295|gb|EGJ87632.1| hypothetical protein SF274771_2289 [Shigella flexneri 2747-71]
 gi|332757428|gb|EGJ87763.1| hypothetical protein SFK671_2332 [Shigella flexneri K-671]
 gi|333003278|gb|EGK22824.1| hypothetical protein SFK218_2722 [Shigella flexneri K-218]
 gi|333017607|gb|EGK36919.1| hypothetical protein SFK304_2481 [Shigella flexneri K-304]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 49/153 (32%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDTSAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLE-----------KVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +              K++  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|291614076|ref|YP_003524233.1| hypothetical protein Slit_1613 [Sideroxydans lithotrophicus ES-1]
 gi|291584188|gb|ADE11846.1| protein of unknown function DUF1311 [Sideroxydans lithotrophicus
           ES-1]
          Length = 280

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 34/95 (35%), Gaps = 18/95 (18%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + NC++   Q +   C+ N    +   L+A Y+ +L++    +     + Q  W   R 
Sbjct: 197 ASFNCSKAESQVEKLICSENEMKSLDRLLDAIYRNMLKQ--DRRSNSLREMQRQWMKKRN 254

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            EC                   C++   I R  +L
Sbjct: 255 -ECQNI---------------GCMKETYINRIFEL 273


>gi|154254024|ref|YP_001414848.1| hypothetical protein Plav_3593 [Parvibaculum lavamentivorans DS-1]
 gi|154157974|gb|ABS65191.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 323

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 30/94 (31%), Gaps = 13/94 (13%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C +     +   C+  + + + E++   Y      +     E+  KSQ +W  +    C
Sbjct: 24  DCGKASSPREKAICSDEALSALDEEIAGAYASARAALSPRGAEILRKSQRSWLRFLDKAC 83

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                            A CL     ++ + L  
Sbjct: 84  -------------PRATAACLAPWMEDQAKFLAG 104


>gi|323977938|gb|EGB73024.1| hypothetical protein ERFG_01460 [Escherichia coli TW10509]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DVQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSAPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|194429338|ref|ZP_03061864.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194412645|gb|EDX28941.1| conserved hypothetical protein [Escherichia coli B171]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 50/153 (32%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKV-----------LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +            ++K +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKTDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|241664831|ref|YP_002983191.1| hypothetical protein Rpic12D_3253 [Ralstonia pickettii 12D]
 gi|240866858|gb|ACS64519.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 153

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
                A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A  
Sbjct: 58  RGETTAGMTECTHAAYQAYDRQMNTLYQAVMSKSDPVSREAIRNAQRAWLAYRNAQKAAD 117

Query: 85  ASGA--EEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    + G+  S             R  +LE Y
Sbjct: 118 NAPWRADAGSVASPDIEGLNVEAIRARIAELEYY 151


>gi|114764434|ref|ZP_01443660.1| hypothetical protein 1100011001309_R2601_01873 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543188|gb|EAU46206.1| hypothetical protein R2601_01873 [Roseovarius sp. HTCC2601]
          Length = 199

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 36/118 (30%), Gaps = 22/118 (18%)

Query: 6   IFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-- 59
           + A   ++     A    A +C +    A+   C     A +  +L   +   +E  E  
Sbjct: 8   LLACLALSPVAGLAQDGPAFDCAKAESSAEKLICDDADLAALDRRLADRFAAAVEVAEGL 67

Query: 60  ----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               +   +     Q  W   R  EC   +               C++   ++R  +L
Sbjct: 68  DVGAEETTDTLRAMQRGWISGRD-ECWKESDL-----------RACVETEYLQREAEL 113


>gi|240144821|ref|ZP_04743422.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
 gi|257203125|gb|EEV01410.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
          Length = 373

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 41/95 (43%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++   Q+++N  +   + ++ E L   +  +    +++  +   + Q  W   + ++   
Sbjct: 279 DKAESQSEINDDSQKRYEVMDECLNYIWNLIKNDTDENAYQKILEEQRTWIADKEAKAKA 338

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           A+    +G+A +  Y +      + R E+L  YL 
Sbjct: 339 ASDEYGDGSAGTAAYYDKSAELTMTRCEELIEYLK 373


>gi|157155222|ref|YP_001463182.1| hypothetical protein EcE24377A_2109 [Escherichia coli E24377A]
 gi|191168076|ref|ZP_03029875.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|193065460|ref|ZP_03046529.1| conserved hypothetical protein [Escherichia coli E22]
 gi|260844287|ref|YP_003222065.1| hypothetical protein ECO103_2139 [Escherichia coli O103:H2 str.
           12009]
 gi|260855817|ref|YP_003229708.1| hypothetical protein ECO26_2729 [Escherichia coli O26:H11 str.
           11368]
 gi|260868475|ref|YP_003234877.1| hypothetical protein ECO111_2463 [Escherichia coli O111:H- str.
           11128]
 gi|300917541|ref|ZP_07134198.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300924969|ref|ZP_07140894.1| hypothetical protein HMPREF9548_03079 [Escherichia coli MS 182-1]
 gi|301327667|ref|ZP_07220874.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|307314211|ref|ZP_07593821.1| protein of unknown function DUF1311 [Escherichia coli W]
 gi|309796013|ref|ZP_07690426.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|157077252|gb|ABV16960.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|190901874|gb|EDV61624.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|192926865|gb|EDV81490.1| conserved hypothetical protein [Escherichia coli E22]
 gi|257754466|dbj|BAI25968.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257759434|dbj|BAI30931.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257764831|dbj|BAI36326.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|300415246|gb|EFJ98556.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300418844|gb|EFK02155.1| hypothetical protein HMPREF9548_03079 [Escherichia coli MS 182-1]
 gi|300845762|gb|EFK73522.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|306906180|gb|EFN36698.1| protein of unknown function DUF1311 [Escherichia coli W]
 gi|308120463|gb|EFO57725.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|315061183|gb|ADT75510.1| predicted protein [Escherichia coli W]
 gi|323152634|gb|EFZ38910.1| hypothetical protein ECEPECA14_5446 [Escherichia coli EPECa14]
 gi|323158638|gb|EFZ44652.1| hypothetical protein ECE128010_5096 [Escherichia coli E128010]
 gi|323180675|gb|EFZ66220.1| hypothetical protein ECOK1180_0664 [Escherichia coli 1180]
 gi|323378240|gb|ADX50508.1| hypothetical protein EKO11_1891 [Escherichia coli KO11]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|78060361|ref|YP_366936.1| hypothetical protein Bcep18194_C7248 [Burkholderia sp. 383]
 gi|77964911|gb|ABB06292.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 153

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 48/123 (39%), Gaps = 10/123 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           +      +    + A +C    +  + + Q + + F    ++L  TY+KVL  + + +  
Sbjct: 26  VAMALTFSWFTAAQARSCTPDSVAPECLLQRSQDEFQQADDELNRTYQKVLTSMSRPRDE 85

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  +  F ++Q  W  +  +EC       E G  +++    C      +R  +L +
Sbjct: 86  YVNYPALKVKFVEAQRQWVRFLDNECTAWYLINEAGADRNLDLLTCEIDRTRDRTRELNA 145

Query: 116 YLT 118
           +L 
Sbjct: 146 WLK 148


>gi|152983582|ref|YP_001349609.1| hypothetical protein PSPA7_4255 [Pseudomonas aeruginosa PA7]
 gi|150958740|gb|ABR80765.1| hypothetical protein PSPA7_4255 [Pseudomonas aeruginosa PA7]
          Length = 111

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 32/110 (29%), Gaps = 15/110 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
             A  ++A    + + +C +     +   C   +      ++   Y+ +        R  
Sbjct: 8   ALAGILLAPLAHAASFDCEKATRADEKAICANRALNDQDVEMSVKYRFLRGLFAMGGRGA 67

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +  Q AW   R   C         G         CL     +R  +L+ 
Sbjct: 68  MQDRQQAWLQERRR-C--------GG------DTGCLSRAYAQRIGELDK 102


>gi|323174606|gb|EFZ60227.1| hypothetical protein ECLT68_0768 [Escherichia coli LT-68]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECKLILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|262274700|ref|ZP_06052511.1| hypothetical protein VHA_001682 [Grimontia hollisae CIP 101886]
 gi|262221263|gb|EEY72577.1| hypothetical protein VHA_001682 [Grimontia hollisae CIP 101886]
          Length = 139

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 50/132 (37%), Gaps = 15/132 (11%)

Query: 1   MCR----KIIFALTIIAIAF--QSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKK 53
           MC+     I+  L + A A    S  + C +      ++  C  N + + ++ L  T   
Sbjct: 1   MCKSWWGCILLGLPLTAFAGKEHSALMACYKASETHVEVTACLDNRWNVSQDALNKTEAA 60

Query: 54  VLEK------VEKHQRELFEKSQ--MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           + E       +   Q  +   +Q   A+  +R ++C    +    G+     Y NC+   
Sbjct: 61  LREHFIKLDALSSLQHGVPVAAQTFSAFRNWREAQCKMVEASYASGSGSGQGYLNCMIEI 120

Query: 106 AIERNEKLESYL 117
             E+  +L S +
Sbjct: 121 TNEQIARLNSLM 132


>gi|293603871|ref|ZP_06686286.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
 gi|292817708|gb|EFF76774.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
          Length = 276

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 25/74 (33%), Gaps = 1/74 (1%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          +  L+++  +  + A+ C++     +   C          +L   Y  +L+       + 
Sbjct: 11 MLLLSLVVASAPAFAIQCSKAASAVEKLICADKQTVAADTQLNRAYNAILKAAPDVDIQA 70

Query: 66 -FEKSQMAWEIYRG 78
              SQ  W   R 
Sbjct: 71 MLVASQKRWIEARD 84


>gi|333004492|gb|EGK24021.1| hypothetical protein SFK272_2516 [Shigella flexneri K-272]
 gi|333017866|gb|EGK37172.1| hypothetical protein SFK227_2240 [Shigella flexneri K-227]
          Length = 162

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDTSAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLE-----------KVEKHQRELFEKSQMAWEIYRGSECAFAAS----GA 88
             +L   Y +              K++  Q  L +KSQ AW  +R  EC    S      
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKECELILSNEVVQD 120

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|327394306|dbj|BAK11728.1| hypothetical protein PAJ_1648 [Pantoea ananatis AJ13355]
          Length = 268

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 46/127 (36%), Gaps = 17/127 (13%)

Query: 5   IIFALTIIAIAFQSMALN---------------C-NETLMQADMN-QCTGNSFALVKEKL 47
           +IF+L++  I+  S A                 C +++    +    C  N       +L
Sbjct: 29  LIFSLSVFLISSTSKANEKNHVTLNDEGRIFLVCLSKSSATNEKLSNCYRNEIKRQDARL 88

Query: 48  EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
              Y+  L    +  R+ + ++Q  W  YR + C    + A    A+ +    C     I
Sbjct: 89  NQNYQHFLATRREDARQRYVEAQRQWVKYRDTNCNAQIANAANEDAELIAGDRCYLKMTI 148

Query: 108 ERNEKLE 114
            R ++L 
Sbjct: 149 NRADELA 155


>gi|91223897|ref|ZP_01259161.1| hypothetical protein V12G01_19172 [Vibrio alginolyticus 12G01]
 gi|91191389|gb|EAS77654.1| hypothetical protein V12G01_19172 [Vibrio alginolyticus 12G01]
          Length = 138

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 46/130 (35%), Gaps = 15/130 (11%)

Query: 1   MCRKIIFALT--IIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           + + ++      +  +A   +   C  +        QC         ++L  +YK+ + +
Sbjct: 5   LNKLLMIFALVSLPCLASDDVEDPCKVKGGGVMAGYQCVEKKMESADKELNESYKEAIAR 64

Query: 58  VEKHQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           + + ++ L            F K+Q AW  YR +EC F    +     Q +    C    
Sbjct: 65  IGEEEKALRETWSQTELVEPFRKAQRAWLKYRDAECEFTGLSSTPSPWQGVQIEECKLRM 124

Query: 106 AIERNEKLES 115
            +ER E    
Sbjct: 125 TLERVEYFNG 134


>gi|253690384|ref|YP_003019574.1| hypothetical protein PC1_4023 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756962|gb|ACT15038.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 266

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 40/123 (32%), Gaps = 26/123 (21%)

Query: 5   IIFALTIIAIA----FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           II A ++   A     Q+ +  C++   + +   C       + E+L   +K     +  
Sbjct: 7   IIIAASVTLAAFNDNAQAASFPCDKATSEQEKLICASPLLGQLDEELAQAWKTSRAFLTA 66

Query: 59  ---EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                   +   + Q +W   R  +C                  +CL+    ++  +L  
Sbjct: 67  YSNSTPWEKTLNQFQRSWLTTRD-QCKDE---------------DCLRQRYQQQLNRLR- 109

Query: 116 YLT 118
           YL 
Sbjct: 110 YLN 112


>gi|323937135|gb|EGB33415.1| hypothetical protein ERCG_01703 [Escherichia coli E1520]
          Length = 176

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 51/160 (31%), Gaps = 33/160 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
                    + +C+      R  +L+ Y    +  L  PF
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSEDF-LSKPF 159


>gi|320641731|gb|EFX11119.1| hypothetical protein ECO5101_14754 [Escherichia coli O157:H7 str.
           G5101]
          Length = 162

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 49/153 (32%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNC--NETLMQADMNQ---CTGNSFALV 43
           M + ++  L II+    +               +C    +    D+N    C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSGDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECDLILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSNPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|288957058|ref|YP_003447399.1| hypothetical protein AZL_002170 [Azospirillum sp. B510]
 gi|288909366|dbj|BAI70855.1| hypothetical protein AZL_002170 [Azospirillum sp. B510]
          Length = 497

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 32/84 (38%), Gaps = 2/84 (2%)

Query: 5  IIFALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          ++ A  + A   ++  + +C       +   C         +++  +YK + +      R
Sbjct: 11 MMVAGIVGAGTARAEPSFDCKAASTPVEKAICADPKLGDADKEIADSYKALQDLSGAADR 70

Query: 64 ELFEKSQMAWEIYRGSECAFAASG 87
          +     Q AW   R  +CA A+S 
Sbjct: 71 DRLRAEQRAWLGQRN-QCATASSP 93


>gi|256028082|ref|ZP_05441916.1| hypothetical protein PrD11_08834 [Fusobacterium sp. D11]
 gi|289766026|ref|ZP_06525404.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|289717581|gb|EFD81593.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 141

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTIIA--IAFQSMALNCN----------ETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    AF S +   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKNKLEKEQKVWLKNRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAIELAK 132


>gi|300311756|ref|YP_003775848.1| lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300074541|gb|ADJ63940.1| lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 265

 Score = 64.4 bits (155), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 37/109 (33%), Gaps = 18/109 (16%)

Query: 6   IFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
             AL+ +A  + ++ + +C +     +   C     + + ++L A +++        +  
Sbjct: 13  FTALSALAWHSTRAASFDCAKAGSSNEKMICADAQLSALDDRLGALFRQARASASDKRAL 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q  W  +R   C                  +CL      R+ +L
Sbjct: 73  RADADQ-HW-RWREQHCHDR---------------SCLLAWYQRRSIEL 104


>gi|170019778|ref|YP_001724732.1| hypothetical protein EcolC_1755 [Escherichia coli ATCC 8739]
 gi|169754706|gb|ACA77405.1| protein of unknown function DUF1311 [Escherichia coli ATCC 8739]
          Length = 162

 Score = 64.4 bits (155), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 47/153 (30%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAAS----GA 88
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S      
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQN 120

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|194434118|ref|ZP_03066387.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|293415192|ref|ZP_06657835.1| yecT protein [Escherichia coli B185]
 gi|331653287|ref|ZP_08354292.1| conserved hypothetical protein [Escherichia coli M718]
 gi|194417662|gb|EDX33762.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|291432840|gb|EFF05819.1| yecT protein [Escherichia coli B185]
 gi|323968299|gb|EGB63706.1| hypothetical protein ERJG_00330 [Escherichia coli M863]
 gi|327253006|gb|EGE64660.1| hypothetical protein ECSTEC7V_2251 [Escherichia coli STEC_7v]
 gi|331049385|gb|EGI21457.1| conserved hypothetical protein [Escherichia coli M718]
 gi|332095164|gb|EGJ00195.1| hypothetical protein SD15574_1564 [Shigella dysenteriae 155-74]
          Length = 162

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|309780362|ref|ZP_07675113.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308921065|gb|EFP66711.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 153

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
                A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A  
Sbjct: 58  RGETTAGMTECTHAAYQAYDRQMNTLYQAVMSKTDPVSREAIRNAQRAWLAYRTAQKAAD 117

Query: 85  ASGA--EEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    + G+  S             R  +LE Y
Sbjct: 118 NAPWRADAGSVASPDIEGLNVEAIRARIAELEYY 151


>gi|304396926|ref|ZP_07378806.1| protein of unknown function DUF1311 [Pantoea sp. aB]
 gi|304355722|gb|EFM20089.1| protein of unknown function DUF1311 [Pantoea sp. aB]
          Length = 136

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 46/125 (36%), Gaps = 9/125 (7%)

Query: 1   MCRKIIFALTIIAIAFQS------MALN-C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M   +   L  ++ +  +       + + C N       MNQC   +  +  + +   Y 
Sbjct: 1   MKPGLFLMLICLSTSALAEDIPSDASPDRCLNNASTTLAMNQCYAAASKVWDQAMNKQYN 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
           K+++ +    +     +Q AW  YR S    + S  + +GT  S+  +         +  
Sbjct: 61  KLMKTLSGEPKNKLRAAQRAWLSYRDSWLEASRSQLSSQGTLGSVALSAQSLSLVRNQAL 120

Query: 112 KLESY 116
            L+S 
Sbjct: 121 MLQSL 125


>gi|332096735|gb|EGJ01726.1| hypothetical protein SB359474_1240 [Shigella boydii 3594-74]
          Length = 162

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALV 43
           M + ++  L II+    +               +C +     D +      C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDIEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|15802289|ref|NP_288314.1| hypothetical protein Z2930 [Escherichia coli O157:H7 EDL933]
 gi|15831841|ref|NP_310614.1| hypothetical protein ECs2587 [Escherichia coli O157:H7 str. Sakai]
 gi|168747907|ref|ZP_02772929.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757914|ref|ZP_02782921.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762326|ref|ZP_02787333.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770863|ref|ZP_02795870.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776573|ref|ZP_02801580.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783180|ref|ZP_02808187.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789745|ref|ZP_02814752.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168801884|ref|ZP_02826891.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|195939581|ref|ZP_03084963.1| hypothetical protein EscherichcoliO157_24757 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810273|ref|ZP_03252149.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816649|ref|ZP_03257769.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819466|ref|ZP_03259786.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209401004|ref|YP_002270961.1| hypothetical protein ECH74115_2614 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328998|ref|ZP_03445079.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793501|ref|YP_003078338.1| hypothetical protein ECSP_2451 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227622|ref|ZP_05941903.1| hypothetical protein EscherichiacoliO157_23931 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258212|ref|ZP_05950745.1| hypothetical protein EscherichiacoliO157EcO_20667 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291283059|ref|YP_003499877.1| hypothetical protein G2583_2329 [Escherichia coli O55:H7 str.
           CB9615]
 gi|12515939|gb|AAG56867.1|AE005410_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13362055|dbj|BAB36010.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187768101|gb|EDU31945.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017438|gb|EDU55560.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999490|gb|EDU68476.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355174|gb|EDU73593.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360261|gb|EDU78680.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367389|gb|EDU85805.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370703|gb|EDU89119.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189376033|gb|EDU94449.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|208724789|gb|EDZ74496.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730992|gb|EDZ79681.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739589|gb|EDZ87271.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162404|gb|ACI39837.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209748410|gb|ACI72512.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|209748412|gb|ACI72513.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|209748414|gb|ACI72514.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|217318345|gb|EEC26772.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592901|gb|ACT72262.1| predicted protein [Escherichia coli O157:H7 str. TW14359]
 gi|290762932|gb|ADD56893.1| hypothetical protein G2583_2329 [Escherichia coli O55:H7 str.
           CB9615]
 gi|320188576|gb|EFW63238.1| hypothetical protein ECoD_05075 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320647091|gb|EFX15924.1| hypothetical protein ECO9389_19250 [Escherichia coli O157:H- str.
           493-89]
 gi|320657975|gb|EFX25737.1| hypothetical protein ECO7815_20135 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658548|gb|EFX26242.1| hypothetical protein ECO5905_21855 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668446|gb|EFX35273.1| hypothetical protein ECOSU61_18979 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326342255|gb|EGD66036.1| hypothetical protein ECoA_03325 [Escherichia coli O157:H7 str.
           1044]
 gi|326343805|gb|EGD67567.1| hypothetical protein ECF_02239 [Escherichia coli O157:H7 str. 1125]
          Length = 162

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 49/153 (32%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNC--NETLMQADMNQ---CTGNSFALV 43
           M + ++  L II+    +               +C    +    D+N    C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSGDDTDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSNPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|254523720|ref|ZP_05135775.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219721311|gb|EED39836.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 141

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 47/137 (34%), Gaps = 19/137 (13%)

Query: 1   MCRKIIFALTIIAIAF--------QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
           M  +++ +L + A            +  ++C       + + C  +  A    +L A Y 
Sbjct: 3   MLPRVLASLALCASLCGVAHAGDRSAEGIDCAHPTTTMESDLCASDVAAAADAELNAVYA 62

Query: 53  KVLEKVEK-----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
              +++                +    +Q AW   R  +C    +   +GTA++     C
Sbjct: 63  LARQQLRTPAKGGGCSYCGDAEQQLVLAQRAWMQLRDHDCNAVYALNSDGTARNGAQMRC 122

Query: 102 LQGHAIERNEKLESYLT 118
           L   A +R  +L  +  
Sbjct: 123 LITLARDRTRQLREFYE 139


>gi|49078032|gb|AAT49744.1| PA3021 [synthetic construct]
          Length = 129

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKTLLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|89108717|ref|AP_002497.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|90111353|ref|NP_416391.4| predicted protein [Escherichia coli str. K-12 substr. MG1655]
 gi|170081533|ref|YP_001730853.1| hypothetical protein ECDH10B_2018 [Escherichia coli str. K-12
           substr. DH10B]
 gi|193069891|ref|ZP_03050840.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194439080|ref|ZP_03071163.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|218695443|ref|YP_002403110.1| hypothetical protein EC55989_2056 [Escherichia coli 55989]
 gi|238901092|ref|YP_002926888.1| hypothetical protein BWG_1691 [Escherichia coli BW2952]
 gi|256017919|ref|ZP_05431784.1| hypothetical protein ShiD9_03312 [Shigella sp. D9]
 gi|256022458|ref|ZP_05436323.1| hypothetical protein E4_03724 [Escherichia sp. 4_1_40B]
 gi|300819861|ref|ZP_07100046.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300951500|ref|ZP_07165335.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300956610|ref|ZP_07168889.1| hypothetical protein HMPREF9547_02427 [Escherichia coli MS 175-1]
 gi|301029327|ref|ZP_07192424.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301645606|ref|ZP_07245535.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|307138542|ref|ZP_07497898.1| hypothetical protein EcolH7_10495 [Escherichia coli H736]
 gi|332278951|ref|ZP_08391364.1| conserved hypothetical protein [Shigella sp. D9]
 gi|3025153|sp|P76296|YECT_ECOLI RecName: Full=Uncharacterized protein yecT
 gi|85675156|dbj|BAE76549.1| hypothetical protein [Escherichia coli str. K12 substr. W3110]
 gi|87081997|gb|AAC74947.2| predicted protein [Escherichia coli str. K-12 substr. MG1655]
 gi|169889368|gb|ACB03075.1| predicted protein [Escherichia coli str. K-12 substr. DH10B]
 gi|192956791|gb|EDV87245.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194422039|gb|EDX38043.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|218352175|emb|CAU97914.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|238862993|gb|ACR64991.1| predicted protein [Escherichia coli BW2952]
 gi|260449000|gb|ACX39422.1| protein of unknown function DUF1311 [Escherichia coli DH1]
 gi|299877753|gb|EFI85964.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300316592|gb|EFJ66376.1| hypothetical protein HMPREF9547_02427 [Escherichia coli MS 175-1]
 gi|300449250|gb|EFK12870.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300527558|gb|EFK48620.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|301076138|gb|EFK90944.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|315136520|dbj|BAJ43679.1| hypothetical protein ECDH1ME8569_1823 [Escherichia coli DH1]
 gi|315617900|gb|EFU98498.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323940455|gb|EGB36646.1| hypothetical protein ERDG_02804 [Escherichia coli E482]
 gi|323972614|gb|EGB67817.1| hypothetical protein ERHG_01357 [Escherichia coli TA007]
 gi|332101303|gb|EGJ04649.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332343603|gb|AEE56937.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 162

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|302381119|ref|YP_003816942.1| hypothetical protein Bresu_0003 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302191747|gb|ADK99318.1| Uncharacterized protein putative lipoprotein-like protein
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 323

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 13/98 (13%), Positives = 28/98 (28%), Gaps = 16/98 (16%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C      A+   C     A +   +   Y ++   V+    ++    Q  W   R 
Sbjct: 241 PSFDCRRARNSAERTICADPGLADLDVAMARRYARMQNNVDGKAAQILRDEQREWLRRRD 300

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           + C                  +CL      R  +++  
Sbjct: 301 A-CETR---------------SCLALMYETRAARMDRM 322


>gi|253690494|ref|YP_003019684.1| hypothetical protein PC1_4134 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251757072|gb|ACT15148.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 309

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 37/116 (31%), Gaps = 21/116 (18%)

Query: 2   CRKIIFAL--TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R +  A+   +        A++C++    ++   C  +    +   L   Y+  +++ +
Sbjct: 1   MRYLSLAVSSLLCLFTSSVWAMDCSKASTDSEKMICASSRLQQLDAVLNKAYQGYVKQAD 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           K Q     + Q AW   R   C                   CL    + R + L  
Sbjct: 61  KAQA---RQEQRAWLAERDR-CQDDV---------------CLGNEMVSRIQALSG 97


>gi|317401349|gb|EFV81985.1| hypothetical protein HMPREF0005_01030 [Achromobacter xylosoxidans
           C54]
          Length = 282

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 31/102 (30%), Gaps = 2/102 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-FEKSQMAW 73
           +  + A++C++    A+   C+         +L   Y  +L++    Q       SQ  W
Sbjct: 20  SAPAWAIDCHKAGTPAEKLICSDRGAVAADAELNRAYAALLKQAPDAQIRAMLVDSQRRW 79

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R        S  E    +    A         R  + + 
Sbjct: 80  VEARNMRLEGLVSDPESLPDEKTPGAV-AADLIRSRASEFKE 120


>gi|158421959|ref|YP_001523251.1| hypothetical protein AZC_0335 [Azorhizobium caulinodans ORS 571]
 gi|158328848|dbj|BAF86333.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 236

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 10/69 (14%), Positives = 25/69 (36%)

Query: 14 IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           A    + +C     + +   C   + + +  ++ A Y+K+L  ++   R      Q  +
Sbjct: 25 AASDGPSFDCRAARSKIEKAICADPALSALDRRIAAAYQKLLAALDAPGRTALRMDQRTF 84

Query: 74 EIYRGSECA 82
             R  +  
Sbjct: 85 LEARDIQAR 93


>gi|91777730|ref|YP_552938.1| hypothetical protein Bxe_B2403 [Burkholderia xenovorans LB400]
 gi|91690390|gb|ABE33588.1| hypothetical protein Bxe_B2403 [Burkholderia xenovorans LB400]
          Length = 229

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 35/103 (33%), Gaps = 12/103 (11%)

Query: 23  CNE-TLMQADMNQCTGNSF----ALVKEKLEATYKKV-------LEKVEKHQRELFEKSQ 70
           C +      D++ C    F      +  K     K++           E       +K+Q
Sbjct: 121 CEKVASATIDLSVCAQFRFEGVAQELDRKFREIEKEIVIGDKDRRAIGEPEATPYLKKAQ 180

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             W+ YR ++C        + + + + + +C+      R  +L
Sbjct: 181 ANWKRYRDNQCYARTYEVGQASLRFVEFWDCMARVTRNRLNEL 223


>gi|289665238|ref|ZP_06486819.1| hypothetical protein XcampvN_19750 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 196

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             A  +  +   + +M   M  C    +A    +L   Y ++L+ +   +    ++ +  
Sbjct: 95  LSASYAQCVKNADAVMPVLM-DCNHQEYAYQDARLNKVYARLLKSLPAEKTASLKQEERD 153

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           W  +R + C    +    G A+ +  ++C      +R E+LE 
Sbjct: 154 WIKWRDTLCQSKGAL-GGGQAEELEDSSCELNATSKRAEELEK 195


>gi|332089610|gb|EGI94712.1| hypothetical protein SB521682_2192 [Shigella boydii 5216-82]
          Length = 162

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|311030934|ref|ZP_07709024.1| hypothetical protein Bm3-1_10376 [Bacillus sp. m3-13]
          Length = 200

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
            + + L  E L   Y  + E++   +     + Q  W  +R      A+   + GT + +
Sbjct: 118 NDRWELWDELLNEIYGVLEEQLSAEEMSQLREEQRNWIKFRDDSALEASHKFKGGTQEHL 177

Query: 97  IYANCLQGHAIERNEKL 113
            Y   L  H  ER  +L
Sbjct: 178 EYVAVLANHTEERCYEL 194


>gi|46093562|dbj|BAD14976.1| hypothetical protein [Escherichia coli]
          Length = 148

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/107 (14%), Positives = 41/107 (38%), Gaps = 2/107 (1%)

Query: 2   CRKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-EKVE 59
            +K +F L+++A +   + + +CN      +   C+ +  + + + L   YK  +   + 
Sbjct: 6   NKKSLFILSMMACSTSYAASFDCNTVASGVEKMICSDHKLSRLDDYLSQNYKIAMGPDMP 65

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           + ++   +K+Q+ W   R +                 ++  C     
Sbjct: 66  EEEKSKIKKAQIDWLNKRNACTDTQCIERIYSKQMDYLWNECFDHLT 112


>gi|237744098|ref|ZP_04574579.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229431327|gb|EEO41539.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 141

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTIIA--IAFQSMALNCN----------ETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    AF S +   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKNRLEKEQKVWLKNRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAIELAK 132


>gi|254490499|ref|ZP_05103685.1| hypothetical protein MDMS009_831 [Methylophaga thiooxidans DMS010]
 gi|224464243|gb|EEF80506.1| hypothetical protein MDMS009_831 [Methylophaga thiooxydans DMS010]
          Length = 92

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 32  MNQCTGNSFALVKEKL--EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           MNQC  +       +L       ++    +     + +K+Q AWE YR  +C       E
Sbjct: 1   MNQCLNHKLERAVNELENNLALTRLKFTDDPAMLAMIDKAQEAWEAYRKKQCQSVFLMWE 60

Query: 90  EGTAQSMIYANCLQGHAIERNEKLES 115
            G+ Q ++  +C    A ERN  L  
Sbjct: 61  GGSIQPLMTVSCSIQLARERNTFLRD 86


>gi|126727157|ref|ZP_01742994.1| hypothetical protein RB2150_00939 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703585|gb|EBA02681.1| hypothetical protein RB2150_00939 [Rhodobacterales bacterium
           HTCC2150]
          Length = 226

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 45/124 (36%), Gaps = 23/124 (18%)

Query: 2   CRKIIFAL-TIIAIAFQSMALN-------CNETLMQADMNQCTGNSFALVKEKLEATYKK 53
            R +   L T+I +A  + A         C+  L   +   C     A++   L  T+K 
Sbjct: 1   MRSLFLILGTLITVAHVNAAFAERILPRWCSNNLNSLERAICRTPELAVLDVTLGETFKV 60

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +L  + + Q +  +  Q  W  +R + C         GT        CL+     R  +L
Sbjct: 61  ILRGLPEEQSDALDDQQAVWRKWR-ATC---------GTD-----LICLKHRYTTRIIEL 105

Query: 114 ESYL 117
             YL
Sbjct: 106 AGYL 109


>gi|15598217|ref|NP_251711.1| hypothetical protein PA3021 [Pseudomonas aeruginosa PAO1]
 gi|9949124|gb|AAG06409.1|AE004727_5 hypothetical protein PA3021 [Pseudomonas aeruginosa PAO1]
          Length = 128

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKTLLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|227114362|ref|ZP_03828018.1| hypothetical protein PcarbP_15443 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 266

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/120 (13%), Positives = 32/120 (26%), Gaps = 24/120 (20%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
            A    +   Q+ + +CN+     +   C       + E+L   +K     +        
Sbjct: 13  VAFAAFSHHAQAASFSCNKADSVQEKLICASPLLGQLDEELAQAWKTSRTFLTAYDNSAP 72

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE---RNEKLESYLT 118
             +   + Q  W   R  +C                  +CL+    +   R   L     
Sbjct: 73  WEKTLNQFQRGWLTTRD-QCKDE---------------DCLRQRYQQQLNRLHYLNDIAQ 116


>gi|260494308|ref|ZP_05814439.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|260198454|gb|EEW95970.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
          Length = 141

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTIIA--IAFQSMALNCN----------ETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    AF S +   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKVEKIKLEKEQKTWLKSRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAVELAK 132


>gi|117918571|ref|YP_867763.1| hypothetical protein Shewana3_0113 [Shewanella sp. ANA-3]
 gi|117610903|gb|ABK46357.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 206

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 38/107 (35%), Gaps = 13/107 (12%)

Query: 10  TIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
           ++ A+A +  + +C +      +   C       + ++L   Y +  +K +  Q  + + 
Sbjct: 23  SVPAMAAEKPSFDCGKVQAGSIEELVCQDAGLTKLDQQLAEVYAQAADKAKNEQPPMLKA 82

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            Q  W   R  EC  +                C++     R  +L++
Sbjct: 83  MQRGWVKGRN-ECWKSEDK-----------RACVESSYQTRIAELQA 117


>gi|253773166|ref|YP_003035997.1| hypothetical protein ECBD_1761 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161937|ref|YP_003045045.1| hypothetical protein ECB_01848 [Escherichia coli B str. REL606]
 gi|297520009|ref|ZP_06938395.1| hypothetical protein EcolOP_20375 [Escherichia coli OP50]
 gi|300928910|ref|ZP_07144414.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|242377598|emb|CAQ32354.1| predicted protein [Escherichia coli BL21(DE3)]
 gi|253324210|gb|ACT28812.1| protein of unknown function DUF1311 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973838|gb|ACT39509.1| hypothetical protein ECB_01848 [Escherichia coli B str. REL606]
 gi|253978032|gb|ACT43702.1| hypothetical protein ECD_01848 [Escherichia coli BL21(DE3)]
 gi|300463064|gb|EFK26557.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|323961932|gb|EGB57531.1| hypothetical protein ERGG_01617 [Escherichia coli H489]
          Length = 162

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|167578993|ref|ZP_02371867.1| hypothetical protein BthaT_12685 [Burkholderia thailandensis TXDOH]
          Length = 275

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 12/109 (11%), Positives = 26/109 (23%), Gaps = 21/109 (19%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELF 66
              ++ + +C       +   C   +   +  ++ A Y+ +       +       R+  
Sbjct: 22  PFARAASFDCARAASAVERAICGTPALGELDVRMAAYYELLQNARPADEGIAYREFRDAL 81

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q  W       C                  +CL      R   L  
Sbjct: 82  RDEQQNWRQRVRDACGA--------------RIDCLTNAYTARIAALRG 116


>gi|146305153|ref|YP_001185618.1| hypothetical protein Pmen_0112 [Pseudomonas mendocina ymp]
 gi|145573354|gb|ABP82886.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 136

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 43/125 (34%), Gaps = 12/125 (9%)

Query: 2   CRKIIFALTIIAIA-FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--- 57
            +   F L     A   ++  +C        + QC   +     + L + Y+  L++   
Sbjct: 6   NKYSFFLLFFTFPALSDAIQKSCEVIEDSQQVAQCAEYAKGQSDKLLNSAYRAALDRIRH 65

Query: 58  -------VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIER 109
                  +      L   +Q  W   R ++C   A   EE   A  +   NCL   + +R
Sbjct: 66  QYRQAPLMADQYISLLRGAQREWIKLRDADCKLEAFEIEETAEAYQVTINNCLARMSNDR 125

Query: 110 NEKLE 114
            + L+
Sbjct: 126 ADYLK 130


>gi|238027246|ref|YP_002911477.1| hypothetical protein bglu_1g16330 [Burkholderia glumae BGR1]
 gi|237876440|gb|ACR28773.1| Hypothetical protein bglu_1g16330 [Burkholderia glumae BGR1]
          Length = 272

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 12/105 (11%), Positives = 26/105 (24%), Gaps = 17/105 (16%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--FEKSQ 70
           A      + +CN+     +   C       +   +   Y  ++    K          +Q
Sbjct: 164 APINAEQSFDCNKAATNVEHLICKNPDLIKLDATVNRGYVAMMLTNSKEISYQDPVRLNQ 223

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + W     + C                   CL     +R   ++ 
Sbjct: 224 INWIKTVRNSCGD---------------NACLMKAYNDRIAYIKG 253


>gi|288986961|ref|YP_003456924.1| Uncharacterized protein putative lipoprotein-like protein
           [Allochromatium vinosum DSM 180]
 gi|288898340|gb|ADC64174.1| Uncharacterized protein putative lipoprotein-like protein
           [Allochromatium vinosum DSM 180]
          Length = 201

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 35/115 (30%), Gaps = 20/115 (17%)

Query: 4   KIIFALTI---IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +I+ A  +   +       + +C++     +   C       +   L   Y+ V      
Sbjct: 8   RIVLATGLALQMLHTVAQPSFDCSKAATLVENAICQDPELGALDVVLAEQYQAVWRATSG 67

Query: 61  H-QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              R+  +KSQ  W   R  +C                   CL     ER E LE
Sbjct: 68  DSARQALKKSQRIWLAKRN-QCQDRP---------------CLVRAYRERLEALE 106


>gi|157161348|ref|YP_001458666.1| hypothetical protein EcHS_A1972 [Escherichia coli HS]
 gi|188495627|ref|ZP_03002897.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|300822349|ref|ZP_07102490.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|157067028|gb|ABV06283.1| conserved hypothetical protein [Escherichia coli HS]
 gi|188490826|gb|EDU65929.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|300525232|gb|EFK46301.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|309702100|emb|CBJ01415.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
          Length = 162

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|251791301|ref|YP_003006022.1| hypothetical protein Dd1591_3742 [Dickeya zeae Ech1591]
 gi|247539922|gb|ACT08543.1| hypothetical protein Dd1591_3742 [Dickeya zeae Ech1591]
          Length = 126

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 48/124 (38%), Gaps = 9/124 (7%)

Query: 2   CRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE- 59
            + ++F + +++ + Q+  + +C +  + A +  C         EK    Y   ++ +  
Sbjct: 1   MKVLVFFVLVLSFSSQANEIQSCYDKKVTAYIQSCMELLSHKEAEKYNIIYHDFIKNIHR 60

Query: 60  ------KHQRELFEKSQMAWEIYRGSECAFAASGA-EEGTAQSMIYANCLQGHAIERNEK 112
                        +++++ WE Y  SEC        ++  A S+ Y  C+     ER   
Sbjct: 61  DDLANYDDFIASIDEAKVFWEKYSVSECKAEGLLNIKDSPAYSIAYNECMVKAYKERVAF 120

Query: 113 LESY 116
            + Y
Sbjct: 121 YKKY 124


>gi|187923080|ref|YP_001894722.1| hypothetical protein Bphyt_1079 [Burkholderia phytofirmans PsJN]
 gi|187714274|gb|ACD15498.1| protein of unknown function DUF1311 [Burkholderia phytofirmans
           PsJN]
          Length = 167

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 38/100 (38%), Gaps = 11/100 (11%)

Query: 27  LMQADMNQCTGNSF-----------ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
              AD+  C+   +             +++  +    ++  +        FEK Q AW  
Sbjct: 65  ASTADIAACSQRDYEIIFAKLKSKIKSLEDGFKKDDAELKAEDNPIASPYFEKGQNAWIE 124

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +R ++C        E + + M + +C+     ER + L+S
Sbjct: 125 FRDNQCYAETYSLGEASMRYMTFWDCMARITRERLDDLDS 164


>gi|84501005|ref|ZP_00999240.1| hypothetical protein OB2597_02682 [Oceanicola batsensis HTCC2597]
 gi|84391072|gb|EAQ03490.1| hypothetical protein OB2597_02682 [Oceanicola batsensis HTCC2597]
          Length = 202

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 38/125 (30%), Gaps = 22/125 (17%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EKHQREL 65
              A +  A +C +    A+   C   + A +  +L   +   L          K   + 
Sbjct: 18  AGHAQEGPAFDCAKAESSAEKLVCDDPALAALDRRLADRFAAALSVTRGLDTGAKEVEDN 77

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL--ESYLTCPEG- 122
              +Q  W   R  EC                   C++   + R  +L  E  L    G 
Sbjct: 78  LRATQRGWIKGRD-ECWKDPDL-----------RACVEAEYLRREAELVAEFLLEEASGV 125

Query: 123 -DLLC 126
            DL+C
Sbjct: 126 RDLVC 130


>gi|312969920|ref|ZP_07784103.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|310338205|gb|EFQ03294.1| conserved hypothetical protein [Escherichia coli 1827-70]
          Length = 162

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 48/153 (31%), Gaps = 32/153 (20%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE--- 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +   
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDIQD 120

Query: 90  -EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                    + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|296504371|ref|YP_003666071.1| hypothetical protein BMB171_C3541 [Bacillus thuringiensis BMB171]
 gi|296325423|gb|ADH08351.1| hypothetical protein BMB171_C3541 [Bacillus thuringiensis BMB171]
          Length = 378

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 284 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAI 343

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 344 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 378


>gi|228960092|ref|ZP_04121756.1| hypothetical protein bthur0005_35630 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228799608|gb|EEM46561.1| hypothetical protein bthur0005_35630 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 393

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|228973893|ref|ZP_04134468.1| hypothetical protein bthur0003_36480 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228980483|ref|ZP_04140793.1| hypothetical protein bthur0002_36510 [Bacillus thuringiensis Bt407]
 gi|228779303|gb|EEM27560.1| hypothetical protein bthur0002_36510 [Bacillus thuringiensis Bt407]
 gi|228785759|gb|EEM33763.1| hypothetical protein bthur0003_36480 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|326941645|gb|AEA17541.1| hypothetical protein CT43_CH3876 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 393

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|229146447|ref|ZP_04274818.1| hypothetical protein bcere0012_35900 [Bacillus cereus BDRD-ST24]
 gi|228637080|gb|EEK93539.1| hypothetical protein bcere0012_35900 [Bacillus cereus BDRD-ST24]
          Length = 393

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|30021963|ref|NP_833594.1| hypothetical protein BC3874 [Bacillus cereus ATCC 14579]
 gi|229129152|ref|ZP_04258125.1| hypothetical protein bcere0015_35970 [Bacillus cereus BDRD-Cer4]
 gi|29897519|gb|AAP10795.1| hypothetical protein BC_3874 [Bacillus cereus ATCC 14579]
 gi|228654389|gb|EEL10254.1| hypothetical protein bcere0015_35970 [Bacillus cereus BDRD-Cer4]
          Length = 393

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|218529924|ref|YP_002420740.1| hypothetical protein Mchl_1949 [Methylobacterium chloromethanicum
           CM4]
 gi|218522227|gb|ACK82812.1| protein of unknown function DUF1311 [Methylobacterium
           chloromethanicum CM4]
          Length = 463

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 32/96 (33%), Gaps = 15/96 (15%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C      ++   C+ +S A +  +L   Y + ++ +    R     +Q  W   R 
Sbjct: 383 PSFSCARASTSSERTICSDSSLARLDRQLTVLYSRAVDNLSNSSRRALIVAQKQWIQERD 442

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            +C         G+        C+     +R   L 
Sbjct: 443 -QC---------GS-----SVGCIARAYTQRIGALR 463


>gi|207739046|ref|YP_002257439.1| hypothetical protein RSIPO_03742 [Ralstonia solanacearum IPO1609]
 gi|206592418|emb|CAQ59324.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 90

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 37/89 (41%), Gaps = 2/89 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSECAFAAS-GAE 89
           M  C    +     +L   Y + +EK ++     L  ++Q AW  YR + C +    G  
Sbjct: 1   MKICASYHWEKEDIRLNRLYARSMEKAKEMGFETLLVQAQRAWLTYRDAVCLYEGQIGTG 60

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLT 118
            G  + +   +C++    ER + L + L 
Sbjct: 61  GGAYEGLYMLSCMETLTKERADHLAADLR 89


>gi|186471119|ref|YP_001862437.1| lipoprotein [Burkholderia phymatum STM815]
 gi|184197428|gb|ACC75391.1| conserved hypothetical lipoprotein [Burkholderia phymatum STM815]
          Length = 296

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 32/116 (27%), Gaps = 17/116 (14%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +C+  +      + A     L+C++ +       C       +   L   Y + +     
Sbjct: 196 LCKPGLLESRYTSQASPMHGLDCSKLISVQARLICGDEELTRIDRTLAKIYAQKMNASS- 254

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +      Q AW       C   A               CL     +R ++L+  
Sbjct: 255 -NKSRLRADQRAWIRSSRDACDDKA---------------CLLRSYRQRIDELKRM 294


>gi|107102571|ref|ZP_01366489.1| hypothetical protein PaerPA_01003635 [Pseudomonas aeruginosa PACS2]
 gi|254235994|ref|ZP_04929317.1| hypothetical protein PACG_01950 [Pseudomonas aeruginosa C3719]
 gi|254241724|ref|ZP_04935046.1| hypothetical protein PA2G_02435 [Pseudomonas aeruginosa 2192]
 gi|126167925|gb|EAZ53436.1| hypothetical protein PACG_01950 [Pseudomonas aeruginosa C3719]
 gi|126195102|gb|EAZ59165.1| hypothetical protein PA2G_02435 [Pseudomonas aeruginosa 2192]
          Length = 128

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|116051022|ref|YP_790151.1| hypothetical protein PA14_24990 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313108313|ref|ZP_07794345.1| hypothetical protein PA39016_001330039 [Pseudomonas aeruginosa
           39016]
 gi|115586243|gb|ABJ12258.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310880847|gb|EFQ39441.1| hypothetical protein PA39016_001330039 [Pseudomonas aeruginosa
           39016]
          Length = 128

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|78061344|ref|YP_371252.1| hypothetical protein Bcep18194_B0494 [Burkholderia sp. 383]
 gi|77969229|gb|ABB10608.1| hypothetical protein Bcep18194_B0494 [Burkholderia sp. 383]
          Length = 132

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 41/128 (32%), Gaps = 5/128 (3%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R +  A   I       A++C +     +++  C  +      E+   + +  L++    
Sbjct: 6   RFLAVAALAIGHTTTFAAVDCEQHGPTMSNVWICILDQNNQAVERAYRSLEHKLKQRNPD 65

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                 KSQ +W  +    C +  +   +         +C    +  R   L+ +    E
Sbjct: 66  AASALAKSQASWTRFADDTCDYVKAANPQQMIPEDARMSCWVDFSQARVRILKKW----E 121

Query: 122 GDLLCPFI 129
             L  P  
Sbjct: 122 AQLDAPQP 129


>gi|209919303|ref|YP_002293387.1| hypothetical protein ECSE_2112 [Escherichia coli SE11]
 gi|293446264|ref|ZP_06662686.1| yecT protein [Escherichia coli B088]
 gi|209912562|dbj|BAG77636.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|291323094|gb|EFE62522.1| yecT protein [Escherichia coli B088]
          Length = 169

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 47/151 (31%), Gaps = 32/151 (21%)

Query: 3   RKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALVKE 45
           + ++  L II+    +               +C +     D +      C    + LV  
Sbjct: 10  KFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDA 69

Query: 46  KLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE----E 90
           +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +     
Sbjct: 70  QLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLS 129

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  + +C+      R  +L+ Y    +
Sbjct: 130 DPYSESEWLSCMIIQTNTRTRQLQLYHNSED 160


>gi|296327967|ref|ZP_06870502.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154923|gb|EFG95705.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 146

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 49/132 (37%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTIIA--IAFQSMALNCN----------------ETLMQADMNQCTGNSFALV 43
            +KI+F + I+    AF S +   +                ++ +  DM+          
Sbjct: 6   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKLQTKIDSGVSVDMSNIITELSEGW 65

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   E  Q  W   R  +    A   E GT Q ++    ++
Sbjct: 66  ENELNTVYSLLMEKLPKEEKIKLENEQKEWLKNRNIKAKKEAKQVEGGTLQPVLLEGSVR 125

Query: 104 GHAIERNEKLES 115
               ER  +L  
Sbjct: 126 AQNKERAIELAK 137


>gi|188991085|ref|YP_001903095.1| hypothetical protein xccb100_1689 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732845|emb|CAP51039.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 196

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A  +  +   + +M A M  C    +A    +L   Y ++L+ V   ++   ++ +  W 
Sbjct: 97  ASYAQCVKNADAVMPALM-DCNHQEYAYQDARLNKAYVRLLKSVPAEKKASLKQEERDWI 155

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +R + C    +    G A+ +  ++C      +R E+LE 
Sbjct: 156 KWRDTLCQSNGAL-GGGQAEELEDSSCELNATSKRAEELEK 195


>gi|168211487|ref|ZP_02637112.1| putative lipoprotein [Clostridium perfringens B str. ATCC 3626]
 gi|170710505|gb|EDT22687.1| putative lipoprotein [Clostridium perfringens B str. ATCC 3626]
          Length = 258

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 36/88 (40%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A   
Sbjct: 165 GSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKESNIAEIR 224

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              E G+   ++  + +   + ER   L
Sbjct: 225 KQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|284009131|emb|CBA76144.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 138

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 46/135 (34%), Gaps = 14/135 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLM--QADMNQCTGNSFALVKEKLEAT 50
           M +  I  +  I+    + ++N       C  +       D   C  N+  L   +L   
Sbjct: 1   MKKLTIVIMLFISKLVLADSINIDQTLEQCLAKPTTVSTLDSVDCYQNALKLWDNELNKQ 60

Query: 51  YKKVL--EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EGTAQSMIYANCLQGHA 106
           Y+ ++  +K+    +   +KSQ+AW  YR           +  +GT   +          
Sbjct: 61  YQLLIADKKLSSRFKTALKKSQLAWIKYRDLNLEAINRFYDTQQGTYWGIAAMANKIELT 120

Query: 107 IERNEKLESYLTCPE 121
             +  +L    T  E
Sbjct: 121 KNKALELTKLRTSTE 135


>gi|50123143|ref|YP_052310.1| hypothetical protein ECA4223 [Pectobacterium atrosepticum SCRI1043]
 gi|49613669|emb|CAG77120.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 266

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 34/117 (29%), Gaps = 22/117 (18%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
             L  +    Q+ +  C +     +   C       + ++L   +K     +        
Sbjct: 13  VTLASLCHPAQAASFPCEKAASVQEKLICASPLLGQLDKELAQAWKTSRTFLTAYDNSAP 72

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +   + Q +W   R  +C                  +CL+    ++  +L  YL 
Sbjct: 73  WEKTLNQFQRSWLTTRD-QCKDE---------------DCLRQRYQQQLNRLR-YLN 112


>gi|169346827|ref|ZP_02865775.1| putative lipoprotein [Clostridium perfringens C str. JGS1495]
 gi|169296886|gb|EDS79010.1| putative lipoprotein [Clostridium perfringens C str. JGS1495]
          Length = 253

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 36/88 (40%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A   
Sbjct: 160 GSTQMGMNIISGKQAKLYDAELNQIYDYLKQNLSKEKSKELEKSEMAWIKEKESNIAEIK 219

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              E G+   ++  + +   + ER   L
Sbjct: 220 KQYEGGSVTPLMVNSEVAKESKERCYYL 247


>gi|300923595|ref|ZP_07139624.1| hypothetical protein HMPREF9548_01788 [Escherichia coli MS 182-1]
 gi|300420112|gb|EFK03423.1| hypothetical protein HMPREF9548_01788 [Escherichia coli MS 182-1]
 gi|323971787|gb|EGB67013.1| hypothetical protein ERHG_02212 [Escherichia coli TA007]
          Length = 111

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 38/120 (31%), Gaps = 18/120 (15%)

Query: 2   CRKII---FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            + I+     +T+ A +  + + +C ++    +   C+ +S   +  +L   Y+ +    
Sbjct: 1   MKNILTAFLIITLPAFSATAASFDCRQSHSADEKAICSSHSLNDLDVELSVKYQFLHGLY 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                     SQ+ W   R   C                   CL+    +R + L     
Sbjct: 61  AMGAAGELHDSQVLWLAERRR-CGSDT--------------TCLRKAYKQRLKTLNHLYD 105


>gi|227325840|ref|ZP_03829864.1| hypothetical protein PcarcW_00385 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 266

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 34/117 (29%), Gaps = 22/117 (18%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
             L  +    Q+ +  C +     +   C       + E+L   +K     +        
Sbjct: 13  VTLASLCHTAQAASFPCEKAASAQEKLICASPLLGQLDEELAQAWKTSRASLTAYDNSAP 72

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +   + Q +W   R  +C                  +CL+    ++  +L  YL 
Sbjct: 73  WEKTLNQFQRSWLTTRD-QCKDE---------------DCLRQRYQQQLNRLR-YLN 112


>gi|190571988|ref|YP_001967713.1| hypothetical protein pCNB_p69 [Comamonas testosteroni CNB-1]
 gi|119943726|gb|ABM06240.1| hypothetical protein [Comamonas testosteroni CNB-1]
          Length = 274

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 39/114 (34%), Gaps = 4/114 (3%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           +++   ++ A+A  + A++C +     +   C+         +L   Y  +L++      
Sbjct: 9   RLLCLASLYALAAPAYAIDCAKAATAVEKLICSDRKTVAADAELNRAYAAILKQAPDGDI 68

Query: 64  EL-FEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIERNEKLES 115
                 SQ  W + R    A      + G+       A   +     R  +L+ 
Sbjct: 69  RAMLAHSQKRWIVARDG--ALMNLIEDPGSVPAGKTVAGVARDLIQSRTAQLKE 120


>gi|229071375|ref|ZP_04204597.1| hypothetical protein bcere0025_35470 [Bacillus cereus F65185]
 gi|228711666|gb|EEL63619.1| hypothetical protein bcere0025_35470 [Bacillus cereus F65185]
          Length = 393

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|229180152|ref|ZP_04307496.1| hypothetical protein bcere0005_34980 [Bacillus cereus 172560W]
 gi|228603361|gb|EEK60838.1| hypothetical protein bcere0005_34980 [Bacillus cereus 172560W]
          Length = 393

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|229192046|ref|ZP_04319015.1| hypothetical protein bcere0002_37020 [Bacillus cereus ATCC 10876]
 gi|228591372|gb|EEK49222.1| hypothetical protein bcere0002_37020 [Bacillus cereus ATCC 10876]
          Length = 393

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|293396526|ref|ZP_06640802.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291420790|gb|EFE94043.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 111

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/112 (13%), Positives = 33/112 (29%), Gaps = 15/112 (13%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
            ++ +  +     Q+ + +C +     +   C   S +    ++   Y+ +        R
Sbjct: 6   PLMLSTLLCVAGAQAASFDCRQATATDERAICASRSLSDKDVEMATKYQFLRGLFAMGMR 65

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              +  Q  W   R   C                  NCL      R  +L++
Sbjct: 66  GNMQDDQTRWLAQRNR-CGND--------------VNCLSNSYATRIAELDA 102


>gi|170750686|ref|YP_001756946.1| hypothetical protein Mrad2831_4296 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657208|gb|ACB26263.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 119

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 30/111 (27%), Gaps = 15/111 (13%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A  I A   ++ +  C+      +   C          ++   ++ +   +    +   
Sbjct: 16  VAGAITAPPARAASFPCDRAEAPDERAICAHLPLNDRDVEMATRFEILKSVLPMGGQAKL 75

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
              Q AW   R + C         G         CL      R + L   L
Sbjct: 76  RDDQEAWLTERQA-C--------GGDV------GCLTAAYDARLKVLRGVL 111


>gi|261823608|ref|YP_003261714.1| hypothetical protein Pecwa_4415 [Pectobacterium wasabiae WPP163]
 gi|261607621|gb|ACX90107.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 307

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 35/116 (30%), Gaps = 21/116 (18%)

Query: 2   CRKIIFAL--TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R +  A+   +        A++C++     +   C  +    +   L    +  ++K +
Sbjct: 1   MRYLSLAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNQANQGYVKKAD 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q     + Q  W + R   C                   CL+   I R + L  
Sbjct: 61  SAQV---RQEQHTWLVERDR-CKDDV---------------CLENEMISRIQALSG 97


>gi|331677762|ref|ZP_08378437.1| conserved hypothetical protein [Escherichia coli H591]
 gi|331074222|gb|EGI45542.1| conserved hypothetical protein [Escherichia coli H591]
          Length = 169

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 47/151 (31%), Gaps = 32/151 (21%)

Query: 3   RKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALVKE 45
           + ++  L II+    +               +C +     D +      C    + LV  
Sbjct: 10  KFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDA 69

Query: 46  KLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE----E 90
           +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +     
Sbjct: 70  QLNKAYGEAYLYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLS 129

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  + +C+      R  +L+ Y    +
Sbjct: 130 DPYSESEWLSCMIIQTNTRTRQLQLYHNSED 160


>gi|167580980|ref|ZP_02373854.1| hypothetical protein BthaT_22707 [Burkholderia thailandensis TXDOH]
          Length = 141

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 39/106 (36%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+    + + +    ++   E   
Sbjct: 32  LPASEVSALLADCD--SNQTSMNFCAWRDRIVAERELQQVVDRQVSE-HPDRKSALEAKI 88

Query: 71  MAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  AA     +G+ +      C      +  +KL +
Sbjct: 89  AKWKKARDASCEKAARKEWGDGSMRPTAQTVCQTESTKKMTKKLSA 134


>gi|83645783|ref|YP_434218.1| hypothetical protein HCH_03028 [Hahella chejuensis KCTC 2396]
 gi|83633826|gb|ABC29793.1| uncharacterized protein conserved in bacteria, putative lipoprotein
           [Hahella chejuensis KCTC 2396]
          Length = 236

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 35/111 (31%), Gaps = 18/111 (16%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +  L +      + + +C +     +   C  +  + + E+L A YK+     E    + 
Sbjct: 16  VAILALDGSVSAAASFDCAKASSSVEALICEDDQLSSLDERLAAAYKQAR---ESGFGKE 72

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            + SQ  W     + C  A                CL     +R + L   
Sbjct: 73  IKFSQTLWLNNSRNLCEDAE---------------CLLRVYDQRLDVLSKL 108


>gi|186470538|ref|YP_001861856.1| hypothetical protein Bphy_5742 [Burkholderia phymatum STM815]
 gi|184196847|gb|ACC74810.1| hypothetical protein Bphy_5742 [Burkholderia phymatum STM815]
          Length = 272

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/105 (13%), Positives = 25/105 (23%), Gaps = 17/105 (16%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--FEKSQ 70
           A      + +C +     +   C       +   +   Y  +L    K    L    + Q
Sbjct: 164 APTNAEQSFDCKKAHTNVEHLICNSTELVKLDATVNRGYVAMLLTDSKEISYLDPVRQDQ 223

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + W       C                   CL      R E ++ 
Sbjct: 224 INWIRKVRDACTD---------------NTCLLNAYRARVEYIKG 253


>gi|110798657|ref|YP_695444.1| putative lipoprotein [Clostridium perfringens ATCC 13124]
 gi|110673304|gb|ABG82291.1| putative lipoprotein [Clostridium perfringens ATCC 13124]
          Length = 258

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 36/88 (40%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A   
Sbjct: 165 GSTQMGMNIISGKQAKLYDAELNQIYDYLKQNLSKEKSKELEKSEMAWIKEKESNIAEIK 224

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              E G+   ++  + +   + ER   L
Sbjct: 225 KQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|228922630|ref|ZP_04085930.1| hypothetical protein bthur0011_36150 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228837059|gb|EEM82400.1| hypothetical protein bthur0011_36150 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 393

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 31/95 (32%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NAMSTNDIVNEIEGNYELWDNKLNEIYSTLKSMMSADAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|152984279|ref|YP_001347509.1| hypothetical protein PSPA7_2137 [Pseudomonas aeruginosa PA7]
 gi|150959437|gb|ABR81462.1| hypothetical protein PSPA7_2137 [Pseudomonas aeruginosa PA7]
          Length = 128

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGSLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATQKTRQRLDFLRE 113


>gi|238695143|ref|YP_002922337.1| hypothetical protein EpJSE_00265 [Enterobacteria phage JSE]
 gi|220029279|gb|ACL78214.1| hypothetical protein EpJSE_00265 [Enterobacteria phage JSE]
          Length = 272

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 32/81 (39%), Gaps = 8/81 (9%)

Query: 2  CRKIIFALTIIAIA--FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + II A+ + A A    + + +C +   +++   C   S + +  KL   Y K ++   
Sbjct: 1  MKNIIAAIVLSATAFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAVKIDP 60

Query: 60 KHQRELFEKSQMAWEIY-RGS 79
                 ++ Q  W    R +
Sbjct: 61 S-----LKQEQRNWNKTVRDT 76


>gi|186472541|ref|YP_001859883.1| hypothetical protein Bphy_3702 [Burkholderia phymatum STM815]
 gi|184194873|gb|ACC72837.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 206

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 40/119 (33%), Gaps = 18/119 (15%)

Query: 1   MCRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + R ++ AL ++A  +  + + NC      A+   C     +   ++L   ++  L++  
Sbjct: 3   LNRTMLAALGLLAMSSAHATSFNCAIAHSTAETLICHDAGLSKADDELGKLFRLALKQTA 62

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             +      S   W  +R   C   A               CL      R  ++  +L 
Sbjct: 63  DRRAYR-RDSDSKW-TWREENCKDVA---------------CLTDWYSTRIGEIREHLR 104


>gi|33620676|ref|NP_891833.1| hypothetical protein RB49p262 [Enterobacteria phage RB49]
 gi|33348143|gb|AAQ15486.1| hypothetical protein RB49ORF260c [Enterobacteria phage RB49]
          Length = 252

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 32/81 (39%), Gaps = 8/81 (9%)

Query: 2  CRKIIFALTIIAIA--FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + II A+ + A A    + + +C +   +++   C   S + +  KL   Y K ++   
Sbjct: 1  MKNIIAAIVLSATAFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAVKIDP 60

Query: 60 KHQRELFEKSQMAWEIY-RGS 79
                 ++ Q  W    R +
Sbjct: 61 S-----LKQEQRNWNKTVRDT 76


>gi|56707875|ref|YP_169771.1| hypothetical protein FTT_0761c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89256654|ref|YP_514016.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110670346|ref|YP_666903.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301717|ref|YP_001121685.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156502797|ref|YP_001428862.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931535|ref|YP_001891519.1| hypothetical protein FTM_0776 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456954|ref|ZP_03665427.1| hypothetical protein FtultM_04221 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254874690|ref|ZP_05247400.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953407|ref|ZP_06558028.1| hypothetical protein FtulhU_03393 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313368|ref|ZP_06803977.1| hypothetical protein FtulhU_03383 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|56604367|emb|CAG45394.1| hypothetical protein [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|89144485|emb|CAJ79792.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320679|emb|CAL08777.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049494|gb|ABO46565.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156253400|gb|ABU61906.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187712444|gb|ACD30741.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840689|gb|EET19125.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 97

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 42/114 (36%), Gaps = 18/114 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL             
Sbjct: 1   MKKLIIMTLTILPTLVAADKV-CD--GNTYEINACLKSQMQIYDTKLNDVQN-------- 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       ++ YR + C   +S  + GT Q++ Y NC+        ++L+
Sbjct: 50  -------HDIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 96


>gi|85703225|ref|ZP_01034329.1| hypothetical protein ROS217_20827 [Roseovarius sp. 217]
 gi|85672153|gb|EAQ27010.1| hypothetical protein ROS217_20827 [Roseovarius sp. 217]
          Length = 146

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 40/105 (38%), Gaps = 6/105 (5%)

Query: 18  SMALNCN---ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE---LFEKSQM 71
           + A  C             +C     A+  + + A Y   +E +++ +R        +Q 
Sbjct: 38  AAARMCQAQPGGDTTLGTTECLMAETAVWTDLMHAAYAAQVEALDEGERNLEAQLAVAQD 97

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           AW  YR +EC        +G+ +++I A C       R  +L S 
Sbjct: 98  AWNAYREAECGLRYGYWIDGSIRTIIAAACHLEKTAARTRELRSL 142


>gi|330812255|ref|YP_004356717.1| hypothetical protein PSEBR_a5229 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380363|gb|AEA71713.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 133

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + +  AL +I+    +        C+E         C+       ++ L    + + E+
Sbjct: 1   MKSLFLALALISTVAHATEDTEPNPCDEVENDVQTLACSVYGKTAAEQLLGENLQSLFER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           ++                 + +Q  W+  R ++CA AA  A+ G+ A  +   +C+   +
Sbjct: 61  LQTRYASDKAQLNDITTKVKTAQQLWQKQRDADCAIAAFPAKPGSEAYKIAENDCMAQVS 120

Query: 107 IERNEKLES 115
            +R+E LES
Sbjct: 121 DDRSEFLES 129


>gi|168216184|ref|ZP_02641809.1| putative lipoprotein [Clostridium perfringens NCTC 8239]
 gi|182381795|gb|EDT79274.1| putative lipoprotein [Clostridium perfringens NCTC 8239]
          Length = 258

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 36/88 (40%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A   
Sbjct: 165 GSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKESNIAEIR 224

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              E G+   ++  + +   + ER   L
Sbjct: 225 KQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|146307165|ref|YP_001187630.1| hypothetical protein Pmen_2138 [Pseudomonas mendocina ymp]
 gi|145575366|gb|ABP84898.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 129

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 49/127 (38%), Gaps = 17/127 (13%)

Query: 7   FALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            +L  + +   +         L+ +  +  A +  C        K+++   Y+++  K++
Sbjct: 10  LSLVFLPLTAWADYDMQYQACLDASGAINNASVAGCAEGVSEAAKKEMNRVYQQLFLKLQ 69

Query: 60  ---KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                  +  E +Q AW IYR S+C             S +Y  C     I+R E+L+  
Sbjct: 70  EGAPQDAQQLEATQKAWLIYRNSQCDLQGKH-----VGSPMYYTCPMQLNIQRVEELKFL 124

Query: 117 LTCPEGD 123
           L    GD
Sbjct: 125 L--ENGD 129


>gi|323937522|gb|EGB33792.1| hypothetical protein ERCG_01273 [Escherichia coli E1520]
          Length = 256

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 43/123 (34%), Gaps = 21/123 (17%)

Query: 2   CRKIIFALTIIAIA--FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            + II A+ + A A    + + +C +   +++   C   S + +  KL   Y K ++   
Sbjct: 1   MKNIIAAIMLSATAFGADAASFDCTKATTKSEKFICANESISALDSKLHEVYVKAVKINP 60

Query: 60  KHQRELFEKSQMAWEIY-RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  ++ Q  W    R              T  ++     L+     + + L + L+
Sbjct: 61  S-----LKQEQRNWNKTVRD-------------TMINIGQIQPLEAVYNAQIQNLMNVLS 102

Query: 119 CPE 121
             E
Sbjct: 103 KEE 105


>gi|168212418|ref|ZP_02638043.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
 gi|170715914|gb|EDT28096.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
          Length = 258

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 39/94 (41%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             + N    QA MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S
Sbjct: 159 EYDSNRGSTQAGMNGISGEQAKLYDNELNQIYDYLKQNLSKEKAKELEKSEMAWIKEKES 218

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             A      E G+   ++  + +   + ER   L
Sbjct: 219 NIAEIRKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|170725337|ref|YP_001759363.1| hypothetical protein Swoo_0975 [Shewanella woodyi ATCC 51908]
 gi|169810684|gb|ACA85268.1| hypothetical protein Swoo_0975 [Shewanella woodyi ATCC 51908]
          Length = 137

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 8/133 (6%)

Query: 1   MCR---KIIFALTIIAIAFQSMALNCNET-LMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M +    +IF + +     Q   + C+E     ++M QC   +    ++++ A    +  
Sbjct: 1   MKKYLAPLIFLMFVNMAYGQQTFIGCDELWQTMSEMVQCQMKANQAKEQEISALINTIQS 60

Query: 57  KVE-KHQRELFEKSQMAWEIYRGSECAFAA-SGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             + K +     KSQ  W  Y  SEC     SGA  GT+ +  Y  C       R ++L+
Sbjct: 61  SFKVKKRSLSVLKSQEHWVNYVESECRSRMISGALSGTSNAARYHICRNEKLSSRLDELQ 120

Query: 115 SYLTCPEGDLLCP 127
            Y  C   D  CP
Sbjct: 121 KYHYCD--DNGCP 131


>gi|257126512|ref|YP_003164626.1| hypothetical protein Lebu_1768 [Leptotrichia buccalis C-1013-b]
 gi|257050451|gb|ACV39635.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 144

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/138 (13%), Positives = 39/138 (28%), Gaps = 23/138 (16%)

Query: 1   MCRKIIFALTIIAI--AFQSMALNCNE-------------TLMQADMNQCTGNSFALVKE 45
           M + +I   +++    +F     +                     +M +     F     
Sbjct: 1   MKKVMILVASLMVSVSSFSGYTSDMINRMEIKEKSVEDSFGGSNVEMKEAAVAIFKGWDN 60

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYR--------GSECAFAASGAEEGTAQSMI 97
           +L   YK ++ K+ K ++      + AW   +           C         GT   + 
Sbjct: 61  ELNKVYKLLMSKLSKKEQLKLRNEEKAWIKRKERAAEEAADRFCETVNGNKLCGTGYGLE 120

Query: 98  YANCLQGHAIERNEKLES 115
           Y   L     +R  +L  
Sbjct: 121 YTGSLINSTKDRAIELSK 138


>gi|238790028|ref|ZP_04633806.1| hypothetical protein yfred0001_19040 [Yersinia frederiksenii ATCC
           33641]
 gi|238721841|gb|EEQ13503.1| hypothetical protein yfred0001_19040 [Yersinia frederiksenii ATCC
           33641]
          Length = 307

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 39/111 (35%), Gaps = 19/111 (17%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++  L I   +    A++C++     + N C+ +    +   L   Y+     +++  + 
Sbjct: 6   LLLFLPISLFSNAIFAMDCSKATTVTEKNICSSSQLLQLDAVLNKDYQA---HIKQQDKV 62

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + ++ Q+AW   R   C                   CL    I R + L  
Sbjct: 63  VAKQQQLAWLKERDL-CQDDV---------------CLSNSMINRIKALSG 97


>gi|229031506|ref|ZP_04187506.1| hypothetical protein bcere0028_35600 [Bacillus cereus AH1271]
 gi|228729795|gb|EEL80775.1| hypothetical protein bcere0028_35600 [Bacillus cereus AH1271]
          Length = 272

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
                 D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 178 NVTSTNDIVNEIEGNYQLWDNKLNELYSTLKNTMSADAFQSLKTKQVAWIKEKESKVKAI 237

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           A+    GT + +  A+        R  +L   Y+ 
Sbjct: 238 ATDENNGTMKYIEAADEKYKMTKARCYELVNGYMN 272


>gi|183598735|ref|ZP_02960228.1| hypothetical protein PROSTU_02156 [Providencia stuartii ATCC
          25827]
 gi|188020932|gb|EDU58972.1| hypothetical protein PROSTU_02156 [Providencia stuartii ATCC
          25827]
          Length = 216

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/85 (11%), Positives = 24/85 (28%), Gaps = 2/85 (2%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M R  +F + +      + + +C +     +   C     +   ++L   Y +       
Sbjct: 1  MIRLFLFLIFVFPSITYAASFDCAKAQSNVEKLICNTPELSKADDELYVDYLQAKLVTGN 60

Query: 61 HQRELFEKSQMAWEIYRGSECAFAA 85
                   +  W   R   C   +
Sbjct: 61 SDEFK-RLVKKNW-ELRVKNCDTKS 83


>gi|156978311|ref|YP_001449217.1| hypothetical protein VIBHAR_07118 [Vibrio harveyi ATCC BAA-1116]
 gi|156529905|gb|ABU74990.1| hypothetical protein VIBHAR_07118 [Vibrio harveyi ATCC BAA-1116]
          Length = 197

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 36/112 (32%), Gaps = 14/112 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ- 62
           +  +      +  S + +CN      A+   C     + +  ++   YKK     +K   
Sbjct: 10  LTMSFFTAGASAASPSFDCNNDSLSGAEQAICQSEMLSQLDRQMSEVYKKAKAVDDKQAG 69

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +   +  Q+ W   R  EC  +                CL+     R  +L+
Sbjct: 70  QHALKAEQVGWIRGRN-ECWKSNDEE-----------QCLKQEYEYRIAELQ 109


>gi|310639420|ref|YP_003944179.1| hypothetical protein EIO_3074 [Ketogulonicigenium vulgare Y25]
 gi|308752996|gb|ADO44140.1| Conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 262

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 30/108 (27%), Gaps = 8/108 (7%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + + A      +C +     +   C     A     +   Y  ++E+     + L  
Sbjct: 54  ALVLPSFAAAQAGFDCAKAQTDTEFAICKDAKIAAADLAMTRAYTALMERAGAPLQSLLR 113

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q A+   R       +      +  +      L      R   L+ 
Sbjct: 114 ADQRAFLAQRT-----ESYDTAGTSDAAFER---LHFQTENRMSMLQR 153


>gi|73542596|ref|YP_297116.1| hypothetical protein Reut_A2912 [Ralstonia eutropha JMP134]
 gi|72120009|gb|AAZ62272.1| Protein of unknown function DUF1311 [Ralstonia eutropha JMP134]
          Length = 162

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 37/102 (36%), Gaps = 11/102 (10%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            C++     D   C    F    ++L A+Y ++   +    ++  + +Q+ W  YR + C
Sbjct: 58  ECDKYRTSYDKTYCFAKLFLESDKELNASYTELRGLIADGAKQKLKDTQLEWIKYRDASC 117

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCPEG 122
             + +          I  +C      +R E L      C  G
Sbjct: 118 ESSGA----------IDVDCNYRVNRDRAEYLRDRVRECKAG 149


>gi|21232505|ref|NP_638422.1| hypothetical protein XCC3075 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767411|ref|YP_242173.1| hypothetical protein XC_1083 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21114294|gb|AAM42346.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572743|gb|AAY48153.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 388

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 44/116 (37%), Gaps = 19/116 (16%)

Query: 1   MCRK-------IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKK 53
           M R+       +  A  + +    S + +C       +   C   +  L+ E+L+A+Y++
Sbjct: 1   MNRRAHALRVVLAGAALLASGGAWSASFDCARASTAVEQRLCAVKALGLLDERLDASYQE 60

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +L+   +       + Q AW   R + CA  A+             +CLQ     R
Sbjct: 61  LLQTTPRSAVAAVREQQRAWLRQRNA-CAQNATP-----------DDCLQRSLTAR 104


>gi|70730382|ref|YP_260123.1| hypothetical protein PFL_3017 [Pseudomonas fluorescens Pf-5]
 gi|68344681|gb|AAY92287.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 199

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 34/110 (30%), Gaps = 14/110 (12%)

Query: 6   IFALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
               T +A A Q  + NC+E +        C     A +  KL   Y+  L+     +  
Sbjct: 16  ALLATSLATAEQGPSFNCSEKMTGSITALICQNPGLAALDRKLATIYRDALKNA-GKRGN 74

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           + +  Q  W   R  EC                   C+      R  +L+
Sbjct: 75  VLKAEQRGWIKGRD-ECWKIDDQ-----------QACVADSYRRRIVELQ 112


>gi|153876624|ref|ZP_02003849.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152066912|gb|EDN66151.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 188

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 38/114 (33%), Gaps = 13/114 (11%)

Query: 1   MCRKIIFALTIIAIAF-QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   I   L  I  +   + + NC     + +   C      L  +++   Y+ + + + 
Sbjct: 1   MKFFIAILLIFINTSSLFAASFNCQIASKEIERMICNTPELNLADKQMGQAYRNLQKVLP 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           K +R +    Q  W   R  E             QS I  +C       R ++L
Sbjct: 61  KSERYILLNDQRGWLRERDIE------------LQSCIELDCELHFYNIRIQQL 102



 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 27/98 (27%), Gaps = 19/98 (19%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C++         C       V  ++   Y+ + +            +Q+ W   R 
Sbjct: 108 ASFDCSKATTPIKKMICRSRLLRHVDGRMVKLYQSLQDD--------LRDNQLKWLKERD 159

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            E +           Q      C+      R E L  Y
Sbjct: 160 LELS-----------QPYCDIECIWRLYKYRIEFLVRY 186


>gi|148547968|ref|YP_001268070.1| hypothetical protein Pput_2752 [Pseudomonas putida F1]
 gi|148512026|gb|ABQ78886.1| Uncharacterized protein putative lipoprotein [Pseudomonas putida
           F1]
          Length = 193

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 30/101 (29%), Gaps = 13/101 (12%)

Query: 16  FQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
            +  A NC +      +   C     + +  K+   Y    +K       + +  Q  W 
Sbjct: 18  AKGPAFNCTQVEAGSIEQQICQSERLSAMDRKMAEVYTAAQQKAANEHPPVLKTEQRGWV 77

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R  +C  +A               C+      R  +L++
Sbjct: 78  KGRN-DCWKSADQP-----------ACIADSYRLRIAELQA 106


>gi|229134684|ref|ZP_04263493.1| hypothetical protein bcere0014_35930 [Bacillus cereus BDRD-ST196]
 gi|228648730|gb|EEL04756.1| hypothetical protein bcere0014_35930 [Bacillus cereus BDRD-ST196]
          Length = 171

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 77  NVMSTNDIVNEIEGNYQLWDNKLNEIYSTLKNTMSADAFQSLKTKQIAWVKEKESKVTAI 136

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +        ER  +L   Y+ 
Sbjct: 137 GTDPNNGTMRRIEASEEKYKMTKERCYELVNGYMN 171


>gi|34497629|ref|NP_901844.1| hypothetical protein CV_2174 [Chromobacterium violaceum ATCC 12472]
 gi|34103485|gb|AAQ59847.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 128

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 38/124 (30%), Gaps = 10/124 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R ++  + + A A+     +C  +      +  C     A    +L A   K L+ + K
Sbjct: 3   LRPLLIGVLLAAPAWSGALEDCTRSQADTPAIAACLQQRHAEAGRQLAAQEDKALDAMRK 62

Query: 61  ---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                    H      +S+ A+  YR   C +  +    G         C      +R  
Sbjct: 63  LDGATDGRFHAARELRRSRQAYRDYRRQHCDWVEASYASGNGAGRARLACEIDLDTQRLA 122

Query: 112 KLES 115
            L  
Sbjct: 123 DLAG 126


>gi|168204972|ref|ZP_02630977.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
 gi|170663448|gb|EDT16131.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
          Length = 258

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 36/88 (40%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN  +G    L   +L   Y  + + + K + +  EK++MAW   + S  A   
Sbjct: 165 GSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKSKELEKNEMAWIKEKESNIAEIR 224

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              E G+   ++  + +   + ER   L
Sbjct: 225 KQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|239834854|ref|ZP_04683182.1| Conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239822917|gb|EEQ94486.1| Conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 225

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 33/110 (30%), Gaps = 7/110 (6%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +       + A      +C +   + +   C+    A     +  +YK +L++     RE
Sbjct: 14  LAAFAFCCSPANAQAGFDCKKASTETEKAICSDPEIAESDRGMTVSYKSLLDRAGTKLRE 73

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                Q A+   R           E   A   +    L  +   R E L 
Sbjct: 74  TLRADQAAFLKIR-------TEAFESSLANRDMRMQKLLDYTDMRAEFLN 116


>gi|291619059|ref|YP_003521801.1| Hypothetical Protein PANA_3506 [Pantoea ananatis LMG 20103]
 gi|291154089|gb|ADD78673.1| Hypothetical Protein PANA_3506 [Pantoea ananatis LMG 20103]
          Length = 145

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 47/127 (37%), Gaps = 9/127 (7%)

Query: 1   MCRKIIFALTIIAIAFQS--MALN-----C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M R  +  L +   A  +    ++     C N+      + QC   +     +++   Y 
Sbjct: 10  MKRGWVLLLLLSCNAAVAGQSTIDVTLNQCLNQADTTLALMQCQDAATQEWDKEMNTQYS 69

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
            +++K+    RE    +Q AW  YR +  A + S    +GT   +  A         +  
Sbjct: 70  ALMKKLSGQPREKLRAAQRAWMKYREAWLAASRSQLNTQGTLGPVALAAQSTALVRNQTL 129

Query: 112 KLESYLT 118
           +L+S   
Sbjct: 130 QLQSLAN 136


>gi|299069711|emb|CBJ40987.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 176

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 40/117 (34%), Gaps = 20/117 (17%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA--------- 72
           +C+  +  A++ +C     +  +++L A Y +VL  ++K   E                 
Sbjct: 27  DCDNPVTSAEVAECADREHSAAEQRLNAVYSQVLASLQKVDAEYLRSYPNHQPLRAAASL 86

Query: 73  ------WEIYRGSECAFA-----ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                 W  +R   C        +    +G   ++    C    +  R  +LE+  +
Sbjct: 87  AAAQRAWLTFRRQSCHVEELVALSGNPNQGDLSAIAVTTCESRLSSARTVELENLAS 143


>gi|310765204|gb|ADP10154.1| hypothetical protein EJP617_04730 [Erwinia sp. Ejp617]
          Length = 265

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 31/109 (28%), Gaps = 21/109 (19%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE------KHQRE 64
           + A    + + +C +   + +   C+    +     +   Y    + ++      K + E
Sbjct: 167 LPAKVTPTPSFDCKKATSKTEKAICSDYELSSWDRSVTLAYSISEQYIKGIGINVKKELE 226

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             + SQ  W   R S C                   C+      R   L
Sbjct: 227 ALKLSQRNWLKGRDS-CGDNT--------------QCISDKMQSRVSVL 260


>gi|157311562|ref|YP_001469605.1| hypothetical protein phi1p262 [Enterobacteria phage Phi1]
 gi|149380766|gb|ABR24771.1| hypothetical protein phi1p262 [Enterobacteria phage Phi1]
          Length = 266

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 31/81 (38%), Gaps = 8/81 (9%)

Query: 2  CRKIIFALTIIA--IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + II A+ + A      + + +C +   +++   C   S + +  KL   Y K ++   
Sbjct: 1  MKNIIAAIVLSATTFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAVKIDP 60

Query: 60 KHQRELFEKSQMAWEIY-RGS 79
                 ++ Q  W    R +
Sbjct: 61 S-----LKQEQRNWNKTVRDT 76


>gi|228987020|ref|ZP_04147145.1| hypothetical protein bthur0001_36940 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228772614|gb|EEM21055.1| hypothetical protein bthur0001_36940 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 393

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NVMSTNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +        ER  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIDASEEKYKMTKERCYELVNGYMN 393


>gi|229157453|ref|ZP_04285530.1| hypothetical protein bcere0010_36350 [Bacillus cereus ATCC 4342]
 gi|228625903|gb|EEK82653.1| hypothetical protein bcere0010_36350 [Bacillus cereus ATCC 4342]
          Length = 393

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NVMSTNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +        ER  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIDASEEKYKMTKERCYELVNGYMN 393


>gi|229197987|ref|ZP_04324701.1| hypothetical protein bcere0001_35220 [Bacillus cereus m1293]
 gi|228585466|gb|EEK43570.1| hypothetical protein bcere0001_35220 [Bacillus cereus m1293]
          Length = 393

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NVMSTNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +        ER  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIDASEEKYKMTKERCYELVNGYMN 393


>gi|83954438|ref|ZP_00963158.1| hypothetical protein NAS141_19069 [Sulfitobacter sp. NAS-14.1]
 gi|83841475|gb|EAP80645.1| hypothetical protein NAS141_19069 [Sulfitobacter sp. NAS-14.1]
          Length = 148

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 46/142 (32%), Gaps = 24/142 (16%)

Query: 1   MCRKIIFALTIIAIAFQS--------MALNCNETLM--------------QADMNQCTGN 38
           M + + F L +I     +        +   C                   Q + +     
Sbjct: 9   MLKYVFFWLLLIPAMATAEKVGPASELLPECTAPQTDPNAVHRCLFAMGDQVERD--MVR 66

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY 98
           ++   +  L A  +    K +     L + SQ+A+E YR   CAF       GTA   + 
Sbjct: 67  AYLDAQAALAAFDQAFSRKADASASALLQSSQIAFEEYRKYHCAFPERLMLGGTAAINVT 126

Query: 99  ANCLQGHAIERNEKLESYLTCP 120
             C       R E+L+ Y T  
Sbjct: 127 LGCRIDLTRSRIEQLQDYATAR 148


>gi|260429484|ref|ZP_05783461.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260420107|gb|EEX13360.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 211

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 43/131 (32%), Gaps = 20/131 (15%)

Query: 6   IFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVE 59
              +++IA+   ++A     +C      A+   C+ ++ A +  +L   +++      ++
Sbjct: 9   AAVISVIALMSPALALEPPFDCTRAESDAEKAVCSDDTLASMDLELSRLFQRAAEGPNMD 68

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLT 118
             +  + +  Q  W   R + C              +    C       R  ++   Y  
Sbjct: 69  PERHRMLQAEQRGWIKGRDA-CWK----------SDLGIPFCTASEYAFRIAEIRQGYAD 117

Query: 119 --CPEGDLLCP 127
                G  L P
Sbjct: 118 ARAENGASLGP 128


>gi|82543643|ref|YP_407590.1| hypothetical protein SBO_1123 [Shigella boydii Sb227]
 gi|81245054|gb|ABB65762.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 169

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 47/151 (31%), Gaps = 32/151 (21%)

Query: 3   RKIIFALTIIAIAFQS------------MALNCNETLMQADMNQ-----CTGNSFALVKE 45
           + ++  L II+    +               +C +     D +      C    + LV  
Sbjct: 10  KFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDA 69

Query: 46  KLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE----E 90
           +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +     
Sbjct: 70  QLNKAYGEAYRYIEQVPRTGVKKPDIEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLS 129

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  + +C+      R  +L+ Y    +
Sbjct: 130 DPYSESEWLSCMIIQTNTRTRQLQLYRNSED 160


>gi|209515942|ref|ZP_03264803.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209503600|gb|EEA03595.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 161

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 47/121 (38%), Gaps = 16/121 (13%)

Query: 14  IAFQSMAL-----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR----- 63
            +  S A      +  E    +D+ QC+   F     +L+ + +    K+E + +     
Sbjct: 40  FSGHSAADVARMCDTGEHASNSDLAQCSHRKFDHAARELDKSLQSAKSKIESNDKSLKEE 99

Query: 64  ------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                   F KSQ AW  YR +EC        E T + + +  C+     +R ++L+  L
Sbjct: 100 GEPLALPYFLKSQDAWTQYRDNECYTETYMMGEATERYIFFWECMANITQDRVKELQEVL 159

Query: 118 T 118
            
Sbjct: 160 K 160


>gi|21243336|ref|NP_642918.1| hypothetical protein XAC2605 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108880|gb|AAM37454.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 147

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           + +C    +A    +L A YK++L +    +++  ++ +  W  +R + C    +    G
Sbjct: 64  LMECNSQEYAYQDARLNAAYKRLLNRWPAEKKDRLKQEERDWIKWRDTLCKSNGAL-GGG 122

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
            A+ +   +C      +R E+LE 
Sbjct: 123 QAEELEDTSCNLNATAQRAEELEK 146


>gi|127514274|ref|YP_001095471.1| hypothetical protein Shew_3346 [Shewanella loihica PV-4]
 gi|126639569|gb|ABO25212.1| conserved hypothetical protein [Shewanella loihica PV-4]
          Length = 227

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 34/102 (33%), Gaps = 13/102 (12%)

Query: 15  AFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
                + +C ++ L   ++  C  +  A +  +L   Y+    K    Q  L +  Q  W
Sbjct: 50  TANQPSFDCGSDKLSSIEVLVCQDSELAALDRQLAEVYQAASAKAVNEQPPLLKAEQRGW 109

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R  EC  +               +C   +   R  +L++
Sbjct: 110 IKGRD-ECWKSDDK-----------HSCAFDNYQMRIAELQA 139


>gi|296388484|ref|ZP_06877959.1| hypothetical protein PaerPAb_10051 [Pseudomonas aeruginosa PAb1]
          Length = 128

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + + + Q+ L +KSQ+AW   R   C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNEGQKALLKKSQIAWIKERDEACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDN------GYFVNLDCATEKTRQRLDFLRE 113


>gi|254249136|ref|ZP_04942456.1| hypothetical protein BCPG_03996 [Burkholderia cenocepacia PC184]
 gi|124875637|gb|EAY65627.1| hypothetical protein BCPG_03996 [Burkholderia cenocepacia PC184]
          Length = 106

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 41/109 (37%), Gaps = 17/109 (15%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ---------RELFEKS 69
           MA  C     Q +           V ++L  TY+KVL+ + + +         +  F  +
Sbjct: 1   MAPECLLQRSQDE--------LQRVDDELNRTYQKVLKSLSRPRDEYVDYPALKVKFVAA 52

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           Q  W  +   EC+      E G  +++    C      +R  +L ++L 
Sbjct: 53  QRQWLRFIDDECSAWYLINEAGADRNLDLLTCEIDRTRDRTRELNAWLK 101


>gi|331642495|ref|ZP_08343630.1| conserved hypothetical protein [Escherichia coli H736]
 gi|331039293|gb|EGI11513.1| conserved hypothetical protein [Escherichia coli H736]
          Length = 169

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 47/151 (31%), Gaps = 32/151 (21%)

Query: 3   RKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALVKE 45
           + ++  L II+    +               +C +     D     +  C    + LV  
Sbjct: 10  KFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDA 69

Query: 46  KLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE----E 90
           +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +     
Sbjct: 70  QLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLS 129

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  + +C+      R  +L+ Y    +
Sbjct: 130 DPYSESEWLSCMIIQTNTRTRQLQLYRNSED 160


>gi|239623765|ref|ZP_04666796.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521796|gb|EEQ61662.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 297

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 33/93 (35%), Gaps = 2/93 (2%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 + + +L + Y  +LE + +         Q  W   R ++ A   +G   G+ + 
Sbjct: 196 AETELKMWEGELNSIYNALLELLPQEDAARLAAEQQEWLKTRETK-AAENTGKSGGSVER 254

Query: 96  MIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           + YA  L     +R  +L        G L  P 
Sbjct: 255 IGYAATLASLTRDRAYELAGRYEQANG-LPAPV 286


>gi|182624999|ref|ZP_02952777.1| putative lipoprotein [Clostridium perfringens D str. JGS1721]
 gi|177909796|gb|EDT72214.1| putative lipoprotein [Clostridium perfringens D str. JGS1721]
          Length = 258

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 39/94 (41%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             + N    QA MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S
Sbjct: 159 EYDSNRGSTQAGMNGISGEQAKLYDNELNKIYDYLKQNLSKEKAKELEKSEMAWIKEKES 218

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             A      E G+   ++  + +   + ER   L
Sbjct: 219 NIAEIKKQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|119386342|ref|YP_917397.1| hypothetical protein Pden_3634 [Paracoccus denitrificans PD1222]
 gi|119376937|gb|ABL71701.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 179

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 37/115 (32%), Gaps = 16/115 (13%)

Query: 18  SMALNC---NETLMQADMNQCTGNSFALVKEKLEATYKKVLEK-------------VEKH 61
           + A  C           M+ C GN   L   +L  TY++V+ +               + 
Sbjct: 60  AAADPCMDSQGGSTTVGMSACLGNELDLWDARLNETYREVMAQSEATDGNMAELGSAAEK 119

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +  L    Q  W  +R + C F  S    GT       +C       +   L+ Y
Sbjct: 120 ESPLLRDMQRNWIAFRDTACGFERSRWGGGTDGGPAGLHCALTLTARQYLWLDQY 174


>gi|325273160|ref|ZP_08139455.1| hypothetical protein G1E_09177 [Pseudomonas sp. TJI-51]
 gi|324101709|gb|EGB99260.1| hypothetical protein G1E_09177 [Pseudomonas sp. TJI-51]
          Length = 135

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

Query: 7   FALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ- 62
            AL  +    Q+       C+          C   +  + + +L++ Y ++  ++     
Sbjct: 4   LALLAVVSGAQASEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELAARMRDQFG 63

Query: 63  -----RELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESY 116
                    E ++  W   R ++C       + G+ A    + +C+   + ER E L S 
Sbjct: 64  DEAGLMSRIEAAEQLWRQLRDADCKVETHAEQPGSKAYQTAWNSCIAQRSDERAEYLRS- 122

Query: 117 LTCPEGDLLCP 127
           L   +GD   P
Sbjct: 123 LGLQDGDEPAP 133


>gi|261821353|ref|YP_003259459.1| hypothetical protein Pecwa_2073 [Pectobacterium wasabiae WPP163]
 gi|261605366|gb|ACX87852.1| Uncharacterized protein putative lipoprotein-like protein
           [Pectobacterium wasabiae WPP163]
          Length = 257

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 35/110 (31%), Gaps = 13/110 (11%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           I      A +  + + +C +   + D   C     + + E++ A Y  +         E 
Sbjct: 13  IIHSFFFASSVNAASFDCKKAEGKIDRTICNHPELSSLDEEMSALYFSIK-NDPIIPPEN 71

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +  Q  +   R + CA   +            + CL+    E   + + 
Sbjct: 72  LKIRQKTFLSARNA-CAREKN-----------VSTCLEDSYQEIINEYQQ 109


>gi|47569503|ref|ZP_00240183.1| conserved hypothetical protein protein [Bacillus cereus G9241]
 gi|47553832|gb|EAL12203.1| conserved hypothetical protein protein [Bacillus cereus G9241]
          Length = 393

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 31/96 (32%), Gaps = 1/96 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
                  D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+   
Sbjct: 298 ANVASDNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKA 357

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             +    GT + +  +        ER  +L   Y+ 
Sbjct: 358 IGTDTNNGTMRRIDASEEKYKMTKERCYELVNGYMN 393


>gi|126640381|ref|YP_001083365.1| putative signal peptide [Acinetobacter baumannii ATCC 17978]
          Length = 97

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 41/102 (40%), Gaps = 15/102 (14%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q+ + +CN    + +++ C   S      K+  TY+ VL  +    R+  + +Q  W   
Sbjct: 2   QAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDNQKDTQQQWLKK 61

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           R + CA                 +C+     +R ++L++ L 
Sbjct: 62  RNA-CAAN--------------VSCISKAYQQRQKQLDTILQ 88


>gi|328766173|gb|EGF76231.1| hypothetical protein BATDEDRAFT_28709 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 245

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 34/92 (36%), Gaps = 1/92 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           + ++ +    M    G S+ +  ++L   Y  + +++     E  +  Q+ W   +    
Sbjct: 148 DSDKGVTNV-MKNYYGRSYEMYDKELNEIYALLKKELSPETMEDLKTEQIKWIEQKEETA 206

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                    GT +++ Y   L     ER  +L
Sbjct: 207 NEERLKYNGGTFENVAYYISLYESTKERCYEL 238


>gi|254374151|ref|ZP_04989633.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571871|gb|EDN37525.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 97

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 42/114 (36%), Gaps = 18/114 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL             
Sbjct: 1   MKKLIIMTLTILPTLVLADKV-CD--GNTYEINACLKSQMQIYDTKLNDVQN-------- 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       ++ YR + C   +S  + GT Q++ Y NC+        ++L+
Sbjct: 50  -------HDIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 96


>gi|188990514|ref|YP_001902524.1| hypothetical protein xccb100_1118 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732274|emb|CAP50466.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 388

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 43/116 (37%), Gaps = 19/116 (16%)

Query: 1   MCRK-------IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKK 53
           M R+       +  A  + +    S + +C       +   C   +  L+ E+L+A+Y++
Sbjct: 1   MNRRAHALRVVLAGAALLASGGAWSASFDCARASTAVEQRLCAVKALGLLDERLDASYQE 60

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +L+   +       + Q  W   R + CA  A+             +CLQ     R
Sbjct: 61  LLQTTPRSAVAAVREQQRGWLRQRNA-CAQNATP-----------DDCLQRSLSAR 104


>gi|110802017|ref|YP_698210.1| putative lipoprotein [Clostridium perfringens SM101]
 gi|110682518|gb|ABG85888.1| putative lipoprotein [Clostridium perfringens SM101]
          Length = 258

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             + N    QA MN  +G    L  ++L   Y  + + + K + +  EKS+MAW   + +
Sbjct: 159 EYDSNRGSTQAGMNGISGEQAKLYDDELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKEN 218

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           + A      E G+   ++  + +   + ER   L
Sbjct: 219 KIAEIKKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|302186151|ref|ZP_07262824.1| hypothetical protein Psyrps6_07392 [Pseudomonas syringae pv.
           syringae 642]
          Length = 136

 Score = 61.7 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A  +        A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTAVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|317049724|ref|YP_004117372.1| hypothetical protein Pat9b_3526 [Pantoea sp. At-9b]
 gi|316951341|gb|ADU70816.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 137

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 44/125 (35%), Gaps = 10/125 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMA-------LNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M + +     +++    +           C N       M+QC   +     +++   Y 
Sbjct: 1   MKKWLPVTCLLLSSYATAQGNPIDQSLQQCLNRESSTLGMSQCYDAANKAWDQEMNNQYN 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGS--ECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           ++++K+    +   + +Q AW  YR S  + +     A +GT   +            + 
Sbjct: 61  QLMKKLTGEPKAKLKNAQRAWLAYRDSWLDASKRYFSASQGTMAVLSVGAQGVNLVRNQA 120

Query: 111 EKLES 115
             L+S
Sbjct: 121 LMLQS 125


>gi|153832575|ref|ZP_01985242.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|148871141|gb|EDL70019.1| conserved hypothetical protein [Vibrio harveyi HY01]
          Length = 197

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 36/112 (32%), Gaps = 14/112 (12%)

Query: 5   IIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ- 62
           +  +      +  S + +CN      A+   C     + +  ++   YKK     +K   
Sbjct: 10  LTMSFFTAGASAASPSFDCNNDSLSGAEQIICQSEMLSQLDRQMSEVYKKAKAVDDKQAG 69

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +   +  Q+ W   R  EC  +                CL+     R  +L+
Sbjct: 70  QHTLKAEQVGWIRGRN-ECWKSNDEE-----------QCLKQEYEYRIAELQ 109


>gi|320323467|gb|EFW79552.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329490|gb|EFW85482.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 74

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLT 118
             +++ F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ 
Sbjct: 7   PAKKQAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVA 66

Query: 119 CPEGDLLCP 127
           C E    CP
Sbjct: 67  CRE--EGCP 73


>gi|167628099|ref|YP_001678599.1| hypothetical protein Fphi_1872 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167598100|gb|ABZ88098.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 96

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 43/115 (37%), Gaps = 21/115 (18%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R I+     + I   + +  C+      ++NQC         +KL+            
Sbjct: 1   MLRIIL--SLFLPILVFANSPICD--GNTYEINQCLKTQMQTYDKKLD------------ 44

Query: 61  HQRELFEKSQ-MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 + S    ++ YR + C+  +S    GT +S+ Y NC+        ++LE
Sbjct: 45  ----SLKDSNIKDFKKYRDNICSKISSTYSGGTYESIKYGNCIISLDRWYLKELE 95


>gi|325528903|gb|EGD05938.1| hypothetical protein B1M_03894 [Burkholderia sp. TJI49]
          Length = 270

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 37/113 (32%), Gaps = 8/113 (7%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ- 62
           +    +  I +A    A++C +     +   C          ++ A Y  VL+       
Sbjct: 7   RAAMFVLGIGVAGPGFAMDCAKATQAIEKRICGNAGLRAADTRMNAAYADVLKIAPDAAI 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R++  +SQ  W   R +              + +  A  ++    +R  +L  
Sbjct: 67  RDMLVRSQRRWLAARNNRLDADYE------GRPLAVAE-VRKMIDQRTAELAD 112


>gi|238021973|ref|ZP_04602399.1| hypothetical protein GCWU000324_01878 [Kingella oralis ATCC 51147]
 gi|237866587|gb|EEP67629.1| hypothetical protein GCWU000324_01878 [Kingella oralis ATCC 51147]
          Length = 363

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 35/92 (38%), Gaps = 5/92 (5%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   ++N     +     + +++ ++K+    +   ++     Q  WE  + + C  A
Sbjct: 274 NNVSDKELNA-AREANDKADQSIKSAWRKI----DPQVQQDLVDEQREWESKKRANCRNA 328

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+  +  T    +   C      ER + L+ Y
Sbjct: 329 AAKGKSATESQYLQLQCDTRMTRERVQYLKGY 360


>gi|229061479|ref|ZP_04198824.1| hypothetical protein bcere0026_35650 [Bacillus cereus AH603]
 gi|228717902|gb|EEL69550.1| hypothetical protein bcere0026_35650 [Bacillus cereus AH603]
          Length = 393

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   +  +    
Sbjct: 299 NVMSTNDIVNEIEGNYQLWDNKLNEIYSTLKNTMSADAFQSLKTKQIAWVKEKERKVTAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +   +GT + +  +        ER  +L   Y+ 
Sbjct: 359 GTDPNKGTMRRIEASEEKYKMTKERCYELVNGYMN 393


>gi|22125156|ref|NP_668579.1| hypothetical protein y1256 [Yersinia pestis KIM 10]
 gi|45442269|ref|NP_993808.1| hypothetical protein YP_2486 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597241|ref|YP_071432.1| hypothetical protein YPTB2925 [Yersinia pseudotuberculosis IP
           32953]
 gi|108808406|ref|YP_652322.1| hypothetical protein YPA_2412 [Yersinia pestis Antiqua]
 gi|108811332|ref|YP_647099.1| hypothetical protein YPN_1169 [Yersinia pestis Nepal516]
 gi|145598873|ref|YP_001162949.1| hypothetical protein YPDSF_1591 [Yersinia pestis Pestoides F]
 gi|149365425|ref|ZP_01887460.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|165939915|ref|ZP_02228453.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|167469450|ref|ZP_02334154.1| hypothetical protein YpesF_16539 [Yersinia pestis FV-1]
 gi|186896343|ref|YP_001873455.1| hypothetical protein YPTS_3041 [Yersinia pseudotuberculosis PB1/+]
 gi|218929757|ref|YP_002347632.1| hypothetical protein YPO2684 [Yersinia pestis CO92]
 gi|229838241|ref|ZP_04458400.1| putative exported protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229895564|ref|ZP_04510735.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|229898806|ref|ZP_04513951.1| putative exported protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229901580|ref|ZP_04516702.1| putative exported protein [Yersinia pestis Nepal516]
 gi|21958017|gb|AAM84830.1|AE013728_10 hypothetical [Yersinia pestis KIM 10]
 gi|45437133|gb|AAS62685.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590523|emb|CAH22163.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|108774980|gb|ABG17499.1| hypothetical protein YPN_1169 [Yersinia pestis Nepal516]
 gi|108780319|gb|ABG14377.1| hypothetical protein YPA_2412 [Yersinia pestis Antiqua]
 gi|115348368|emb|CAL21303.1| putative exported protein [Yersinia pestis CO92]
 gi|145210569|gb|ABP39976.1| hypothetical protein YPDSF_1591 [Yersinia pestis Pestoides F]
 gi|149291838|gb|EDM41912.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|165912134|gb|EDR30773.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|186699369|gb|ACC89998.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681509|gb|EEO77603.1| putative exported protein [Yersinia pestis Nepal516]
 gi|229688354|gb|EEO80425.1| putative exported protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229694607|gb|EEO84654.1| putative exported protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229701370|gb|EEO89398.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|320016109|gb|ADV99680.1| putative exported protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 122

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 33/111 (29%), Gaps = 16/111 (14%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +I +   +A+   + + +C+      + + CT    + + + L + Y K        +  
Sbjct: 9   LIISTFFLAVPGYAASFDCDNAKGYVETSICTNPVLSKLDDTLLSVYAKAQAAAPDQEIN 68

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                Q  W                  +  ++   + L      R  +L  
Sbjct: 69  -IRNEQREWLK---------------NSRNTLTSEDALILSYEARIAQLSK 103


>gi|113968458|ref|YP_732251.1| hypothetical protein Shewmr4_0113 [Shewanella sp. MR-4]
 gi|113883142|gb|ABI37194.1| conserved hypothetical protein [Shewanella sp. MR-4]
          Length = 128

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 40/113 (35%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQS--MALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +FA+T+   A  +   + +C++      +   C       + ++L   Y K  EK +  Q
Sbjct: 17  LFAMTLGTPAMAAEKPSFDCSKVRAGSIEELVCQDEGLIKLDQQLAEVYTKATEKAKNEQ 76

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
               +  Q  W   R  EC  +                C++     R  +L++
Sbjct: 77  PPTLKAMQRGWVKGRD-ECWKSEDK-----------RACVESTYQTRIAELQA 117


>gi|323497604|ref|ZP_08102621.1| hypothetical protein VISI1226_22295 [Vibrio sinaloensis DSM 21326]
 gi|323317353|gb|EGA70347.1| hypothetical protein VISI1226_22295 [Vibrio sinaloensis DSM 21326]
          Length = 179

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 40/118 (33%), Gaps = 20/118 (16%)

Query: 2   CRKIIFALTIIAIA----FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            R +   L +  ++    F   + +C      A+   C     + + +K+   Y   LE 
Sbjct: 1   MRLLALTLLVWTLSTPLTFAQPSFDCTLASQVAEKVICGSKELSQLDQKITQRYLDTLES 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +        ++Q  W + R   C +                +C+   +++R  +L S
Sbjct: 61  AQDD-ITSLRQTQRQWLMERNK-CEYGF--------------DCILQQSLQRLRELNS 102


>gi|71735833|ref|YP_276912.1| hypothetical protein PSPPH_4814 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482954|ref|ZP_05636995.1| hypothetical protein PsyrptA_06846 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298485225|ref|ZP_07003318.1| hypothetical protein PSA3335_0637 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556386|gb|AAZ35597.1| Protein of unknown function (DUF1311) subfamily, putative
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298160213|gb|EFI01241.1| hypothetical protein PSA3335_0637 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326338|gb|EFW82391.1| hypothetical protein PsgB076_01976 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331671|gb|EFW87609.1| hypothetical protein PsgRace4_01295 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330882846|gb|EGH16995.1| hypothetical protein Pgy4_28655 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330989480|gb|EGH87583.1| hypothetical protein PLA107_30969 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011801|gb|EGH91857.1| hypothetical protein PSYTB_19381 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 136

 Score = 61.3 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 54/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|118497328|ref|YP_898378.1| hypothetical protein FTN_0733 [Francisella tularensis subsp.
           novicida U112]
 gi|195536014|ref|ZP_03079021.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
 gi|118423234|gb|ABK89624.1| hypothetical protein FTN_0733 [Francisella novicida U112]
 gi|194372491|gb|EDX27202.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
          Length = 97

 Score = 61.3 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 42/114 (36%), Gaps = 18/114 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL             
Sbjct: 1   MKKLIIMTLTILPTLIVADKV-CD--GNTYEINACLKSQMQIYDTKLNDVQN-------- 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       ++ YR + C   +S  + GT Q++ Y NC+        ++L+
Sbjct: 50  -------HDIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 96


>gi|170023396|ref|YP_001719901.1| hypothetical protein YPK_1150 [Yersinia pseudotuberculosis YPIII]
 gi|169749930|gb|ACA67448.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 122

 Score = 61.3 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 33/111 (29%), Gaps = 16/111 (14%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +I +   +A+   + + +C+      + + CT    + + + L + Y K        +  
Sbjct: 9   LIISTFFLAVPGYAASFDCDNAKGYVETSICTNPVLSKLDDTLLSVYAKAQAAAPDQEIN 68

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                Q  W                  +  ++   + L      R  +L  
Sbjct: 69  -IRNEQREWLK---------------NSRNTLTSEDALILSYETRIAQLSK 103


>gi|146307989|ref|YP_001188454.1| hypothetical protein Pmen_2967 [Pseudomonas mendocina ymp]
 gi|145576190|gb|ABP85722.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 125

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE---LFE 67
            +AI+       C +    A  N C G ++   +++L+ +Y ++L   ++++ E      
Sbjct: 12  CMAISAAESEDPCQQGSAMAA-NLCHGPAWQAAEDELQRSYDRLLSHFKEYEPELVVELR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQ-SMIYANCLQGHAIERNEKLESYLTCP 120
            +Q +W   R   C+  A    +G+       A C+   A  R   L++ L   
Sbjct: 71  DAQRSWIRQREQSCSLYARSRVQGSPWTGFWAAQCMAEQARARAAWLKTMLEDE 124


>gi|289624280|ref|ZP_06457234.1| hypothetical protein PsyrpaN_03891 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646907|ref|ZP_06478250.1| hypothetical protein Psyrpa2_04022 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330869846|gb|EGH04555.1| hypothetical protein PSYAE_21879 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 136

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +K +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFKNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|163747908|ref|ZP_02155241.1| hypothetical protein OIHEL45_19671 [Oceanibulbus indolifex HEL-45]
 gi|161378816|gb|EDQ03252.1| hypothetical protein OIHEL45_19671 [Oceanibulbus indolifex HEL-45]
          Length = 210

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/101 (12%), Positives = 28/101 (27%), Gaps = 15/101 (14%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A    + +C       +   C   + + +  ++   ++       K +       Q +W 
Sbjct: 3   AQAQASFDCKLAATTVEKTICADAALSKLDRQMADAFRNARRSASKSKSASILADQRSWI 62

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R S C+                 +CL      R   L +
Sbjct: 63  GQRNS-CSSDR--------------SCLLASMQNRIADLNA 88


>gi|163733878|ref|ZP_02141320.1| hypothetical protein RLO149_06183 [Roseobacter litoralis Och 149]
 gi|161392989|gb|EDQ17316.1| hypothetical protein RLO149_06183 [Roseobacter litoralis Och 149]
          Length = 203

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 37/116 (31%), Gaps = 18/116 (15%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV----- 58
            +  A T ++      + +C +   Q +   C   + A++  ++   Y   L+       
Sbjct: 9   CLTLAATCVSAETTGPSFDCAKAGSQTEDLICNDTALAVLDRRMALRYAAALKAAGNIQG 68

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             ++        Q  W   R  +C  A               NC++   + R  +L
Sbjct: 69  GTENALNTLRAMQRGWIKGRD-DCWKADDL-----------RNCVEAAYLTREGEL 112


>gi|330446354|ref|ZP_08310006.1| putative uncharacterized protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490545|dbj|GAA04503.1| putative uncharacterized protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 403

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 45/121 (37%), Gaps = 18/121 (14%)

Query: 1   MCRKI-IFA--LTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M R + + A  + + + A  + +L+   C+    + D   C      ++ ++L   Y++ 
Sbjct: 1   MKRLVPLLAGVVAMFSPALMAASLDASDCHSPSSELDKLICHDAELVVLNKQLSGVYQQA 60

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L +    + ++ +++Q  W   R   C   +               CL      R + L+
Sbjct: 61  LTQSMVSEADVMKETQKNWLATR-HLCLKHSDPQR-----------CLVDSYRSRLQSLK 108

Query: 115 S 115
            
Sbjct: 109 E 109


>gi|311108673|ref|YP_003981526.1| hypothetical protein AXYL_05511 [Achromobacter xylosoxidans A8]
 gi|310763362|gb|ADP18811.1| hypothetical protein AXYL_05511 [Achromobacter xylosoxidans A8]
          Length = 223

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 38/117 (32%), Gaps = 10/117 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M R ++FA ++      + A   NC +     +   C   + A     +   YK V  K+
Sbjct: 1   MIRHLVFAASLAMAGSAAAAPSFNCAKATSPVEKAICAHPALADQDAAIAQQYKAVRAKL 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +    +     Q  +   R +      +    G+         +      R + L++
Sbjct: 61  DAEAVKSLTSDQRYFLSVRDN----IYAEPFTGSTPVKEIGTSM----RYRLDFLKA 109


>gi|146277875|ref|YP_001168034.1| hypothetical protein Rsph17025_1838 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556116|gb|ABP70729.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 225

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 26/95 (27%), Gaps = 15/95 (15%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C+      +   C+  + A +   +   Y           R+     Q AW   R   
Sbjct: 22  FDCSRAGTMVEHAICSDPALAALDRDVAQAYGAARAGQPPAARDQLLAEQRAWLAARD-- 79

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                     G+ +      CL      R   L++
Sbjct: 80  --------GCGSDRI-----CLSTAMQNRLSALQA 101


>gi|310765203|gb|ADP10153.1| hypothetical protein EJP617_04720 [Erwinia sp. Ejp617]
          Length = 136

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 43/119 (36%), Gaps = 12/119 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A   I+ +  ++  +C +      +  C   +    ++ L   Y    ++++        
Sbjct: 15  AGLQISCSAYAI-DDCAKETSDPAVFTCAEKNKDTAEKNLNHEYLAAKKRIDDVFSSEAD 73

Query: 61  ---HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLES 115
                     +SQ  W  YR  +C   A  A++ +    +   NC+      R+++L+ 
Sbjct: 74  VKKEYLATLIESQRGWLKYRDGQCKLFAHVADKNSNPYIVFTNNCIAELDENRSKQLKE 132


>gi|110678670|ref|YP_681677.1| hypothetical protein RD1_1349 [Roseobacter denitrificans OCh 114]
 gi|109454786|gb|ABG30991.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 212

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 36/117 (30%), Gaps = 22/117 (18%)

Query: 7   FALTIIAIAFQS----MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV---- 58
              T+ A    +     + +C +   QA+   C   + A +  +L   +   LE      
Sbjct: 17  MCFTLAATGVNAETTGPSFDCAKASSQAEDLICADAALATLDRRLALRFGAALEAAGNIE 76

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              ++ R      Q  W   R  EC  A                C++   + R  +L
Sbjct: 77  DDTENARTTLRAMQRGWIKGRD-ECWKAQD-----------VRGCVERDYLTREGQL 121


>gi|330891369|gb|EGH24030.1| hypothetical protein PSYMO_22213 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 142

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 54/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +  +
Sbjct: 7   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|187940055|gb|ACD39188.1| hypothetical protein PACL_0400 [Pseudomonas aeruginosa]
          Length = 404

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 17/105 (16%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C++     +   C     + + E L  +YK  LE V   Q +   +SQ  W   R
Sbjct: 24  AASFDCSKASSFPETEICRDGYLSGLDEWLARSYKAALE-VNPGQSDAVRQSQREWLATR 82

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            + C                   CL      R + L+ Y+T  +G
Sbjct: 83  NA-CTDQ---------------QCLDSTIGARIQALDQYVTAEKG 111


>gi|303245746|ref|ZP_07332029.1| protein of unknown function DUF1311 [Desulfovibrio fructosovorans
           JJ]
 gi|302493009|gb|EFL52874.1| protein of unknown function DUF1311 [Desulfovibrio fructosovorans
           JJ]
          Length = 136

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 7/107 (6%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWEIYRGSEC 81
                Q +MN    ++      +L A Y  VLEK +         + ++ AW  +R +E 
Sbjct: 21  ARAQTQMEMNVAACDAAKKADAELNAAYAAVLEKNKDDPVFIRKLKVAERAWLAFRDAEL 80

Query: 82  AFAA----SGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGD 123
           A         A  G+  +  Y N L     +R   L  +    PEGD
Sbjct: 81  AARYPAEDKAAAYGSMYNFCYCNALAELTRKRAAALAPWRDGVPEGD 127


>gi|296158394|ref|ZP_06841225.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
 gi|295891338|gb|EFG71125.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
          Length = 196

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 35/115 (30%), Gaps = 17/115 (14%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
               + + +CN      +   C+  + + + + L   Y K   +V   +      S   W
Sbjct: 17  PLAHAASFDCNRGRSLTEKIICSDPALSKLDDALGQLYWKARRRVANRRAF-LTDSDSKW 75

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
             +R   C  AA               CL      R E+L+  +   +     P 
Sbjct: 76  -AWREGNCRDAA---------------CLGTWYATRIEELQKLVESLQAGTPPPV 114


>gi|254519766|ref|ZP_05131822.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226913515|gb|EEH98716.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 209

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 35/90 (38%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G S+ +  + L   Y  + E++     +  +  Q+ W   + +    
Sbjct: 113 SDAGITNAMRSFYGISYDMYDKALNEIYALLKEQLSPETMQNLQSEQIKWIEKKEATATN 172

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            A   + G+ + + Y + L G    R  +L
Sbjct: 173 EAEKYKGGSFEFVAYNSSLYGTTKNRCYEL 202


>gi|325496982|gb|EGC94841.1| hypothetical protein ECD227_1079 [Escherichia fergusonii ECD227]
          Length = 135

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 40/121 (33%), Gaps = 25/121 (20%)

Query: 21  LNCNETLMQADMNQ-----CTGNSFALVKEKLEATYKKV----------------LEKVE 59
            NC     + D        C    + L   KL   Y  V                 +K++
Sbjct: 2   ENCLRAWSEDDAEITTAITCMKQEYQLADAKLNKVYGDVYRYIELVPRAWWNKGEKDKID 61

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEE----GTAQSMIYANCLQGHAIERNEKLES 115
             Q  L ++SQ AW  +R  EC    S  ++         + +  C+      R  +L+S
Sbjct: 62  VEQLNLLKESQRAWINFRDKECTLVISSEDDPKLTNPYAEVEWLKCMTLQTNTRIRQLQS 121

Query: 116 Y 116
           Y
Sbjct: 122 Y 122


>gi|308188239|ref|YP_003932370.1| hypothetical protein Pvag_2762 [Pantoea vagans C9-1]
 gi|308058749|gb|ADO10921.1| hypothetical protein Pvag_2762 [Pantoea vagans C9-1]
          Length = 136

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 55/140 (39%), Gaps = 14/140 (10%)

Query: 1   MCRKIIFALTIIAIAFQS------MALN-C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M   ++  L  ++ A  +       AL+ C N+     +MNQC   +  +  +++   Y 
Sbjct: 1   MKSGLLLMLLFVSTATIAKDLPSDAALDRCLNDASATLEMNQCYAAATTIWDQQMNQQYN 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
            +++ +    +     +Q AW  YR S  A + S  A +GT  S+  +         +  
Sbjct: 61  TLMKTLNGDAKNRLRIAQRAWLSYRDSWLAASHSQLATQGTLGSVALSAQGLSLVRNQAL 120

Query: 112 KLESYLTCPEGDLLCPFINN 131
            L+S      G   C   ++
Sbjct: 121 MLQSL-----GKGSCANPDD 135


>gi|167644332|ref|YP_001681995.1| hypothetical protein Caul_0360 [Caulobacter sp. K31]
 gi|167346762|gb|ABZ69497.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 117

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 34/124 (27%), Gaps = 22/124 (17%)

Query: 2   CRKIIFALTIIAIAFQSM-------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            R ++ AL ++ +   +        + +C       +   C   +      ++   Y   
Sbjct: 1   MRLLLTALALVPVLGLAAPLAAEAASFDCARARTPDEKAICANMALNDKDVRMSVLYDIN 60

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              +    R   E +Q  W   R   C    +              CL      R  +LE
Sbjct: 61  KHTLAMGGRGAMEDAQRQWLRDRR-NCGANRA--------------CLNRAYDRRLSELE 105

Query: 115 SYLT 118
             L 
Sbjct: 106 RSLD 109


>gi|187920382|ref|YP_001889413.1| hypothetical protein Bphyt_5697 [Burkholderia phytofirmans PsJN]
 gi|187718820|gb|ACD20043.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 123

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 37/115 (32%), Gaps = 16/115 (13%)

Query: 2   CRKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R  +FA+  ++ A   + + +C    +  +   C     + +  ++   Y+ +   V  
Sbjct: 13  LRCALFAMVTLSSATAFAASFDCGRARLADEKAICASRQLSEMDVEMAVRYQMLTGLVAM 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   +  Q  W   R + C         G        +CL      R   L+ 
Sbjct: 73  GARGDMQDEQQVWLKSRKA-C--------GGN------RSCLLNAYRRRIGTLKD 112


>gi|259907304|ref|YP_002647660.1| hypothetical protein EpC_06280 [Erwinia pyrifoliae Ep1/96]
 gi|224962926|emb|CAX54407.1| Putative exported protein [Erwinia pyrifoliae Ep1/96]
 gi|283477123|emb|CAY73023.1| putative type VI secretion system-associated hypothetical protein
           [Erwinia pyrifoliae DSM 12163]
          Length = 133

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 43/119 (36%), Gaps = 12/119 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A   I+ +  ++  +C +      +  C   +    ++ L   Y     +++        
Sbjct: 12  AGLQISCSAYAI-DDCAKETSDPAVFTCAEKNKDTAEKNLNHEYLAAKTRIDDLFSHEAD 70

Query: 61  ---HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLES 115
                   F +SQ  W  YR  +C   A  A++ +    +   NC+      R+++L+ 
Sbjct: 71  VKKEYLTTFIESQRGWLKYRDGQCKLFAHIADKNSNPYIVFTNNCIAELDENRSKQLKE 129


>gi|83944451|ref|ZP_00956904.1| hypothetical protein EE36_13998 [Sulfitobacter sp. EE-36]
 gi|83844653|gb|EAP82537.1| hypothetical protein EE36_13998 [Sulfitobacter sp. EE-36]
          Length = 140

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 52/140 (37%), Gaps = 20/140 (14%)

Query: 1   MCRKIIFALTIIAIAFQSMAL--------NCNETLMQAD-MNQC-----------TGNSF 40
           M + + F+L +I     +  L        +C       D +++C              ++
Sbjct: 1   MLKCMFFSLLLIPAMATAEKLPPASELLSDCTAPQTDPDAVHRCLFAMGDQVERDMVRAY 60

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
              +  L A  +    K +     L + SQ+A+E YR   CAF    +  GTA   +  +
Sbjct: 61  LDAQAALAAFDQAFSRKADASASALLQNSQIAFEDYRKYHCAFPERLSLGGTAAINVTLS 120

Query: 101 CLQGHAIERNEKLESYLTCP 120
           C       R E+L+ Y T  
Sbjct: 121 CRIVLTRSRIEQLQDYATAR 140


>gi|265509431|gb|ACY75518.1| hypothetical protein [Pseudomonas aeruginosa]
          Length = 404

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 17/105 (16%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C++     +   C     + + E L  +YK  LE V   Q +   +SQ  W   R
Sbjct: 24  AASFDCSKASSFPETEICRDGYLSGLDEWLARSYKTALE-VNPGQSDAVRQSQREWLATR 82

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            + C                   CL      R + L+ Y+T  +G
Sbjct: 83  NA-CTDQ---------------QCLDSTIGARIQALDQYVTAEKG 111


>gi|148545583|ref|YP_001265685.1| hypothetical protein Pput_0328 [Pseudomonas putida F1]
 gi|148509641|gb|ABQ76501.1| protein of unknown function DUF1311 [Pseudomonas putida F1]
          Length = 138

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 43/126 (34%), Gaps = 10/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M       L  I    Q+       C+          C   +  + + +L++ Y  ++ +
Sbjct: 1   MKSMAWLVLLAIVSGAQASEDESTPCDNVETDQQTFACAAFNKQVAERELQSAYDDLVAR 60

Query: 58  VEKHQ------RELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERN 110
           +              E ++  W   R ++C       + G+ A  + + +C+   + ER 
Sbjct: 61  MRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSRAYQIAWNSCIAQRSDERA 120

Query: 111 EKLESY 116
           E L S 
Sbjct: 121 EYLRSL 126


>gi|213027655|ref|ZP_03342102.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
          Length = 75

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 37/71 (52%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1  MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62 QRELFEKSQMA 72
          QREL +K+Q+A
Sbjct: 61 QRELLQKAQVA 71


>gi|56698171|ref|YP_168543.1| hypothetical protein SPO3347 [Ruegeria pomeroyi DSS-3]
 gi|56679908|gb|AAV96574.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 128

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 38/125 (30%), Gaps = 8/125 (6%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK- 60
            R  +       +     AL C++   Q +   C     A V+  L    +       + 
Sbjct: 4   LRYAVALALAPVLTAADPALECSDAASQVETGACVSEMSARVEGALAIALEIARGSAAEL 63

Query: 61  -------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                        + +Q AW  YR + C    +G   G+   +   +C       R ++L
Sbjct: 64  DEVTGRKMALPALDSAQSAWTAYRAAHCEAVGAGFGGGSGTGIAITSCQIELGRARIDEL 123

Query: 114 ESYLT 118
            +   
Sbjct: 124 MAMAQ 128


>gi|291087653|ref|ZP_06347044.2| conserved hypothetical protein [Clostridium sp. M62/1]
 gi|291074355|gb|EFE11719.1| conserved hypothetical protein [Clostridium sp. M62/1]
          Length = 455

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 L  ++L   YK ++ +++  + E  +K +  W   +  +   AAS  + GT + 
Sbjct: 364 ADYELKLWDDELNVIYKDIMSRLDTEEAEKLKKEERTWIRQKDEDARKAASRYKGGTLEG 423

Query: 96  MIYANCLQGHAIERNEK-LESYLTC 119
           + +   L     ER    L+SY +C
Sbjct: 424 LEHTASLAKSTRERAYALLDSYGSC 448


>gi|39995863|ref|NP_951814.1| putative lipoprotein [Geobacter sulfurreducens PCA]
 gi|39982627|gb|AAR34087.1| lipoprotein, putative [Geobacter sulfurreducens PCA]
 gi|298504874|gb|ADI83597.1| lipoprotein, putative [Geobacter sulfurreducens KN400]
          Length = 280

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 32/104 (30%), Gaps = 13/104 (12%)

Query: 13  AIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           A A +  + +C+       +   C     + +  KL   Y     +            Q 
Sbjct: 101 ATAPEGPSYDCDTVTPGSIEALVCGDRELSALDRKLADVYAAASARAVNEHPPRLGAEQR 160

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            W   R  +C  + +  E           C++   + R  +L++
Sbjct: 161 GWIKGRN-DCWKSDTVRE-----------CVRDEYLRRTAELQA 192


>gi|87124504|ref|ZP_01080353.1| hypothetical protein RS9917_12860 [Synechococcus sp. RS9917]
 gi|86168076|gb|EAQ69334.1| hypothetical protein RS9917_12860 [Synechococcus sp. RS9917]
          Length = 106

 Score = 60.2 bits (144), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 35/119 (29%), Gaps = 18/119 (15%)

Query: 1   MCRKIIFALTIIAI---AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R ++ A   +     + Q  A+ C       +M  C   ++            ++ EK
Sbjct: 1   MKRLLLVAGLTLFPDVVSAQPAAIQC-PGDTTPEMRYCAEQAWRRSDA-------QLREK 52

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           V              W+    + CA A +   EGT    +   C         ++    
Sbjct: 53  VSPELM-------QQWQDATKALCAAAYASYLEGTIYPQLVVGCDDNLNRALLKEFRGL 104


>gi|260599449|ref|YP_003212020.1| hypothetical protein CTU_36570 [Cronobacter turicensis z3032]
 gi|260218626|emb|CBA33925.1| hypothetical protein CTU_36570 [Cronobacter turicensis z3032]
          Length = 112

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 40/119 (33%), Gaps = 16/119 (13%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             +  + +++C+      D+  C           L   YK  +  +   Q+++ + +Q++
Sbjct: 1   MCSAAAWSMSCDNPRSPYDVTYCAALEMVQGDRDLNQQYKNTMSALSPAQKQVVKNAQIS 60

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY------LTCPEGDLL 125
           W   R  ECA            S +   C       R   L+S         C + DL 
Sbjct: 61  WLKVRDHECAE----------GSTLLLGCANEKMAARITLLKSIERECRNAGCNDADLS 109


>gi|26987049|ref|NP_742474.1| hypothetical protein PP_0307 [Pseudomonas putida KT2440]
 gi|24981670|gb|AAN65938.1|AE016221_10 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 143

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 45/126 (35%), Gaps = 10/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M       L  I    Q+       C+          C   +  + + +L++ Y +++E+
Sbjct: 6   MKSMAWLVLLAIVSGAQADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIER 65

Query: 58  VEKHQ------RELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERN 110
           +              E ++  W   R ++C       + G+ A  + + +C+   + ER 
Sbjct: 66  MRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERA 125

Query: 111 EKLESY 116
           E L S 
Sbjct: 126 EYLRSL 131


>gi|237802315|ref|ZP_04590776.1| hypothetical protein POR16_26104 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025172|gb|EGI05228.1| hypothetical protein POR16_26104 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 136

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF---QSM----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A    Q+     A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDATPCDGVDDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A S+   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFSISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|157372684|ref|YP_001480673.1| hypothetical protein Spro_4451 [Serratia proteamaculans 568]
 gi|157324448|gb|ABV43545.1| protein of unknown function DUF1311 [Serratia proteamaculans 568]
          Length = 143

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 49/140 (35%), Gaps = 28/140 (20%)

Query: 1   MCRKIIFALTIIA------IAFQSMALN-----------------C--NETLMQADMNQC 35
           M  K++ A  + A       A  +   +                 C   +         C
Sbjct: 1   MKIKMLAAALVFAATPAFVSAAPAATQDTEQNVLMKYQYSKTYMQCMDKDGGNTPGAAAC 60

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
               F L   +L   YK+ L+   K   + + ++Q  W  ++ S+C    +    G+  +
Sbjct: 61  IEAEFKLWDARLNKAYKESLKF--KAAPKAWREAQRNWLKFKDSQCLALVAAP-HGSGDA 117

Query: 96  MIYANCLQGHAIERNEKLES 115
           +  A+C     I+R  +LES
Sbjct: 118 LDSASCQLNMTIDRTLQLES 137


>gi|283956224|ref|ZP_06373705.1| hypothetical protein C1336_000240005 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792277|gb|EFC31065.1| hypothetical protein C1336_000240005 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 247

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/139 (12%), Positives = 45/139 (32%), Gaps = 22/139 (15%)

Query: 1   MCRKIIFALTIIAIAFQS---------MALNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I     + ++  +          + +C +   + +   C         +      
Sbjct: 1   MQKFLIVLGLCLMLSISANAQSPKEAKPSFDCAKAKSKVEKMICNDESGELQKLDRLYSK 60

Query: 50  TYKKVLEKVEK------HQRELFEKSQMAWEIYRGS-ECAFAASGAEEGTAQSMIYANCL 102
            Y  +L+ + K      + RE  +   +A    R + +C FA    E+     +   +C+
Sbjct: 61  LYFSILKSIPKNTKEGQNAREKLKYFNIAVMKNRDTFQCYFAVEEQED---FQLHSNDCI 117

Query: 103 QGHAIERNEKLE-SYLTCP 120
           +   +E    L    +   
Sbjct: 118 KQIYLEAIATLAFRMIDSE 136


>gi|19703731|ref|NP_603293.1| hypothetical protein FN0389 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19713861|gb|AAL94592.1| Hypothetical protein FN0389 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 133

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 33/87 (37%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
             DM+          + +L   Y  ++EK+ K ++   E  Q  W   R  +    A   
Sbjct: 38  SVDMSNIITELSEGWENELNTVYSLLMEKLPKEEKIKLENEQKEWLKNRNIKAKKEAKQV 97

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLES 115
           E GT Q ++    ++    ER  +L  
Sbjct: 98  EGGTLQPVLLEGSVRAQNKERAIELAK 124


>gi|66048009|ref|YP_237850.1| hypothetical protein Psyr_4785 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258716|gb|AAY39812.1| Protein of unknown function DUF1311 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330972935|gb|EGH73001.1| hypothetical protein PSYAR_20842 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 136

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A      +   +   C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|109898713|ref|YP_661968.1| hypothetical protein Patl_2398 [Pseudoalteromonas atlantica T6c]
 gi|109700994|gb|ABG40914.1| conserved hypothetical protein [Pseudoalteromonas atlantica T6c]
          Length = 203

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 37/110 (33%), Gaps = 17/110 (15%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
              L ++A    S + NC       +   C     + + E+L   YK  +   +    + 
Sbjct: 29  ATILAMMASNAFSASFNCQNAAQTDEKIVCGSVELSTLDEQLSKRYKVAIANNQAQPAKK 88

Query: 66  F--EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              ++SQ  W   R + C F+               +C++    +R   L
Sbjct: 89  LEIQRSQTQWLSQRKA-CHFSF--------------DCIKRVYRKRISSL 123


>gi|330961978|gb|EGH62238.1| hypothetical protein PMA4326_25827 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 136

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF---QSM----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A    Q+     A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDATPCDGVDDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|239833310|ref|ZP_04681638.1| Hypothetical protein OINT_2000064 [Ochrobactrum intermedium LMG
           3301]
 gi|239821373|gb|EEQ92942.1| Hypothetical protein OINT_2000064 [Ochrobactrum intermedium LMG
           3301]
          Length = 181

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 30/82 (36%), Gaps = 4/82 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                     +L   Y +V+  +    +   ++SQ  W  YR SEC +         A  
Sbjct: 30  AYADLKAADRRLNNLYSQVVNSLPASNQMQLKESQRNWIKYRDSECRYQQVNY----AIM 85

Query: 96  MIYANCLQGHAIERNEKLESYL 117
           +  A+C +    +R + L   L
Sbjct: 86  VSEADCKEFLTRQRADHLNQQL 107


>gi|289672501|ref|ZP_06493391.1| hypothetical protein PsyrpsF_04610 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330943177|gb|EGH45588.1| hypothetical protein PSYPI_26114 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 136

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A      +   +   C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCVA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|95930907|ref|ZP_01313637.1| hypothetical protein Dace_0667 [Desulfuromonas acetoxidans DSM 684]
 gi|95133033|gb|EAT14702.1| hypothetical protein Dace_0667 [Desulfuromonas acetoxidans DSM 684]
          Length = 165

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 46/152 (30%), Gaps = 39/152 (25%)

Query: 6   IFALTIIAIAFQSMALNCNET-----------LMQADMNQ------CTGNSF-------- 40
           I  L ++  +  + A +  +            +   +         C  NS+        
Sbjct: 9   IACLYLVLHSVSAQAFDYKKVDAFPALRDFATVSDFEKFYGEYTQTCLDNSYGGTRGIPC 68

Query: 41  ----ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA------SGAEE 90
                L   +L   Y  +   ++K  +E  ++SQ AW   R     F             
Sbjct: 69  FIGSELWDRELNDYYHALYNTLDKQGQEALKQSQRAWLKERDLSIDFNTLLLNQKYSTRS 128

Query: 91  GTAQSMIYANCLQGHA----IERNEKLESYLT 118
           GT   ++ A   +        +R  +L+ +L 
Sbjct: 129 GTMFLLMRAGDAEELTQDIVKQRALQLKKWLE 160


>gi|78066557|ref|YP_369326.1| hypothetical protein Bcep18194_A5088 [Burkholderia sp. 383]
 gi|77967302|gb|ABB08682.1| hypothetical protein Bcep18194_A5088 [Burkholderia sp. 383]
          Length = 276

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 27/80 (33%), Gaps = 1/80 (1%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-REL 65
            +  + +A  + A++C + +   +   C          ++ + Y   L+       R++
Sbjct: 13 MFMMGVGVAVPAFAIDCAKAVQPIEKRICASPVLRAADTRMNSAYTGALKAAPDTAIRDM 72

Query: 66 FEKSQMAWEIYRGSECAFAA 85
            +SQ  W   R        
Sbjct: 73 LVRSQRRWIDARNKRLDADY 92


>gi|323948237|gb|EGB44225.1| hypothetical protein EREG_00200 [Escherichia coli H120]
          Length = 136

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 35/105 (33%), Gaps = 15/105 (14%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSE 80
           +  C    + LV  +L   Y +    +           +  Q  L +KSQ AW  +R  E
Sbjct: 23  IKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKE 82

Query: 81  CAFAASGAE----EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           C    S  +            + +C+      R  +L+ Y    +
Sbjct: 83  CELILSNEDVQDLSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 127


>gi|28867623|ref|NP_790242.1| hypothetical protein PSPTO_0393 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|301382471|ref|ZP_07230889.1| hypothetical protein PsyrptM_07547 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302132905|ref|ZP_07258895.1| hypothetical protein PsyrptN_16014 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28850858|gb|AAO53937.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|331014930|gb|EGH94986.1| hypothetical protein PLA106_03337 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 136

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF---QSM----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A    Q+     A  C+         +C+  S    +E L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 61  LKRVQSQFVANKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|238790289|ref|ZP_04634063.1| hypothetical protein yfred0001_31190 [Yersinia frederiksenii ATCC
          33641]
 gi|238721639|gb|EEQ13305.1| hypothetical protein yfred0001_31190 [Yersinia frederiksenii ATCC
          33641]
          Length = 329

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 27/74 (36%), Gaps = 3/74 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          IF L ++ I+  + A+NC       +   C+      + +     Y+ +L K +      
Sbjct: 7  IFFLLMMIISSSAFAINCQRAATPVEYTVCSDEDLHWLDQTFSDIYQAMLVKYDTETVYQ 66

Query: 66 FEKSQMAWEIYRGS 79
                AWE    S
Sbjct: 67 QR---RAWEKALNS 77


>gi|73539023|ref|YP_299390.1| hypothetical protein Reut_B5200 [Ralstonia eutropha JMP134]
 gi|72122360|gb|AAZ64546.1| putative Uncharacterized protein conserved in bacteria putative
           lipoprotein [Ralstonia eutropha JMP134]
          Length = 306

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 36/116 (31%), Gaps = 17/116 (14%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +CR  +  +        + + +C++ +       C       V +KL   Y++ L+    
Sbjct: 206 LCRPGLAEIQPEMKDALAHSFDCSKLVSTQAQLICADAELTRVDKKLAMVYEQKLKT--S 263

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +      Q AW     + C+                  CL     +R ++L   
Sbjct: 264 ANKARLRADQRAWLRDSRNLCSDK---------------GCLLRSYQQRIDELNRM 304


>gi|330955014|gb|EGH55274.1| hypothetical protein PSYCIT7_27410 [Pseudomonas syringae Cit 7]
          Length = 142

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A      +   +   C+         +C+  S    ++ L+  +  +
Sbjct: 7   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|323143780|ref|ZP_08078448.1| hypothetical protein HMPREF9444_01080 [Succinatimonas hippei YIT
           12066]
 gi|322416493|gb|EFY07159.1| hypothetical protein HMPREF9444_01080 [Succinatimonas hippei YIT
           12066]
          Length = 135

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 46/129 (35%), Gaps = 15/129 (11%)

Query: 5   IIFALTIIAIAFQSMALN--------CNETLM--QADMNQCTGNSFALVKEKLEATYKKV 54
           ++   ++   +F ++A          C          M +C  ++F  +  KL   YK+ 
Sbjct: 6   VLAIASVFVFSFTAVADEELSPGYNACMSASGGVTVQMRKCQNDAFIYLDGKLNKIYKQA 65

Query: 55  LEKVEKHQ-----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +            +    K Q AW  Y+ +   +      +GT   ++  + +     E+
Sbjct: 66  MLSCNDEGDSKACKNTILKMQRAWIKYKEATVDYLFMALGDGTLTPVVVDDFVNQTTKEQ 125

Query: 110 NEKLESYLT 118
            +KLE  L 
Sbjct: 126 VKKLELMLN 134


>gi|260890291|ref|ZP_05901554.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260859911|gb|EEX74411.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 144

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 42/138 (30%), Gaps = 23/138 (16%)

Query: 1   MCRKIIFALTIIAI--AFQSMALNCNE-------------TLMQADMNQCTGNSFALVKE 45
           M + +I   +++ +  +F     +                    A+M + +        +
Sbjct: 1   MKKVMILVASLMVVISSFAGYTSDMINRMETKEKSVEDSFGGSNAEMKEASSVILDGWND 60

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--------GTAQSMI 97
           +L   YK ++ K+ K ++E     +  W   +      AA             GT   + 
Sbjct: 61  ELNKVYKLLMSKLSKKEQEKLRNEERTWIKRKERVAKEAADEFCGTVNGQKLCGTGYGLE 120

Query: 98  YANCLQGHAIERNEKLES 115
           Y   L      R  +L  
Sbjct: 121 YTQSLINSTKNRAIELSK 138


>gi|163738103|ref|ZP_02145519.1| hypothetical protein RGBS107_06814 [Phaeobacter gallaeciensis
           BS107]
 gi|161388719|gb|EDQ13072.1| hypothetical protein RGBS107_06814 [Phaeobacter gallaeciensis
           BS107]
          Length = 53

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            E +Q +WE +R + C F  +    G+   +   +C      +R E L
Sbjct: 1   METAQKSWEAFRDAHCDFVGATFGGGSGTGIAILSCRITLTRDRVEAL 48


>gi|170747880|ref|YP_001754140.1| hypothetical protein Mrad2831_1462 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654402|gb|ACB23457.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 314

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/101 (12%), Positives = 26/101 (25%), Gaps = 3/101 (2%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-FEKSQMAWE 74
             + A++C +     +   C   +       L + Y  +L   +  +       SQ  W 
Sbjct: 30  SPARAIDCRKAASPLERMICADAALRKADAALGSAYGGLLRGTDDAEIRAMLVASQKRWV 89

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R +        A    +        +      R   L  
Sbjct: 90  AARDT--RLGDLDAAGAPSDPADARAVVLAAIRARTRDLSG 128


>gi|330504907|ref|YP_004381776.1| hypothetical protein MDS_3993 [Pseudomonas mendocina NK-01]
 gi|328919193|gb|AEB60024.1| protein of unknown function DUF1311 [Pseudomonas mendocina NK-01]
          Length = 242

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 24/75 (32%), Gaps = 1/75 (1%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
                  L   Y++   ++         ++Q  W   R +EC       +  +       
Sbjct: 162 LGDADALLNTAYRERQRQLSDEAGTALRQAQRNWIAMRDAECK-PYGEEQPYSVFGEFSY 220

Query: 100 NCLQGHAIERNEKLE 114
           +C+    ++R  +L 
Sbjct: 221 DCMVRLTLDRARQLA 235


>gi|320178257|gb|EFW53231.1| hypothetical protein SGB_04582 [Shigella boydii ATCC 9905]
          Length = 141

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 46/126 (36%), Gaps = 14/126 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN-------CNET---LMQADMNQCTGNSFALVKEKLEATY 51
            +KI+  L++++    +   +       C      +    +  C   +     + L   Y
Sbjct: 1   MKKILVLLSLVSTTALAKEFSIDVALQQCKNNPAIVSDMAIADCYQVAIKSWDKMLNTEY 60

Query: 52  KKVLE--KVEKHQRELFEKSQMAWEIYRG--SECAFAASGAEEGTAQSMIYANCLQGHAI 107
           K+++   +  K  ++  +KSQ+ W  YR   ++        E G+   ++    +     
Sbjct: 61  KQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHGSDWGIVGTENIMNITK 120

Query: 108 ERNEKL 113
            +  +L
Sbjct: 121 NKAIEL 126


>gi|302062097|ref|ZP_07253638.1| hypothetical protein PsyrptK_19096 [Pseudomonas syringae pv. tomato
           K40]
          Length = 142

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF---QSM----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A    Q+     A  C+         +C+  S    +E L+  +  +
Sbjct: 7   MKTFLLTLALMATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 67  LKRVQSQFVANKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|330898990|gb|EGH30409.1| hypothetical protein PSYJA_16102 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330980078|gb|EGH78314.1| hypothetical protein PSYAP_16813 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 142

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAF----QSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A      +   +   C+         +C+  S    ++ L+  +  +
Sbjct: 7   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A ++   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCVA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|156935158|ref|YP_001439074.1| hypothetical protein ESA_03009 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533412|gb|ABU78238.1| hypothetical protein ESA_03009 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/139 (14%), Positives = 41/139 (29%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+F ++++ ++  S+A          ++  C         E L     K    + K 
Sbjct: 1   MKKIVFIISVLLVSHASLAAETANVTRNDEVKACEDQYGDENSECLGDIDDKSTGALNKA 60

Query: 62  QRELFEK--------------------------SQMAWEIYRGSECAFAASGAEEGTAQS 95
             +  ++                          SQ  W  YR   C  A + A       
Sbjct: 61  YADKLKEMENFDYTKWWMGDEDRKKRMIELFKKSQAEWLKYRDDYCGVAVAEAASTHYLG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C      +R ++++
Sbjct: 121 NAATACNINMNRQRIKEIQ 139


>gi|295700022|ref|YP_003607915.1| hypothetical protein BC1002_4424 [Burkholderia sp. CCGE1002]
 gi|295439235|gb|ADG18404.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
          Length = 161

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 42/117 (35%), Gaps = 11/117 (9%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--------- 63
           + A  +   +  +     D+ QC+   F      L+   +    K+  + R         
Sbjct: 44  SAADVAHMCDTGDHATNDDLAQCSHRKFDHAGRALDKILRSAKIKIGSNDRSLKAEGEPL 103

Query: 64  --ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
               F KSQ +W  YR +EC        E   + + +  C+     +R ++L+  L 
Sbjct: 104 ALPYFLKSQDSWAQYRDNECYTETYMMGEAAERYIYFWECMANITQDRVKELQEVLK 160


>gi|254258725|ref|ZP_04949779.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254217414|gb|EET06798.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 240

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E  F  +
Sbjct: 52  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHFVRA 111

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 112 VYETTQGTMYAMANADMRLQPVRERALALRG 142



 Score = 38.6 bits (88), Expect = 0.26,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 175 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 221

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 222 LIGARVATLKRF 233


>gi|315636877|ref|ZP_07892101.1| hypothetical protein HMPREF9401_1512 [Arcobacter butzleri JV22]
 gi|315478707|gb|EFU69416.1| hypothetical protein HMPREF9401_1512 [Arcobacter butzleri JV22]
          Length = 236

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 41/123 (33%), Gaps = 25/123 (20%)

Query: 1   MCRKIIFALTIIAIAFQS-----MALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKV 54
           M + I+  L I      +      + +C+       + + C   + +L+   L   YK+ 
Sbjct: 1   MKKFILIKLFIFFNILIANEQFSPSFDCSNVKKETVESHICDNENLSLLDNTLAELYKQA 60

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            E    +     ++SQ  W   R   C                   C+Q   +ER + L 
Sbjct: 61  YEL---NLNNNLKQSQKKWLKKRD-NCKTI---------------GCIQKSYLERVDYLG 101

Query: 115 SYL 117
           + L
Sbjct: 102 NLL 104


>gi|228909702|ref|ZP_04073525.1| hypothetical protein bthur0013_38540 [Bacillus thuringiensis IBL
           200]
 gi|228849991|gb|EEM94822.1| hypothetical protein bthur0013_38540 [Bacillus thuringiensis IBL
           200]
          Length = 393

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 33/95 (34%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
            T+  +D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NTMSASDIVNEIEGNYQLWDNKLNEIYSTLRSTMSVDAFQSLKTKQIAWVKEKESKVKVI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            +    GT + +  +         R  +L   Y+ 
Sbjct: 359 GTDTNNGTMRRIEASEEKYKMTKARCYELVNGYMN 393


>gi|261823440|ref|YP_003261546.1| hypothetical protein Pecwa_4215 [Pectobacterium wasabiae WPP163]
 gi|261607453|gb|ACX89939.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 266

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 32/108 (29%), Gaps = 22/108 (20%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKHQRELFEKSQ 70
            Q+ + +C +     +   C       + E+L   +K     +          +   + Q
Sbjct: 22  AQAASFSCEKAASAQEKLICASPLLGQLDEELAQAWKTSRAFLTAYDNSAPWEKTLNQFQ 81

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +W   R   C                  +CL+    ++  +L  YL 
Sbjct: 82  RSWLTTRDR-CKDE---------------DCLRQRYQQQLNRLR-YLN 112


>gi|294789340|ref|ZP_06754578.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
 gi|294482765|gb|EFG30454.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
          Length = 240

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 37/92 (40%), Gaps = 4/92 (4%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           +  +  D       +     ++++++++ +        R+   + Q AWE  R   C  A
Sbjct: 149 KPSVNDDELDSIRKAHKKADDEIKSSWRNI----SPEIRKDLVEEQKAWEKQRNQRCRQA 204

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+ A   T  S +Y  C      ER + L+ Y
Sbjct: 205 ANAASNDTEASKLYMQCDTRMTKERVKNLQGY 236


>gi|313496672|gb|ADR58038.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 138

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 47/123 (38%), Gaps = 7/123 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   ++ A+   A A +  +  C+          C   +  + + +L++ Y  ++ ++  
Sbjct: 4   MAWLVLLAIVSGAQAGEEESTPCDNVENDQQTFACAAFNKQVAERELQSAYDDLVARMRD 63

Query: 61  HQ------RELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
                       E ++  W   R ++C       + G+ A  + + +C+   + ER E L
Sbjct: 64  QFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYL 123

Query: 114 ESY 116
            S 
Sbjct: 124 RSL 126


>gi|218887180|ref|YP_002436501.1| hypothetical protein DvMF_2090 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758134|gb|ACL09033.1| hypothetical protein DvMF_2090 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 356

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 29/104 (27%), Gaps = 13/104 (12%)

Query: 13  AIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           A   +  +  C E     A+   C     A +   L   Y     +            Q 
Sbjct: 116 AAPTEGPSFPCTEVRSGSAEAMVCDDAELAGLDRTLADVYAAARARSANEHPPFLRAEQR 175

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            W   R  EC  +A               C++   + R  +L++
Sbjct: 176 GWARGRD-ECWKSAD-----------RRTCVRDAYVLRIAELQA 207


>gi|300703272|ref|YP_003744874.1| hypothetical protein RCFBP_10940 [Ralstonia solanacearum CFBP2957]
 gi|299070935|emb|CBJ42241.1| conserved membrane protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 566

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 23/74 (31%), Gaps = 2/74 (2%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
           +T      Q  + +C +    A+   C+    A    +L A Y K               
Sbjct: 467 ITAPPAPSQQASFDCTKARSDAEHIICSDPELAAADVQLAAIYTKAKAAATDPIGFKERT 526

Query: 69  SQMAWEIYRGSECA 82
            +  W  YR  +C 
Sbjct: 527 -RAQW-NYRERQCH 538


>gi|170724057|ref|YP_001751745.1| hypothetical protein PputW619_4900 [Pseudomonas putida W619]
 gi|169762060|gb|ACA75376.1| protein of unknown function DUF1311 [Pseudomonas putida W619]
          Length = 138

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 53/134 (39%), Gaps = 8/134 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           M   ++ A+   A A +  +  C+          C   +    + +L + Y  +++++  
Sbjct: 4   MAWLVLLAIVSGAQAGEEESTPCDNVETDQQTFACAAFNKQTAERELNSAYDDLIQRMLD 63

Query: 59  ----EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
               E   +   E ++  W   R ++C     G + G+ A  + + +C+   + ER+E L
Sbjct: 64  QYGDEAGLQSQIESARKVWAQLRDADCKVETYGEQAGSKAFQIAWNSCIAQRSDERSEYL 123

Query: 114 ESYLTCPEGDLLCP 127
            S L     D   P
Sbjct: 124 RS-LGSQNSDEPAP 136


>gi|330504161|ref|YP_004381030.1| hypothetical protein MDS_3247 [Pseudomonas mendocina NK-01]
 gi|328918447|gb|AEB59278.1| hypothetical protein MDS_3247 [Pseudomonas mendocina NK-01]
          Length = 124

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 45/122 (36%), Gaps = 6/122 (4%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQ--CTGNSFALVKEKLEATYKKVLEKV 58
           M   +     +   + Q+     +     + M    C G  +   +++L+ TY +V+  +
Sbjct: 1   MGWLLALGAAVGFSSAQAAEDTEDPCQQGSAMAAFMCQGPVWKAAEQELQGTYDRVMASL 60

Query: 59  ---EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ-SMIYANCLQGHAIERNEKLE 114
              +         +Q  W   R  +C+  A    +G+       + C    A ER E L+
Sbjct: 61  KQYDPTFATELRDAQRLWVKLREQDCSLYARNRVQGSPWTGFWESECQAQQARERTEWLK 120

Query: 115 SY 116
           S+
Sbjct: 121 SF 122


>gi|328675920|gb|AEB28595.1| hypothetical protein FN3523_0738 [Francisella cf. novicida 3523]
          Length = 97

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 40/114 (35%), Gaps = 18/114 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + I+  L I+     +  + C+       +N C  +   +   KL             
Sbjct: 1   MKKHIVMTLAILPTLVLADKV-CD--GNTYQINACLKSQMQIYDTKLNDVQN-------- 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       ++ YR + C   +S  + GT Q++ Y NC+        ++L+
Sbjct: 50  -------HDIKNFKKYRDNLCYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 96


>gi|53720180|ref|YP_109166.1| hypothetical protein BPSL2569 [Burkholderia pseudomallei K96243]
 gi|167816932|ref|ZP_02448612.1| hypothetical protein Bpse9_17474 [Burkholderia pseudomallei 91]
 gi|167823585|ref|ZP_02455056.1| hypothetical protein Bpseu9_07892 [Burkholderia pseudomallei 9]
 gi|52210594|emb|CAH36577.1| putative exported protein [Burkholderia pseudomallei K96243]
          Length = 141

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 41/106 (38%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+    + + +    ++   E   
Sbjct: 32  LPASEVSALLADCD--SNQTSMNFCAWRDQLVAERELQQVVDQQISE-HPERKTALEAKV 88

Query: 71  MAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|237753195|ref|ZP_04583675.1| predicted protein [Helicobacter winghamensis ATCC BAA-430]
 gi|229375462|gb|EEO25553.1| predicted protein [Helicobacter winghamensis ATCC BAA-430]
          Length = 420

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 33/96 (34%), Gaps = 10/96 (10%)

Query: 20  ALNCNE-TLMQADMNQCTGNSFALVKEKLEATY-KKVLEKVEKHQRELFEKSQMAWEIYR 77
           + +C +  L + +   C           L A +   +       Q+   +K Q+ W   R
Sbjct: 232 SFDCEKQGLSKVEKGICNSFYTLRDDVSLNAMFEYALAFAWSNEQKSTLKKEQLQWLKKR 291

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +C  A +G E          +CL G    R  +L
Sbjct: 292 NIQCNNAENGKE--------LLHCLYGMINHRIREL 319


>gi|254470071|ref|ZP_05083475.1| hypothetical protein PJE062_4616 [Pseudovibrio sp. JE062]
 gi|211960382|gb|EEA95578.1| hypothetical protein PJE062_4616 [Pseudovibrio sp. JE062]
          Length = 161

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 33/92 (35%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M +C     AL ++ +  + K++     K  +    +S   W+ +R + C    +
Sbjct: 66  QTSMGMRECYSRETALWEKMISNSEKELRRNENKATKTELVESTRNWKAFRNNACNIPFA 125

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              +GT   ++   C          +L  + T
Sbjct: 126 MNPKGTLAPVLGMECFNRITALWALQLSEFAT 157


>gi|309378559|emb|CBX22831.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 337

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 256 EEAHVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAEYL 315

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 316 KLQCDTRMTRERIQYLRGY 334


>gi|168206517|ref|ZP_02632522.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
 gi|170662014|gb|EDT14697.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
          Length = 290

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 1/84 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
             + F  + + L   +  +   +   + +  +  Q+ W   R       +   +  + + 
Sbjct: 203 AKDYFDYLDKILNEEWADLRRVLTYKEFDKLKAEQINWIKERDRIAKEESDSNKNTSYRK 262

Query: 96  MIYANCLQGHAIERNEKL-ESYLT 118
           + Y         +R  +L E YL 
Sbjct: 263 VTYVIVQGKETEKRIRELNEKYLN 286


>gi|168215058|ref|ZP_02640683.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
 gi|170713520|gb|EDT25702.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
          Length = 290

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 1/84 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
             + F  + + L   +  +   +   + +  +  Q+ W   R       +   +  + + 
Sbjct: 203 AKDYFDYLDKVLNEEWADLRRVLTYKEFDKLKAEQINWIKERDRIAKEESDSNKNTSYRK 262

Query: 96  MIYANCLQGHAIERNEKL-ESYLT 118
           + Y         +R  +L E YL 
Sbjct: 263 VTYVIVQGKETEKRIRELNEKYLN 286


>gi|126462627|ref|YP_001043741.1| hypothetical protein Rsph17029_1865 [Rhodobacter sphaeroides ATCC
          17029]
 gi|126104291|gb|ABN76969.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC
          17029]
          Length = 225

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 18/58 (31%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +C+      +   C+  + A +   +   Y           R+ F   Q AW   R 
Sbjct: 22 FDCSRAGTMVEHAICSDPALAALDRDVAQAYGAARAGQPPAVRDQFLAEQRAWLAARD 79


>gi|257125525|ref|YP_003163639.1| hypothetical protein Lebu_0740 [Leptotrichia buccalis C-1013-b]
 gi|257049464|gb|ACV38648.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 172

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 32/87 (36%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
            ADMN        L++ +++  Y  +  K+   ++   +K Q  W+         A    
Sbjct: 78  TADMNNAVSKQEELLEAEMKKVYGLLEAKLSDSEKAKLKKEQEDWKKEVEKNVDEATKEV 137

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLES 115
           E GT   ++  N       ER  +L  
Sbjct: 138 EGGTISGVMGGNAWVTKTEERALELAK 164


>gi|76811342|ref|YP_332628.1| hypothetical protein BURPS1710b_1217 [Burkholderia pseudomallei
           1710b]
 gi|76580795|gb|ABA50270.1| putative exported protein [Burkholderia pseudomallei 1710b]
          Length = 199

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E  F  +
Sbjct: 11  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHFVRA 70

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 71  VYETTQGTMYAMANADMRLQPVRERALALRG 101



 Score = 38.2 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 134 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 180

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 181 LIGARVATLKRF 192


>gi|261400020|ref|ZP_05986145.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269210241|gb|EEZ76696.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 337

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 256 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAEYL 315

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 316 KLQCDTRMTRERIQYLRGY 334


>gi|156932436|ref|YP_001436352.1| hypothetical protein ESA_00215 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530690|gb|ABU75516.1| hypothetical protein ESA_00215 [Cronobacter sakazakii ATCC BAA-894]
          Length = 141

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 37/112 (33%), Gaps = 16/112 (14%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           +++C+      D   C           L   YK  +  +   Q+++ + +Q++W   R  
Sbjct: 37  SMSCDNPRSPYDTTYCAALEMVQGDRDLNQQYKNTMSVLSPAQKQVVKNAQISWLKVRDH 96

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY------LTCPEGDLL 125
           ECA            S +   C       R   L+S         C + DL 
Sbjct: 97  ECAE----------GSTLLLGCANEKMAARIALLKSIERECRNAGCNDADLS 138


>gi|271502422|ref|YP_003335448.1| hypothetical protein Dd586_3912 [Dickeya dadantii Ech586]
 gi|270345977|gb|ACZ78742.1| conserved hypothetical protein [Dickeya dadantii Ech586]
          Length = 254

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 42/128 (32%), Gaps = 27/128 (21%)

Query: 1   MCRKII-----FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M R +       A+  +A+   + +  C +     +   C   + + + ++L   ++K  
Sbjct: 1   MKRLLATWLLPLAVGCVALPSLAASFPCQQASSAQEKLICQTPALSQLDDELAKEWQKSR 60

Query: 56  EKVEKHQREL-----FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
             +  +   +       + Q +W   R + C                   CL+    ++ 
Sbjct: 61  AFLTGNAERVAQDKILTQFQRSWLSSRNT-CRDEE---------------CLRQSYQQQL 104

Query: 111 EKLESYLT 118
            +L  YL 
Sbjct: 105 NRLR-YLN 111


>gi|298369589|ref|ZP_06980906.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282146|gb|EFI23634.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 339

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 26/81 (32%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                     ++   +      ++K  ++     Q +W   +   CA AA+ A+      
Sbjct: 260 AREQNRKADSEINRIW----GGMDKTIQQGMLAEQRSWIQSKKQNCAQAAAEADNPAQAE 315

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 316 YLRLQCDTRMTRERVQYLRGY 336


>gi|296315144|ref|ZP_06865085.1| hypothetical protein NEIPOLOT_02324 [Neisseria polysaccharea ATCC
           43768]
 gi|296837950|gb|EFH21888.1| hypothetical protein NEIPOLOT_02324 [Neisseria polysaccharea ATCC
           43768]
          Length = 338

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|153878247|ref|ZP_02004531.1| hypothetical protein BGP_6090 [Beggiatoa sp. PS]
 gi|152065289|gb|EDN65469.1| hypothetical protein BGP_6090 [Beggiatoa sp. PS]
          Length = 78

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 26/59 (44%)

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             Q++L + +Q  W  +R   CAF       GT  +   + C +    +R   L++ LT
Sbjct: 13  MEQKQLLKIAQTDWLRFREQHCAFVTFLNRGGTGFTAYESECFEQLTKQRIITLKNALT 71


>gi|197103619|ref|YP_002128996.1| hypothetical protein PHZ_c0153 [Phenylobacterium zucineum HLK1]
 gi|196477039|gb|ACG76567.1| hypothetical protein PHZ_c0153 [Phenylobacterium zucineum HLK1]
          Length = 275

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/107 (9%), Positives = 28/107 (26%), Gaps = 16/107 (14%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           ++      + +C     +++   C     A +  +L+  +++ +              Q 
Sbjct: 184 VSAPAPRPSFDCRYAGTRSERMVCGDPRLAGLDRRLDRAFERAV--AAGIPYRELRAEQD 241

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            W   R      +    E                  +R  +L+    
Sbjct: 242 DWLAIREDAARHSPDAVES--------------VYRQRIAELDDLAD 274


>gi|291535308|emb|CBL08420.1| Protein of unknown function (DUF1311) [Roseburia intestinalis
           M50/1]
          Length = 330

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 28/87 (32%), Gaps = 1/87 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF-A 84
              Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +        
Sbjct: 125 AQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILAEQRNWIAMKEEVTLLHI 184

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNE 111
            S  E G+   ++  + L+     R  
Sbjct: 185 GSYEENGSMYPLLQNSYLEEITKNRAY 211


>gi|240144973|ref|ZP_04743574.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
 gi|257202964|gb|EEV01249.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
          Length = 336

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 28/87 (32%), Gaps = 1/87 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF-A 84
              Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +        
Sbjct: 131 AQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILAEQRNWIAMKEEVTLLHI 190

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNE 111
            S  E G+   ++  + L+     R  
Sbjct: 191 GSYEENGSMYPLLQNSYLEEITKNRAY 217


>gi|120608749|ref|YP_968427.1| hypothetical protein Aave_0036 [Acidovorax citrulli AAC00-1]
 gi|120587213|gb|ABM30653.1| hypothetical protein Aave_0036 [Acidovorax citrulli AAC00-1]
          Length = 147

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 39/126 (30%), Gaps = 15/126 (11%)

Query: 5   IIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           ++FA  I   +  +              QA M  C     A  ++ L          + K
Sbjct: 14  LLFASFIATASAHATEERALREACSAFSQAGMRDCLSKKAADSQDDLRQARNDATSALSK 73

Query: 61  HQREL---------FEKSQMAWEIYRGSECAFAASGAEEGTA--QSMIYANCLQGHAIER 109
              +             S   +E YR + C F AS +  G    + ++ + C+      R
Sbjct: 74  WDEDAQYTGRAKAELTASDKVFEKYRDAHCKFRASLSGGGAGNSREILRSACIAELNGIR 133

Query: 110 NEKLES 115
             +L  
Sbjct: 134 ARQLRD 139


>gi|325293304|ref|YP_004279168.1| hypothetical protein AGROH133_07094 [Agrobacterium sp. H13-3]
 gi|325061157|gb|ADY64848.1| hypothetical protein AGROH133_07094 [Agrobacterium sp. H13-3]
          Length = 121

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 34/110 (30%), Gaps = 16/110 (14%)

Query: 5   IIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           I+ A   +     + + +C +      +   C   +      K+  T+  + + +    R
Sbjct: 16  ILLACASLGSPANAASFDCTKPDLAADEKAICDNRALNDQDVKMVTTFDILTQLMAMGAR 75

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +   + Q  W   R  EC                   C+     ER ++L
Sbjct: 76  DTLREEQSQWLKKR-QECNAD--------------VACITSAYEERMKRL 110


>gi|313667395|ref|YP_004047679.1| lipoprotein [Neisseria lactamica ST-640]
 gi|313004857|emb|CBN86283.1| putative lipoprotein [Neisseria lactamica 020-06]
          Length = 338

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|15889210|ref|NP_354891.1| hypothetical protein Atu1916 [Agrobacterium tumefaciens str. C58]
 gi|15157035|gb|AAK87676.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 116

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 41/110 (37%), Gaps = 17/110 (15%)

Query: 5   IIFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           I+FA ++++ A  + + +C ++     +   C   +      K+  T+  + + +    R
Sbjct: 12  ILFATSLLSPA-SAASFDCTKSDLAADEKAICDNRALNDQDVKMATTFDILTQLMAMGAR 70

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +     Q  W   R  ECA                  CL G   ER ++L
Sbjct: 71  DTLRDEQSKWLKKR-QECAAD--------------VACLTGAYEERMKRL 105


>gi|167918025|ref|ZP_02505116.1| hypothetical protein BpseBC_05688 [Burkholderia pseudomallei
           BCC215]
 gi|254190796|ref|ZP_04897303.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938471|gb|EDO94141.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 239

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 51  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 110

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 111 VYETTQGTMYAMANADMRLQPVRERALALRG 141



 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 174 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 220

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 221 LIGARVATLKRF 232


>gi|126440468|ref|YP_001058109.1| hypothetical protein BURPS668_1059 [Burkholderia pseudomallei 668]
 gi|167814743|ref|ZP_02446423.1| hypothetical protein Bpse9_06347 [Burkholderia pseudomallei 91]
 gi|167893295|ref|ZP_02480697.1| hypothetical protein Bpse7_05985 [Burkholderia pseudomallei 7894]
 gi|254181398|ref|ZP_04887995.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|126219961|gb|ABN83467.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|184211936|gb|EDU08979.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 236

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 48  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 107

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 108 VYETTQGTMYAMANADMRLQPVRERALALRG 138



 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 171 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 217

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 218 LIGARVATLKRF 229


>gi|53718646|ref|YP_107632.1| hypothetical protein BPSL1004 [Burkholderia pseudomallei K96243]
 gi|53725201|ref|YP_102486.1| hypothetical protein BMA0716 [Burkholderia mallei ATCC 23344]
 gi|126450832|ref|YP_001081154.1| hypothetical protein BMA10247_1610 [Burkholderia mallei NCTC 10247]
 gi|126455025|ref|YP_001065345.1| hypothetical protein BURPS1106A_1065 [Burkholderia pseudomallei
           1106a]
 gi|167003041|ref|ZP_02268831.1| hypothetical protein BMAPRL20_A0728 [Burkholderia mallei PRL-20]
 gi|167901753|ref|ZP_02488958.1| hypothetical protein BpseN_05700 [Burkholderia pseudomallei NCTC
           13177]
 gi|167909992|ref|ZP_02497083.1| hypothetical protein Bpse112_05831 [Burkholderia pseudomallei 112]
 gi|254298279|ref|ZP_04965731.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52209060|emb|CAH35000.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|52428624|gb|AAU49217.1| hypothetical protein BMA0716 [Burkholderia mallei ATCC 23344]
 gi|126228667|gb|ABN92207.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126243702|gb|ABO06795.1| hypothetical protein BMA10247_1610 [Burkholderia mallei NCTC 10247]
 gi|157808157|gb|EDO85327.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|243061346|gb|EES43532.1| hypothetical protein BMAPRL20_A0728 [Burkholderia mallei PRL-20]
          Length = 240

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 52  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 111

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 112 VYETTQGTMYAMANADMRLQPVRERALALRG 142



 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 175 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 221

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 222 LIGARVATLKRF 233


>gi|134281016|ref|ZP_01767725.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134247322|gb|EBA47407.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 238

 Score = 57.5 bits (137), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 50  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 109

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 110 VYETTQGTMYAMANADMRLQPVRERALALRG 140



 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 173 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 219

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 220 LIGARVATLKRF 231


>gi|121600798|ref|YP_993606.1| hypothetical protein BMASAVP1_A2297 [Burkholderia mallei SAVP1]
 gi|124385213|ref|YP_001028933.1| hypothetical protein BMA10229_A2989 [Burkholderia mallei NCTC
           10229]
 gi|226194328|ref|ZP_03789926.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242316992|ref|ZP_04816008.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254178304|ref|ZP_04884959.1| hypothetical protein BMA10399_E0213 [Burkholderia mallei ATCC
           10399]
 gi|254199390|ref|ZP_04905756.1| hypothetical protein BMAFMH_C0215 [Burkholderia mallei FMH]
 gi|254205704|ref|ZP_04912056.1| hypothetical protein BMAJHU_C0224 [Burkholderia mallei JHU]
 gi|254357865|ref|ZP_04974138.1| hypothetical protein BMA721280_A1261 [Burkholderia mallei
           2002721280]
 gi|121229608|gb|ABM52126.1| hypothetical protein BMASAVP1_A2297 [Burkholderia mallei SAVP1]
 gi|124293233|gb|ABN02502.1| hypothetical protein BMA10229_A2989 [Burkholderia mallei NCTC
           10229]
 gi|147748986|gb|EDK56060.1| hypothetical protein BMAFMH_C0215 [Burkholderia mallei FMH]
 gi|147753147|gb|EDK60212.1| hypothetical protein BMAJHU_C0224 [Burkholderia mallei JHU]
 gi|148026992|gb|EDK85013.1| hypothetical protein BMA721280_A1261 [Burkholderia mallei
           2002721280]
 gi|160699343|gb|EDP89313.1| hypothetical protein BMA10399_E0213 [Burkholderia mallei ATCC
           10399]
 gi|225933413|gb|EEH29402.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242140231|gb|EES26633.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 242

 Score = 57.5 bits (137), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 54  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 113

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 114 VYETTQGTMYAMANADMRLQPVRERALALRG 144



 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 177 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 223

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 224 LIGARVATLKRF 235


>gi|254196281|ref|ZP_04902705.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653024|gb|EDS85717.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 240

 Score = 57.5 bits (137), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 36/91 (39%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 52  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 111

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT   M  A+       ER   L  
Sbjct: 112 VYETTQGTMYVMANADMRLQPVRERALALRG 142



 Score = 39.0 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 175 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 221

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 222 LIGARVATLKRF 233


>gi|300696822|ref|YP_003747483.1| hypothetical protein RCFBP_mp10276 [Ralstonia solanacearum
           CFBP2957]
 gi|299073546|emb|CBJ53066.1| exported protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 115

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 34/96 (35%), Gaps = 14/96 (14%)

Query: 33  NQCTGNSFALVKEKLEATYKKVLEKVEK-------------HQRELFEKSQMAWEIYRGS 79
             C       + +++E  + + L +++                R  F ++Q  W  YR +
Sbjct: 18  AYCYAAESERLDKEVEVLFAEKLRQLDSLPKALAVSKELQREVRHNFTEAQAHWTAYRDA 77

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C F       GT +   Y++C       R   LE+
Sbjct: 78  ACRFEGDSNL-GTGRPRAYSSCRIELDKRRIADLEA 112


>gi|167718582|ref|ZP_02401818.1| hypothetical protein BpseD_06137 [Burkholderia pseudomallei DM98]
          Length = 195

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 7   SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 66

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 67  VYETTQGTMYAMANADMRLQPVRERALALRG 97



 Score = 38.6 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 130 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 176

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 177 LIGARVATLKRF 188


>gi|291538106|emb|CBL11217.1| Protein of unknown function (DUF1311) [Roseburia intestinalis
           XB6B4]
          Length = 333

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 28/87 (32%), Gaps = 1/87 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS-ECAFA 84
              Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +        
Sbjct: 128 AQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILTEQRNWIDMKEEVTLLDI 187

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNE 111
            S  E G+   ++  + L+     R  
Sbjct: 188 GSYEENGSMYPLLQNSYLEEITKNRAY 214


>gi|167572067|ref|ZP_02364941.1| hypothetical protein BoklC_19664 [Burkholderia oklahomensis C6786]
          Length = 267

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 33/127 (25%), Gaps = 21/127 (16%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   +  ALT  A   ++ + +C      A+   C   +   +  ++ A Y+ +      
Sbjct: 1   MAAALGAALTFGAPFVRAASFDCARAASAAERAVCNTPALGELDVRMAAYYEILQHAHPA 60

Query: 61  HQ-------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            +       R+     Q  W       C                  +CL      R   L
Sbjct: 61  EEGMAYREFRDALRDEQQNWRQRVRDACGART--------------DCLTSAYTARIAAL 106

Query: 114 ESYLTCP 120
                  
Sbjct: 107 RGVADAR 113


>gi|257126362|ref|YP_003164476.1| hypothetical protein Lebu_1613 [Leptotrichia buccalis C-1013-b]
 gi|257050301|gb|ACV39485.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 146

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 27/84 (32%), Gaps = 2/84 (2%)

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA--SGAEEGTAQSMIY 98
               ++L   Y+K+++      +     +Q AW   R  +   +      E G+   +  
Sbjct: 62  EEWDKELNIVYQKIMKIANTKTKNNLRNAQRAWLKSRDKKVHDSYYFENPEGGSMGVLFS 121

Query: 99  ANCLQGHAIERNEKLESYLTCPEG 122
            N       +R  +L        G
Sbjct: 122 LNTNVKLLEQRTLELAEMYDRLTG 145


>gi|237811328|ref|YP_002895779.1| hypothetical protein GBP346_A1057 [Burkholderia pseudomallei
           MSHR346]
 gi|237506090|gb|ACQ98408.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 239

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 52  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 111

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 112 VYETTQGTMYAMANADMRLQPVRERALALRG 142



 Score = 38.6 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 174 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 220

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 221 LIGARVATLKRF 232


>gi|218508513|ref|ZP_03506391.1| hypothetical protein RetlB5_13529 [Rhizobium etli Brasil 5]
          Length = 117

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 40/109 (36%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  L I +   Q+ + +C+ + L   +   C   +      K+  +++ +   +    R 
Sbjct: 13  LTILAITSGMAQAASFDCDGKELKPDEKVICDNRALNDADVKMATSFELLSGLLAMGSRG 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A+              CL+    ER ++L
Sbjct: 73  TLQDEQTAWLKKR-QECGADAA--------------CLKAAYEERLKQL 106


>gi|299135203|ref|ZP_07028394.1| Protein of unknown function DUF2091, periplasmic [Afipia sp. 1NLS2]
 gi|298590180|gb|EFI50384.1| Protein of unknown function DUF2091, periplasmic [Afipia sp. 1NLS2]
          Length = 213

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 26/95 (27%), Gaps = 13/95 (13%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C       +   C   + A++  +         E     Q  + +  Q +W   R  E
Sbjct: 33  FDCARAEAPIEKLICGNPTLAMLDRETTRVLTLTREDASVSQPNILKD-QDSWLKQRN-E 90

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           C  +                CL    + R   L +
Sbjct: 91  CMTSTDKER-----------CLADSYVGRISALRA 114


>gi|217419704|ref|ZP_03451210.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|217397008|gb|EEC37024.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
          Length = 236

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 48  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 107

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 108 VYETTQGTMYAMANADMRLQPVRERALALRG 138



 Score = 38.6 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 171 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 217

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 218 LIGARVATLKRF 229


>gi|156935155|ref|YP_001439071.1| hypothetical protein ESA_03006 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533409|gb|ABU78235.1| hypothetical protein ESA_03006 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 49/139 (35%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSF-----------ALVKEKLEAT 50
            ++I+  + ++ IA  S+A +  +      ++QC    +              + +L+  
Sbjct: 1   MKRIMAIIPLLMIATASLAADEKDITSDNAVDQCLDKYYEFSSECLEDLNDKTEAELKKA 60

Query: 51  YKKVLEKVEKHQR---------------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           Y+  L+ +E+                  E F KSQ  W  YR   C  A + A+      
Sbjct: 61  YETKLKSLERVDYTKWWMGDEDRKKRMIEAFRKSQRDWLTYRDGYCDVATTAAQGTHFLG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C       R ++++
Sbjct: 121 AASVGCNINMNKRRIKEIQ 139


>gi|167737610|ref|ZP_02410384.1| hypothetical protein Bpse14_06065 [Burkholderia pseudomallei 14]
          Length = 204

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 16  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 75

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 76  VYETTQGTMYAMANADMRLQPVRERALALRG 106



 Score = 38.6 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 139 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 185

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 186 LIGARVATLKRF 197


>gi|167844762|ref|ZP_02470270.1| hypothetical protein BpseB_05683 [Burkholderia pseudomallei B7210]
          Length = 205

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 17  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 76

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 77  VYETTQGTMYAMANADMRLQPVRERALALRG 107



 Score = 38.2 bits (87), Expect = 0.34,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 140 FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 186

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 187 LIGARVATLKRF 198


>gi|313650081|gb|EFS14494.1| hypothetical protein SF2457T_1388 [Shigella flexneri 2a str. 2457T]
          Length = 115

 Score = 57.1 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 36/105 (34%), Gaps = 15/105 (14%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLE-----------KVEKHQRELFEKSQMAWEIYRGSE 80
           +  C    + LV  +L   Y +              K++  Q  L +KSQ AW  +R  E
Sbjct: 2   IKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKE 61

Query: 81  CAFAASGAE----EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           C    S  +            + +C+      R  +L+ Y    +
Sbjct: 62  CELILSNEDVQDLSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 106


>gi|260889231|ref|ZP_05900494.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260861291|gb|EEX75791.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 144

 Score = 57.1 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 43/132 (32%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNET-----------------LMQADMNQCTGNSFALVK 44
            +K++  + ++ +   + A    +                     ADM   +       +
Sbjct: 6   MKKVLLIIGMLLVGAVAFAGKYEDGLKERMKVAEERLESKFEGTTADMLNASSELTDEWE 65

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           +++   Y  +L+K+   ++  F+  Q  W   R +    A +  E+G        A    
Sbjct: 66  KEMNKVYDLILKKLPVKEQSKFKAEQTKWLNDRKAAIKKALADEEDGPKMAVFGAAGTGL 125

Query: 104 GHAIERNEKLES 115
               ER  KL  
Sbjct: 126 SMTEERALKLAK 137


>gi|330503500|ref|YP_004380369.1| hypothetical protein MDS_2587 [Pseudomonas mendocina NK-01]
 gi|328917787|gb|AEB58618.1| hypothetical protein MDS_2587 [Pseudomonas mendocina NK-01]
          Length = 129

 Score = 57.1 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 8/103 (7%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE---KHQRELFEKSQMAWEI 75
             L+ +  +  A +  C        K+++   Y+++  K++       E  + +Q AW +
Sbjct: 29  ACLDASGMINNASVAGCAEGVSETAKKEMNRIYQQLFLKLQKSAPEDAEQLQAAQKAWLV 88

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           YR  +C             S +Y  C     I+R ++L+  L 
Sbjct: 89  YRNGQCDLQGKH-----IGSPMYYTCPMELNIQRLDELKFLLE 126


>gi|325578894|ref|ZP_08148912.1| hypothetical protein HMPREF9417_1653 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159541|gb|EGC71674.1| hypothetical protein HMPREF9417_1653 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 115

 Score = 57.1 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + +I   +II +   +   NC++        +C  N+    K++L  ++++++   E 
Sbjct: 1   MKKFLIALCSIILL--TAANKNCDD-------IECHKNNIEEYKKELNKSFQELVRVDEN 51

Query: 61  H-QRELFEKSQMAWEIYRGSECAFAASGAE--EGTAQSMIYANCLQGHAIERNEKLESYL 117
               + F++SQM W  +   +C F  S     +G    ++Y  CL+ +   R +++   +
Sbjct: 52  KLVVDSFKESQMLWNKFIKEDCKFMNSPMSFTQGDGYIIVYYECLEDYYNIRIKQINKMI 111

Query: 118 T 118
            
Sbjct: 112 N 112


>gi|85702811|ref|ZP_01033915.1| hypothetical protein ROS217_18757 [Roseovarius sp. 217]
 gi|85671739|gb|EAQ26596.1| hypothetical protein ROS217_18757 [Roseovarius sp. 217]
          Length = 315

 Score = 57.1 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN   G      + +L A   +   K+     +   + Q  W  +  ++    A
Sbjct: 218 PRTQMGMNLSMGGELHDEEAQLAAAMDEA-TKLHGIDLKALTELQNRWIEWADAQANLVA 276

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           S   EG+   M++A+     A ER+E+++  ++
Sbjct: 277 SQVAEGSMYPMVWASERATIARERHEQVKRLIS 309


>gi|302878718|ref|YP_003847282.1| hypothetical protein Galf_1499 [Gallionella capsiferriformans ES-2]
 gi|302581507|gb|ADL55518.1| hypothetical protein Galf_1499 [Gallionella capsiferriformans ES-2]
          Length = 130

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 46/125 (36%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIA---FQSMALNCNE---TLMQADMNQCTGN-SFALVKEKLEATYKKVLEK 57
           +  AL+++  +     +  LNC++            C    +     + L   Y+ ++  
Sbjct: 7   LFIALSVMLSSPRGAMAEELNCDQFLEGSTPW--ASCNNYNASVDADKDLNDAYRNLMTV 64

Query: 58  VEK----HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           + K      ++    +Q AW I+R  EC F+           +  + C+     +R E +
Sbjct: 65  MNKPAWREAKKKLIAAQRAWIIFRDRECEFSQELIGGSNH--VNQSECIADMTEKRAEYI 122

Query: 114 ESYLT 118
           +S   
Sbjct: 123 KSLYE 127


>gi|323165332|gb|EFZ51120.1| hypothetical protein SS53G_4432 [Shigella sonnei 53G]
          Length = 115

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 35/105 (33%), Gaps = 15/105 (14%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSE 80
           +  C    + LV  +L   Y +    +           +  Q  L +KSQ AW  +R  E
Sbjct: 2   IKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKE 61

Query: 81  CAFAASGAE----EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           C    S  +            + +C+      R  +L+ Y    +
Sbjct: 62  CELILSNEDVQDLSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 106


>gi|332162923|ref|YP_004299500.1| hypothetical protein YE105_C3303 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|325667153|gb|ADZ43797.1| hypothetical protein YE105_C3303 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862331|emb|CBX72491.1| hypothetical protein YEW_GP28220 [Yersinia enterocolitica W22703]
          Length = 329

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 24/74 (32%), Gaps = 3/74 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
             L ++ ++  S A+NC       +   C       + +     Y+ +L K +      
Sbjct: 7  FLFLLMMVVSSSSFAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQAMLVKYDTETVYQ 66

Query: 66 FEKSQMAWEIYRGS 79
            ++   W     S
Sbjct: 67 QRQA---WIKALNS 77


>gi|167564864|ref|ZP_02357780.1| hypothetical protein BoklE_20080 [Burkholderia oklahomensis EO147]
          Length = 267

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 33/127 (25%), Gaps = 21/127 (16%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   +  ALT  A   ++ + +C      A+   C   +   +  ++ A Y+ +      
Sbjct: 1   MAAALGAALTFGAPFVRAASFDCARAASAAERAVCNTPALGELDVRMAAYYEILQHAHPA 60

Query: 61  HQ-------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            +       R+     Q  W       C                  +CL      R   L
Sbjct: 61  EEGMAYREFRDALRDEQQNWRQRVRDACGART--------------DCLASAYTARIAAL 106

Query: 114 ESYLTCP 120
                  
Sbjct: 107 RGVADAR 113


>gi|238762380|ref|ZP_04623351.1| hypothetical protein ykris0001_26240 [Yersinia kristensenii ATCC
          33638]
 gi|238699365|gb|EEP92111.1| hypothetical protein ykris0001_26240 [Yersinia kristensenii ATCC
          33638]
          Length = 329

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 27/70 (38%), Gaps = 3/70 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          +F L ++ I+  S+A+NC       +   C       + +     Y+ +L K +      
Sbjct: 7  VFFLLLMIISSSSLAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQAMLVKYDTETVYQ 66

Query: 66 FEKSQMAWEI 75
            ++   WE 
Sbjct: 67 QRQA---WEK 73


>gi|329297928|ref|ZP_08255264.1| hypothetical protein Pstas_17950 [Plautia stali symbiont]
          Length = 136

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS--EC 81
           N+    A M+QC   +     +++ A Y ++++K+    ++    +Q AW  YR S  + 
Sbjct: 27  NKESSTAGMSQCYSTANKAWDKEMNAQYSQLMKKLTGEPKDKLRNAQRAWLAYRDSWTDA 86

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + +   + +G+  ++            +   L+S
Sbjct: 87  SRSYFLSSQGSMAALSVGAQGVSLVRNQALMLQS 120


>gi|317405081|gb|EFV85427.1| hypothetical protein HMPREF0005_04235 [Achromobacter xylosoxidans
          C54]
          Length = 229

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 8/60 (13%), Positives = 20/60 (33%)

Query: 19 MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           + +C +    A+   C     A +   +   Y +  + ++    E   + Q  +   R 
Sbjct: 30 PSFDCAKARAGAEKAICANPQLAALDASIAKRYDEARKSLDAATAEALARDQRYFAKVRD 89


>gi|66391830|ref|YP_238755.1| hypothetical protein PHG31p26 [Aeromonas phage 31]
 gi|62114667|gb|AAX63515.1| hypothetical protein PHG31p26 [Aeromonas phage 31]
          Length = 221

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 39/121 (32%), Gaps = 23/121 (19%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M    + AL +++ +  + + +CN   L   +   C     +++ ++L   YK V     
Sbjct: 1   MKFLSVIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMMDQQLADAYKVVRH--- 57

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
                  +  Q  +   R       ++ +             L+    +R  +LE     
Sbjct: 58  ---IPEVKADQKTFIKDRN------SAPSLGD----------LKDLMRDRIIELEIIAEL 98

Query: 120 P 120
            
Sbjct: 99  E 99


>gi|294339946|emb|CAZ88309.1| hypothetical protein; putative exported protein [Thiomonas sp. 3As]
          Length = 135

 Score = 56.7 bits (135), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 47/128 (36%), Gaps = 11/128 (8%)

Query: 6   IFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYK-KVLEKVEK 60
           +  LT    A  ++ +     C   L Q     C   +   + E++   Y  ++ + +  
Sbjct: 11  LLVLTCFGQAQAAIEVKTPPIC---LSQPRSADCAAQTRRALNERMTHLYHLELQKVMGT 67

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAE-EGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +     + +Q  W  +  +EC F     +    A S    +CL G    R  +L+ +L C
Sbjct: 68  YTERRLDHAQNLWRRWANAECEFRNGPPDWPNAAWSTRQDDCLSGMIRRRIAQLDGFLHC 127

Query: 120 PEGDLLCP 127
                 CP
Sbjct: 128 S--GATCP 133


>gi|254284847|ref|ZP_04959814.1| probable urease-associated protein, putative [Vibrio cholerae
           AM-19226]
 gi|150425632|gb|EDN17408.1| probable urease-associated protein, putative [Vibrio cholerae
           AM-19226]
          Length = 135

 Score = 56.7 bits (135), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 41/126 (32%), Gaps = 11/126 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M + + F   I + +  + A + C+ TL    +  C  N        L  +Y  + + V 
Sbjct: 1   MLKYLFFIGFIFSSSASASASDECDYTLPLGSIVACYENKNEESDAVLNKSYNDLKKLVM 60

Query: 60  KHQRE---------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIER 109
               +            KSQ  W   R S+C       E GT  Q +    CL      R
Sbjct: 61  GSPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGTDLQRIEIKKCLFLSTEIR 120

Query: 110 NEKLES 115
              L  
Sbjct: 121 VLYLNE 126


>gi|289661662|ref|ZP_06483243.1| hypothetical protein XcampvN_00830 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 392

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 33/93 (35%), Gaps = 12/93 (12%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +     +   C   + A + ++L+  Y++VLE   +         Q  W   R + 
Sbjct: 28  FDCKQVSTPVEKRLCAVPALANLDDQLDEAYRRVLEATPRASIAAVRDQQRTWLRQRNA- 86

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           CA  A              +CLQ     R + L
Sbjct: 87  CAQDAKL-----------DDCLQRSLKARVDVL 108


>gi|308388305|gb|ADO30625.1| putative lipoprotein [Neisseria meningitidis alpha710]
 gi|325137152|gb|EGC59747.1| putative lipoprotein [Neisseria meningitidis M0579]
 gi|325201271|gb|ADY96725.1| putative lipoprotein [Neisseria meningitidis M01-240149]
 gi|325205189|gb|ADZ00642.1| putative lipoprotein [Neisseria meningitidis M04-240196]
 gi|325207130|gb|ADZ02582.1| putative lipoprotein [Neisseria meningitidis NZ-05/33]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|325131129|gb|EGC53850.1| putative lipoprotein [Neisseria meningitidis OX99.30304]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|83718664|ref|YP_441418.1| hypothetical protein BTH_I0862 [Burkholderia thailandensis E264]
 gi|167580186|ref|ZP_02373060.1| hypothetical protein BthaT_18685 [Burkholderia thailandensis TXDOH]
 gi|167618290|ref|ZP_02386921.1| hypothetical protein BthaB_18426 [Burkholderia thailandensis Bt4]
 gi|257139907|ref|ZP_05588169.1| hypothetical protein BthaA_12005 [Burkholderia thailandensis E264]
 gi|83652489|gb|ABC36552.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 238

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++++      R  +++SQ  W  +R  E     +
Sbjct: 51  SSTAGQIQCMDEARQQWQGEVDAAYQRLVKTAPADARRGWQESQRRWLAWRKDEAHLVRA 110

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       ER   L  
Sbjct: 111 VYETTQGTMYAMASADMRLQPVRERALALRG 141



 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++    R+    +Q  W  +  +                ++       
Sbjct: 173 FDMNRYYEKLRARMPADSRQTLVAAQREWAAFSDA-------------MTPLVSEGERVD 219

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 220 LIGARVATLKRF 231


>gi|325197385|gb|ADY92841.1| putative lipoprotein [Neisseria meningitidis G2136]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|295687707|ref|YP_003591400.1| hypothetical protein Cseg_0262 [Caulobacter segnis ATCC 21756]
 gi|295429610|gb|ADG08782.1| conserved hypothetical protein [Caulobacter segnis ATCC 21756]
          Length = 113

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 27/99 (27%), Gaps = 15/99 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   S      +++  Y      V    R+     Q AW   R +
Sbjct: 22  SFDCGKARAADERAICANRSLNDQDVRVDQLYGITRHLVPMGGRDAIIGDQRAWLKSRHA 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            C    +              CL      R  +L   + 
Sbjct: 82  -CGANRA--------------CLARSYDRRLVELNQVMD 105


>gi|325203210|gb|ADY98663.1| putative lipoprotein [Neisseria meningitidis M01-240355]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|259907303|ref|YP_002647659.1| hypothetical protein EpC_06270 [Erwinia pyrifoliae Ep1/96]
 gi|224962925|emb|CAX54406.1| uncharacterized protein [Erwinia pyrifoliae Ep1/96]
          Length = 260

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 32/101 (31%), Gaps = 19/101 (18%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF----EKSQMAWE 74
            + +C +   +++   C     + + + +   ++      +             SQ AW 
Sbjct: 171 PSFDCGKAQAESEKAICADYRLSSLDKSVFDAWRVAKALAKDVANTELLATVVASQKAWL 230

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + R  +C         G+        CL     ER EKL  
Sbjct: 231 MNRN-QC---------GSDP-----QCLAKSMTERMEKLAE 256


>gi|254356073|ref|ZP_04972350.1| hypothetical protein BMA721280_M0169 [Burkholderia mallei
           2002721280]
 gi|148025056|gb|EDK83225.1| hypothetical protein BMA721280_M0169 [Burkholderia mallei
           2002721280]
          Length = 380

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 128 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 187

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 188 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 221


>gi|254203387|ref|ZP_04909748.1| hypothetical protein BMAFMH_G0127 [Burkholderia mallei FMH]
 gi|147745626|gb|EDK52705.1| hypothetical protein BMAFMH_G0127 [Burkholderia mallei FMH]
          Length = 376

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 124 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 183

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 184 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 217


>gi|121598039|ref|YP_990453.1| hypothetical protein BMASAVP1_0853 [Burkholderia mallei SAVP1]
 gi|121225837|gb|ABM49368.1| hypothetical protein BMASAVP1_0853 [Burkholderia mallei SAVP1]
          Length = 390

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 138 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 197

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 198 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 231


>gi|121633964|ref|YP_974209.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|120865670|emb|CAM09394.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|261391629|emb|CAX49071.1| hypothetical lipoprotein [Neisseria meningitidis 8013]
 gi|325129132|gb|EGC51980.1| putative lipoprotein [Neisseria meningitidis N1568]
 gi|325133159|gb|EGC55830.1| putative lipoprotein [Neisseria meningitidis M6190]
 gi|325138775|gb|EGC61327.1| putative lipoprotein [Neisseria meningitidis ES14902]
 gi|325145418|gb|EGC67694.1| putative lipoprotein [Neisseria meningitidis M01-240013]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|254182744|ref|ZP_04889337.1| hypothetical protein BURPS1655_C0417 [Burkholderia pseudomallei
           1655]
 gi|184213278|gb|EDU10321.1| hypothetical protein BURPS1655_C0417 [Burkholderia pseudomallei
           1655]
          Length = 359

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 34/126 (26%), Gaps = 25/126 (19%)

Query: 1   MCRKIIFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M R +I AL         + ++ + +C      A+   C   +   +  ++ A Y+ +  
Sbjct: 89  MKRLMIAALGAALAFGALSARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQN 148

Query: 57  KVEKHQ-------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
                +       R+     Q  W       C                  +CL      R
Sbjct: 149 ARPADEGMAYREFRDALRDEQQRWRQRTRDACG--------------ARIDCLTNAYTAR 194

Query: 110 NEKLES 115
              L  
Sbjct: 195 IAALRG 200


>gi|327189700|gb|EGE56847.1| hypothetical protein RHECNPAF_560015 [Rhizobium etli CNPAF512]
          Length = 116

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 39/109 (35%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  L I +   Q+ + +C  + L   +   C   +      K+  +++ +   +    R 
Sbjct: 12  LTILAITSGMAQAASFDCEGKELKPDEKVICDNRALNDADVKMATSFELLSGLLAMGSRG 71

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A+              CL+    ER ++L
Sbjct: 72  TLQDEQTAWLKKR-QECGADAA--------------CLKAAYEERLKQL 105


>gi|242312740|ref|ZP_04811757.1| hypothetical protein BURPS1106B_1678 [Burkholderia pseudomallei
           1106b]
 gi|242135979|gb|EES22382.1| hypothetical protein BURPS1106B_1678 [Burkholderia pseudomallei
           1106b]
          Length = 374

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 122 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 181

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 182 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 215


>gi|37651508|ref|NP_932382.1| hypothetical protein 44RRORF027c [Aeromonas phage 44RR2.8t]
 gi|34732808|gb|AAQ81346.1| hypothetical protein 44RRORF027c [Aeromonas phage 44RR2.8t]
          Length = 221

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 39/121 (32%), Gaps = 23/121 (19%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M    + AL +++ +  + + +CN   L   +   C     +++ ++L   YK V     
Sbjct: 1   MKFLSVIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMMDQQLADAYKVVRH--- 57

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
                  +  Q  +   R       ++ +             L+    +R  +LE     
Sbjct: 58  ---IPEVKADQKTFIKDRN------SAPSLGD----------LKDLMRDRIIELEIIAEL 98

Query: 120 P 120
            
Sbjct: 99  E 99


>gi|15676018|ref|NP_273148.1| hypothetical protein NMB0086 [Neisseria meningitidis MC58]
 gi|304388891|ref|ZP_07370940.1| probable lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|7225304|gb|AAF40549.1| hypothetical protein NMB0086 [Neisseria meningitidis MC58]
 gi|254671519|emb|CBA09117.1| hypothetical protein NME_2088 [Neisseria meningitidis alpha153]
 gi|254673882|emb|CBA09665.1| hypothetical protein NMW_2109 [Neisseria meningitidis alpha275]
 gi|304337152|gb|EFM03337.1| probable lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|316985932|gb|EFV64871.1| lipoprotein [Neisseria meningitidis H44/76]
 gi|325141242|gb|EGC63741.1| putative lipoprotein [Neisseria meningitidis CU385]
 gi|325143308|gb|EGC65644.1| putative lipoprotein [Neisseria meningitidis 961-5945]
 gi|325199309|gb|ADY94764.1| putative lipoprotein [Neisseria meningitidis H44/76]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|296447322|ref|ZP_06889250.1| hypothetical protein MettrDRAFT_2966 [Methylosinus trichosporium
          OB3b]
 gi|296255187|gb|EFH02286.1| hypothetical protein MettrDRAFT_2966 [Methylosinus trichosporium
          OB3b]
          Length = 463

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 21/75 (28%), Gaps = 1/75 (1%)

Query: 16 FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
            + + +C       +   C       +  +L A  K  L      + E   ++   W I
Sbjct: 17 VHAQSFDCAAARTMVERLVCADRRLGALDAELGAAVKASLAADPAKRAERLAEA-RRWII 75

Query: 76 YRGSECAFAASGAEE 90
           R   C   A     
Sbjct: 76 ERDRLCPPPAREPVG 90


>gi|237750334|ref|ZP_04580814.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373864|gb|EEO24255.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 390

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 33/96 (34%), Gaps = 10/96 (10%)

Query: 20  ALNCNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQRELFEKSQMAWEIYR 77
           + +C +  L + +   C           L A ++  ++      QR   +K Q+ W   R
Sbjct: 201 SFDCEKQGLSKIEKGICNSFYTLRDDVSLNAMFEYAMDFAWSNEQRSRLKKEQLQWLKER 260

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +C  A  G E           CL      R ++L
Sbjct: 261 NMKCVKAKDGEE--------LLTCLYQAINHRIKEL 288


>gi|262368207|ref|ZP_06061536.1| predicted protein [Acinetobacter johnsonii SH046]
 gi|262315885|gb|EEY96923.1| predicted protein [Acinetobacter johnsonii SH046]
          Length = 140

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 43/118 (36%), Gaps = 9/118 (7%)

Query: 6   IFALTIIAIAFQSMA-----LNCNETLMQA--DMNQCTGNSFALVKEKLEATYKKVLEKV 58
           +  + + + +  +M        C +       +++ C    + + K++L+  +K  L K 
Sbjct: 19  LLVVGLFSGSAFAMGPTKKYEACMKQTGNVLSEIDACMSKEYKVQKKRLKKVFKPYLAKA 78

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              ++ L ++S   W   R   C        E T   +   +CL      R +  E+ 
Sbjct: 79  PVEEQGLVKQSHQQWLAQRDQICNNKPIVKNEKT--ELQRISCLMQMTQTRADMYEAL 134


>gi|254805857|ref|YP_003084078.1| hypothetical protein NMO_1941 [Neisseria meningitidis alpha14]
 gi|254669399|emb|CBA08574.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|218767216|ref|YP_002341728.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|121051224|emb|CAM07497.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|319411423|emb|CBY91835.1| hypothetical lipoprotein [Neisseria meningitidis WUE 2594]
          Length = 338

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|288958273|ref|YP_003448614.1| hypothetical protein AZL_014320 [Azospirillum sp. B510]
 gi|288910581|dbj|BAI72070.1| hypothetical protein AZL_014320 [Azospirillum sp. B510]
          Length = 287

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 34/124 (27%), Gaps = 15/124 (12%)

Query: 6   IFALTIIAIAFQSMAL--------------NCNETLMQADMNQCTGNSFALVKEKLEATY 51
           +FA+     A  + A               +C+          C     A     L+   
Sbjct: 16  LFAIMAAVPALSAPADGSLTNPGPIESTAPDCDAAETPMAQLVCRDPKLAAAGAALDDAL 75

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
             +    +   R     SQ  W   R   C  +A+   +         +CL     +R  
Sbjct: 76  AALGTTTDDAGRAAIGDSQTVWRARRDEACPVSAADLAD-AKSVKTRTDCLMRVIRQRTA 134

Query: 112 KLES 115
            LE+
Sbjct: 135 ALEA 138


>gi|262192872|ref|YP_001079289.2| hypothetical protein BMA10247_A2117 [Burkholderia mallei NCTC
           10247]
 gi|261834996|gb|ABO02458.2| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
          Length = 377

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 125 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 184

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 185 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 218


>gi|261827207|gb|ABN00107.2| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
          Length = 389

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 137 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 196

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 197 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 230


>gi|53716213|ref|YP_106397.1| hypothetical protein BMAA1849 [Burkholderia mallei ATCC 23344]
 gi|238563389|ref|ZP_00438938.2| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|52422183|gb|AAU45753.1| hypothetical protein BMAA1849 [Burkholderia mallei ATCC 23344]
 gi|238520777|gb|EEP84234.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
          Length = 385

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 133 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 192

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 193 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 226


>gi|238025236|ref|YP_002909468.1| hypothetical protein bglu_2g19080 [Burkholderia glumae BGR1]
 gi|237879901|gb|ACR32233.1| Hypothetical protein bglu_2g19080 [Burkholderia glumae BGR1]
          Length = 352

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 25/95 (26%), Gaps = 22/95 (23%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C     +   + L   Y +V           +   Q AW   R +
Sbjct: 35  SFDCTKAATPTEKRICADPRLSKQDDTLHQLYARV------SGSPAWRDDQRAWRATRDA 88

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            C                   CL+    +R   L 
Sbjct: 89  -CGD---------------LVCLRNLYADRLVVLR 107


>gi|254195360|ref|ZP_04901788.1| hypothetical protein BURPSS13_J0221 [Burkholderia pseudomallei S13]
 gi|169652107|gb|EDS84800.1| hypothetical protein BURPSS13_J0221 [Burkholderia pseudomallei S13]
          Length = 382

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 130 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 189

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 190 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 223


>gi|126457773|ref|YP_001074360.1| hypothetical protein BURPS1106A_A0317 [Burkholderia pseudomallei
           1106a]
 gi|126231541|gb|ABN94954.1| hypothetical protein BURPS1106A_A0317 [Burkholderia pseudomallei
           1106a]
          Length = 371

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 119 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 178

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 179 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 212


>gi|254176286|ref|ZP_04882944.1| hypothetical protein BMA10399_B1791 [Burkholderia mallei ATCC
           10399]
 gi|160697328|gb|EDP87298.1| hypothetical protein BMA10399_B1791 [Burkholderia mallei ATCC
           10399]
          Length = 379

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 127 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 186

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 187 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 220


>gi|254205264|ref|ZP_04911617.1| hypothetical protein BMAJHU_I1086 [Burkholderia mallei JHU]
 gi|147754850|gb|EDK61914.1| hypothetical protein BMAJHU_I1086 [Burkholderia mallei JHU]
          Length = 369

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 117 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 176

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 177 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 210


>gi|124383261|ref|YP_001024946.1| hypothetical protein BMA10229_1143 [Burkholderia mallei NCTC 10229]
          Length = 373

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 121 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 180

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 181 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 214


>gi|307133014|ref|YP_003885030.1| hypothetical protein Dda3937_00254 [Dickeya dadantii 3937]
 gi|306530543|gb|ADN00474.1| hypothetical protein Dda3937_00254 [Dickeya dadantii 3937]
          Length = 262

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 41/128 (32%), Gaps = 27/128 (21%)

Query: 1   MCRKII-----FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M R +       A+   A+   + +  C +     +   C   + + + ++L   ++K  
Sbjct: 9   MKRSLATLLLPLAVGCSALPALAASFPCQQAASAQEKLICQTPALSQLDDELAKEWQKSR 68

Query: 56  EKVEKH-----QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
             +  +     Q +   + Q  W   R + C                   CL+    ++ 
Sbjct: 69  AFLTGNPDRVAQDKNLTQFQRGWLSSRNT-CRDEE---------------CLRQSYQQQL 112

Query: 111 EKLESYLT 118
            +L  YL 
Sbjct: 113 TRLR-YLN 119


>gi|254196925|ref|ZP_04903349.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653668|gb|EDS86361.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 122

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 26/98 (26%), Gaps = 17/98 (17%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            + +C +     +   C+    A    +L   Y K   K         +  Q  W     
Sbjct: 42  ASFDCAKASSAIEHLICSTPESANADLRLADEYSKARAKSSDPA--ALKADQRNWMKSER 99

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             C+                A CL      R +KL + 
Sbjct: 100 DACSD---------------AGCLVKVTEARIQKLAAM 122


>gi|237508561|ref|ZP_04521276.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|235000766|gb|EEP50190.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 421

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 34/126 (26%), Gaps = 25/126 (19%)

Query: 1   MCRKIIFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M R +I AL         + ++ + +C      A+   C   +   +  ++ A Y+ +  
Sbjct: 151 MKRLMIAALGAALAFGALSARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQN 210

Query: 57  KVEKHQ-------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
                +       R+     Q  W       C                  +CL      R
Sbjct: 211 ARPADEGMAYREFRDALRDEQQRWRQRTRDACGA--------------RIDCLTNAYTAR 256

Query: 110 NEKLES 115
              L  
Sbjct: 257 IAALRG 262


>gi|227114494|ref|ZP_03828150.1| hypothetical protein PcarbP_16113 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 309

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 28/103 (27%), Gaps = 19/103 (18%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
                  A++C++     +   C  +    +   L   Y       +K  +    ++Q A
Sbjct: 14  FCTSSVWAIDCSKASADTEKMICASSRLQQLDTVLNKAY---QGYAKKEDKAQALQAQRA 70

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           W   R   C                   CL    + R + L  
Sbjct: 71  WLAERDR-CKDDV---------------CLGNEMVSRIQALSG 97


>gi|329847586|ref|ZP_08262614.1| hypothetical protein ABI_06520 [Asticcacaulis biprosthecum C19]
 gi|328842649|gb|EGF92218.1| hypothetical protein ABI_06520 [Asticcacaulis biprosthecum C19]
          Length = 233

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 34/112 (30%), Gaps = 16/112 (14%)

Query: 8   ALTIIAIAFQSMALNCNETLMQ----ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           A +  A A  + + +C + L       +   C       +  +L   Y  + +      R
Sbjct: 43  ASSSPAGAMGTPSFDCAKALQDDPDGIERVICGDTQLVDLDNELARLYF-LADASAGASR 101

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           E  ++ Q  W   R S C   A               CL     ER   L S
Sbjct: 102 ETLQRLQKGWLDQRRSTCTRTA-----------EIKQCLVNAYAERIHDLRS 142


>gi|325135206|gb|EGC57831.1| putative lipoprotein [Neisseria meningitidis M13399]
          Length = 338

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|254507894|ref|ZP_05120023.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219549130|gb|EED26126.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 166

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 39/104 (37%), Gaps = 16/104 (15%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQM 71
            +A    + NC+     A+   C     + +   +   Y++ L     +  ++   + Q 
Sbjct: 1   MLANAEPSYNCDNVSHVAEHAICGSQELSSLDRLIAKQYRQSLSDAALEKDKQTLRQVQR 60

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           AW   R  EC ++               +CL+  ++ER   L++
Sbjct: 61  AWVTQRN-ECEYSF--------------DCLKERSLERLATLKA 89


>gi|170697512|ref|ZP_02888602.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|170137535|gb|EDT05773.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
          Length = 132

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 42/129 (32%), Gaps = 5/129 (3%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R +  A   I  A    A++C       D +  C  +      +    + ++ L++   
Sbjct: 5   IRFLAIAALAIGPACAFAAVDCEHQGPTMDNVRACVVDRNQQEVDSTYRSLERTLKRRNP 64

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
                  KSQ +W  + G  C +  +   +    +  + NC    +  R   L+ +    
Sbjct: 65  DAAGELAKSQASWTRFAGDTCNYVKAANPQQMIPNDAWMNCWVDFSQARVRILKKW---- 120

Query: 121 EGDLLCPFI 129
           E     P  
Sbjct: 121 EALENAPQP 129


>gi|161869104|ref|YP_001598270.1| lipoprotein [Neisseria meningitidis 053442]
 gi|161594657|gb|ABX72317.1| lipoprotein [Neisseria meningitidis 053442]
          Length = 338

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|313669553|ref|YP_004049978.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
 gi|313156750|gb|ADR35425.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
          Length = 319

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF---EKSQMAWEIYRGSE 80
           ++ L Q DMN    +      + +EA   +++ ++     E     +++  +W+ Y    
Sbjct: 214 DQPLTQMDMNMSACDDLTKTLDSIEAIDSEIVRQISDKWIERLEYYKRAHESWKKYMEDN 273

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCPEGD 123
             F AS    G+  ++I A+     A+ER + L+  L    E D
Sbjct: 274 SEFEASSFIGGSMWTLIKASSANRIALEREKDLKLLLNQLEEND 317


>gi|15807203|ref|NP_295932.1| hypothetical protein DR_2210 [Deinococcus radiodurans R1]
 gi|6460018|gb|AAF11763.1|AE002054_8 hypothetical protein DR_2210 [Deinococcus radiodurans R1]
          Length = 127

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 34/96 (35%), Gaps = 10/96 (10%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           CN  +   D   C          ++   Y+K+L K+    ++   ++Q AW   R ++C 
Sbjct: 29  CNYPVGTFDQVYCVNKVTLQADTEMNTAYQKLLRKLPVSAQQTLRQTQRAWMAKRDNDCV 88

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              +          +Y NC     + R   L   L 
Sbjct: 89  DGYT----------VYVNCTHDMTVSRLNFLNDRLR 114


>gi|302873357|ref|YP_003841990.1| hypothetical protein Clocel_0450 [Clostridium cellulovorans 743B]
 gi|307688473|ref|ZP_07630919.1| hypothetical protein Ccel74_09953 [Clostridium cellulovorans 743B]
 gi|302576214|gb|ADL50226.1| hypothetical protein Clocel_0450 [Clostridium cellulovorans 743B]
          Length = 328

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G+S+    + L   Y  + E++ +   +  E  ++ W   + +    
Sbjct: 104 SDAGITISMKSFYGDSYRCYDDALNEIYNLLKEQLSQDIMKNLEAEEINWITQKENAANA 163

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           AAS  + GT + + Y   L      R  +L
Sbjct: 164 AASEFKGGTFEPVAYNTSLYNSTKARCYEL 193



 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 29/91 (31%), Gaps = 1/91 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
             +     M       +    E+L   Y  + +++   +     K ++ W   + ++   
Sbjct: 232 AGSGTTNSMFTYADKKYIKWDEQLNKIYSLLKQQLPSDEMSKLNKEELQWITQKETKAKK 291

Query: 84  AASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
           +      G+   S+ Y   L      R  +L
Sbjct: 292 SEESQGVGSQLGSVAYQASLAFVTESRCYEL 322


>gi|190891386|ref|YP_001977928.1| hypothetical protein RHECIAT_CH0001780 [Rhizobium etli CIAT 652]
 gi|190696665|gb|ACE90750.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 117

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 39/109 (35%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  L I +   Q+ + +C  + L   +   C   +      K+  +++ +   +    R 
Sbjct: 13  LTILAITSGMAQAASFDCEGKELKPDEKVICDNRALNDADVKMATSFELLSGLLAMGSRG 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A+              CL+    ER ++L
Sbjct: 73  TLQDEQTAWLKKR-QECGADAA--------------CLKAAYEERLKQL 106


>gi|167835838|ref|ZP_02462721.1| hypothetical protein Bpse38_05065 [Burkholderia thailandensis
           MSMB43]
          Length = 202

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 36/91 (39%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + + +A Y+++++      R  +++SQ  W  +R  E     +
Sbjct: 15  SSTAGQIQCMDEARQQWQGEADAAYQRLVKTAPADARRGWQESQRRWLAWRKDEAHLVRA 74

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             E  +GT  +M  A+       +R   L  
Sbjct: 75  VYETTQGTMYAMASADMRLQPVRDRALALRG 105



 Score = 35.5 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 19/72 (26%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++       
Sbjct: 137 FDMNRYYEKLRARMPVDSLPTLVAAQREWAAFRDAT-------------TPLVGEGERVD 183

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 184 LIGARVATLKRF 195


>gi|332974227|gb|EGK11160.1| hypothetical protein HMPREF0476_0469 [Kingella kingae ATCC 23330]
          Length = 352

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 31/89 (34%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q D+NQ      A   + ++ +++K+        ++     Q  WE  +   C  AA+ 
Sbjct: 266 SQNDINQ-ANRDNAAADQAIKNSWRKI----SPDIQQTLVAEQRDWESKKNVSCRNAAAK 320

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
                    +   C      ER + L  Y
Sbjct: 321 GGSAAESQYLQMQCDTRLTRERVQYLNGY 349


>gi|251787795|ref|YP_003002516.1| hypothetical protein Dd1591_0144 [Dickeya zeae Ech1591]
 gi|247536416|gb|ACT05037.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 254

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 43/128 (33%), Gaps = 27/128 (21%)

Query: 1   MCRKIIFALTII-----AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M R +   L  +     A+   + +  C +     +   C   + + + ++L   ++K  
Sbjct: 1   MKRLLATWLLPLVVGGSALPALAASFPCQQASSAQEKLICQTPALSQLDDELAKEWQKSR 60

Query: 56  EKVEKH-----QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
             +  +     Q ++  + Q +W   R + C                   CL+    ++ 
Sbjct: 61  AFLTGNPERVAQEKILTQFQRSWLSSRNT-CRDEE---------------CLRQSYQQQL 104

Query: 111 EKLESYLT 118
            +L  YL 
Sbjct: 105 TRLR-YLN 111


>gi|42782968|ref|NP_980215.1| putative lipoprotein [Bacillus cereus ATCC 10987]
 gi|42738895|gb|AAS42823.1| lipoprotein, putative [Bacillus cereus ATCC 10987]
          Length = 385

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 28/87 (32%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
             +   D+      ++ L   KL   Y  +   +     +  +  Q+AW   + S+    
Sbjct: 299 NVMSTNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAI 358

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNE 111
            +    GT + +  +        ER  
Sbjct: 359 GTDTNNGTMRRIDASEEKYKMTKERCY 385


>gi|310765201|gb|ADP10151.1| DUF1311 protein [Erwinia sp. Ejp617]
          Length = 132

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 40/109 (36%), Gaps = 11/109 (10%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK----------VEKHQRELFEK 68
            A  C E L    + QCT     L +E L   Y    ++          + +     F  
Sbjct: 22  AADICAEQLSDGSLWQCTERQKKLAEEDLNQAYIAAKKRIVQMYRSDKPLGEQYVATFTD 81

Query: 69  SQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESY 116
           SQ  W  YR  +C+  A  AEEG+   +     C+      R+E ++  
Sbjct: 82  SQRHWLKYRDGQCSLEAFAAEEGSTVHATAVNICIARIDKARSEMIKQM 130


>gi|261379142|ref|ZP_05983715.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269144367|gb|EEZ70785.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 339

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 258 EEARIQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 317

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 318 KLQCETRMTRERIQYLRGY 336


>gi|312114009|ref|YP_004011605.1| peptidase C14 caspase catalytic subunit p20 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219138|gb|ADP70506.1| peptidase C14 caspase catalytic subunit p20 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 494

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 18/100 (18%)

Query: 18  SMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWE 74
           + + NCN+     A++  C  +  + +  +++  Y  +++ +  +    +L    Q  W 
Sbjct: 406 APSFNCNDANLNLAEIKVCQVDQLSRLDIEMQKLYDNLIQDLRSNVSAFKLLVSEQRQWL 465

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R S C                   CL      R ++L+
Sbjct: 466 KLR-SMCGANEL--------------CLTDTYKRRLQQLK 490



 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 31/101 (30%), Gaps = 18/101 (17%)

Query: 18  SMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWE 74
           + + NCN       ++  C     A +  +++  Y  +L   + +          Q  W 
Sbjct: 307 APSFNCNGVNLNSVELKICHVAQLARLDLEMQRVYDNLLRASKSNVTAFNTLVSDQRQWL 366

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R S C  +               NC+      R E+L  
Sbjct: 367 KLR-SMCGPSE--------------NCIDAVYKRRLEELNE 392


>gi|183982377|ref|YP_001850668.1| lipoprotein, LprL [Mycobacterium marinum M]
 gi|183175703|gb|ACC40813.1| lipoprotein, LprL [Mycobacterium marinum M]
          Length = 211

 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 32/102 (31%), Gaps = 13/102 (12%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             +  +  L+C           C       +  +L+  Y++ L++     +     +Q  
Sbjct: 37  PTSTAAPLLDCTNPEDDTQRLVCNDPQLTELDRRLDTAYQQALDR-PGTDKAALTLAQGH 95

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           W   R  +CA           Q+     CLQ     R  +L 
Sbjct: 96  WAETRD-QCA-----------QNPDMRTCLQESYQTRLAQLA 125


>gi|13474022|ref|NP_105590.1| hypothetical protein mll4801 [Mesorhizobium loti MAFF303099]
 gi|14024774|dbj|BAB51376.1| mll4801 [Mesorhizobium loti MAFF303099]
          Length = 130

 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 41/124 (33%), Gaps = 9/124 (7%)

Query: 1   MCRKI-IFALTIIAIAFQSMALN------C--NETLMQADMNQCTGNSFALVKEKLEATY 51
           M R   +  +  +  A  +MA +      C        + M  C          +L   Y
Sbjct: 1   MLRYACLLGILAMTTAHSAMAQSDAEMKACVDRSGGATSAMLDCGKTEIDKFDARLNTAY 60

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
             ++ +    +R   ++ Q AW  +   E    A+  + G+A  +   +        R  
Sbjct: 61  NTLMHREHGPERARLQREQRAWLKHHLRETHRLAADPDNGSAAFLTSQSFELDDLSARTA 120

Query: 112 KLES 115
           +LE 
Sbjct: 121 ELEK 124


>gi|291042726|ref|ZP_06568467.1| lipoprotein [Neisseria gonorrhoeae DGI2]
 gi|291013160|gb|EFE05126.1| lipoprotein [Neisseria gonorrhoeae DGI2]
          Length = 352

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 271 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 330

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 331 KLQCDTRMTRERIQYLRGY 349


>gi|50083586|ref|YP_045096.1| putative signal peptide [Acinetobacter sp. ADP1]
 gi|49529562|emb|CAG67274.1| conserved hypothetical protein; putative signal peptide
           [Acinetobacter sp. ADP1]
          Length = 116

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 42/122 (34%), Gaps = 19/122 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M   I      I +A    A      CN+  ++++   C   S      K+  TY  +L 
Sbjct: 1   MKASIQLITIFIGVALSGAASAASFPCNKAQLRSEKTICQTLSLNDADVKMATTYNIILH 60

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    R+  + +Q  W   R + C         G+       +CL      R + L+S 
Sbjct: 61  ALPMGGRDSEKGAQYQWLKQRNA-C---------GS-----NVSCLTASYASRQQHLDSI 105

Query: 117 LT 118
           + 
Sbjct: 106 IQ 107


>gi|59802206|ref|YP_208918.1| hypothetical protein NGO1889 [Neisseria gonorrhoeae FA 1090]
 gi|194099859|ref|YP_002002996.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|239997876|ref|ZP_04717800.1| Lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|240015143|ref|ZP_04722056.1| Lipoprotein [Neisseria gonorrhoeae DGI18]
 gi|240017591|ref|ZP_04724131.1| Lipoprotein [Neisseria gonorrhoeae FA6140]
 gi|240081735|ref|ZP_04726278.1| Lipoprotein [Neisseria gonorrhoeae FA19]
 gi|240116747|ref|ZP_04730809.1| Lipoprotein [Neisseria gonorrhoeae PID18]
 gi|240118968|ref|ZP_04733030.1| Lipoprotein [Neisseria gonorrhoeae PID1]
 gi|240122214|ref|ZP_04735176.1| Lipoprotein [Neisseria gonorrhoeae PID24-1]
 gi|240124504|ref|ZP_04737460.1| Lipoprotein [Neisseria gonorrhoeae PID332]
 gi|240124623|ref|ZP_04737509.1| Lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268593722|ref|ZP_06127889.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597833|ref|ZP_06132000.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268602418|ref|ZP_06136585.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268604681|ref|ZP_06138848.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268683137|ref|ZP_06149999.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268683190|ref|ZP_06150052.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|293398249|ref|ZP_06642454.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|59719101|gb|AAW90506.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193935149|gb|ACF30973.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|268547111|gb|EEZ42529.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268551621|gb|EEZ46640.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268586549|gb|EEZ51225.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268588812|gb|EEZ53488.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268623421|gb|EEZ55821.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268623474|gb|EEZ55874.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|291611512|gb|EFF40582.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|317165326|gb|ADV08867.1| hypothetical protein NGTW08_1912 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 338

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|296136644|ref|YP_003643886.1| hypothetical protein Tint_2205 [Thiomonas intermedia K12]
 gi|295796766|gb|ADG31556.1| hypothetical protein Tint_2205 [Thiomonas intermedia K12]
          Length = 241

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 32/109 (29%), Gaps = 17/109 (15%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRE 64
           +        +    A +C      AD   C     + +  ++   Y   L +      +E
Sbjct: 143 MATAAASTHSGDGPAFDCANATAPADKLVCGSAGLSAMDRQVATAYHAALHQAPNPQVQE 202

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             + +Q+AW   +   C   A               CLQ    ER   L
Sbjct: 203 QIKHAQIAWVRTKMR-CRNVA---------------CLQSVYRERLGVL 235


>gi|294650832|ref|ZP_06728179.1| hypothetical protein HMP0015_2388 [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823250|gb|EFF82106.1| hypothetical protein HMP0015_2388 [Acinetobacter haemolyticus ATCC
           19194]
          Length = 110

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 36/119 (30%), Gaps = 11/119 (9%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +   +  +     +                        +K +L   YK+   + E 
Sbjct: 1   MKRLLFIPILALCGLAIA-----GNADSDLQKL---DKEIKNLKTELNTVYKEASSQTEA 52

Query: 61  HQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            Q      SQ +W  ++  +C  F  + A+  +A       C      +R + L+    
Sbjct: 53  KQ--ELAASQESWLKFKELQCGDFVVADAQGSSATISYDLTCQSILYKQRIDFLKEMFN 109


>gi|296390518|ref|ZP_06879993.1| hypothetical protein PaerPAb_20291 [Pseudomonas aeruginosa PAb1]
          Length = 111

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 27/96 (28%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   +      ++   Y  +        R   +  Q  W   R  
Sbjct: 22  SFDCEKAERADEKAICANRALNDKDVEMNVKYHFLRGLFAMGGRGAMQDRQQGWLRERRR 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C         G        +CL     +R ++L+ 
Sbjct: 82  -C--------GG------DTDCLSRAYAQRIDELDK 102


>gi|240114011|ref|ZP_04728501.1| Lipoprotein [Neisseria gonorrhoeae MS11]
 gi|240129183|ref|ZP_04741844.1| Lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|254494769|ref|ZP_05107940.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268600076|ref|ZP_06134243.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268687566|ref|ZP_06154428.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|226513809|gb|EEH63154.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268584207|gb|EEZ48883.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268627850|gb|EEZ60250.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
          Length = 338

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|260439492|ref|ZP_05793308.1| Lipoprotein [Neisseria gonorrhoeae DGI2]
          Length = 338

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
               +  ++ E+   K+   ++   ++     Q  W   + S C  AA+ A+       +
Sbjct: 257 EEARVQNQRAESEITKLWGGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYL 316

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L  Y
Sbjct: 317 KLQCDTRMTRERIQYLRGY 335


>gi|167845129|ref|ZP_02470637.1| hypothetical protein BpseB_07548 [Burkholderia pseudomallei B7210]
          Length = 141

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 39/106 (36%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+    +        ++   E   
Sbjct: 32  LPASEVSALLADCD--SNQTSMNFCAWRDQIVAERELQQVVDQ-QVSQHPERKTALEAKV 88

Query: 71  MAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|118617191|ref|YP_905523.1| lipoprotein, LprL [Mycobacterium ulcerans Agy99]
 gi|118569301|gb|ABL04052.1| lipoprotein, LprL [Mycobacterium ulcerans Agy99]
          Length = 211

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 31/102 (30%), Gaps = 13/102 (12%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             +  +  L+C           C       +  +L+  Y++ L++     +     +Q  
Sbjct: 37  PTSTAAPLLDCTNPEDDTQRLVCNDPQLTELDRRLDTAYQQALDR-PGTDKAALTLAQGH 95

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           W   R  +CA           Q      CLQ     R  +L 
Sbjct: 96  WAETRD-QCA-----------QDPDMRTCLQESYQTRLAQLA 125


>gi|227356317|ref|ZP_03840705.1| upregulator of flagellar master operon [Proteus mirabilis ATCC
           29906]
 gi|227163427|gb|EEI48348.1| upregulator of flagellar master operon [Proteus mirabilis ATCC
           29906]
          Length = 137

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 40/123 (32%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQSM--------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +  +++++ +  +             +    Q  +  C  +   L +E+L   Y K    
Sbjct: 12  LLTMSLLSFSSFAQVNHDPLTKCYELSTDASQTTIKACLLDELRLSEEQLNVIYNKSKGD 71

Query: 58  VEKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +E           +    SQ  + ++R SEC   ++    G     +   C       R 
Sbjct: 72  LEDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRA 131

Query: 111 EKL 113
           + L
Sbjct: 132 KLL 134


>gi|296135783|ref|YP_003643025.1| hypothetical protein Tint_1307 [Thiomonas intermedia K12]
 gi|295795905|gb|ADG30695.1| hypothetical protein Tint_1307 [Thiomonas intermedia K12]
          Length = 135

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 46/128 (35%), Gaps = 11/128 (8%)

Query: 6   IFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEA-TYKKVLEKVEK 60
           +  L     A  ++ +     C   L Q     C   +   + E++      ++ + +  
Sbjct: 11  LLVLACFGQAQAAIEVKTPPIC---LSQPRSADCAAQTRRALNERMTHLYRLELQKVMGT 67

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAE-EGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +     + +Q  W  +  +EC F     + +  A S    +CL G    R  +L+ +L C
Sbjct: 68  YTERRLDHAQNLWRRWANAECEFRNGPPDWQNAAWSTRQDDCLSGMIRSRIAQLDGFLHC 127

Query: 120 PEGDLLCP 127
                 CP
Sbjct: 128 S--GATCP 133


>gi|163746187|ref|ZP_02153546.1| hypothetical protein OIHEL45_11383 [Oceanibulbus indolifex HEL-45]
 gi|161380932|gb|EDQ05342.1| hypothetical protein OIHEL45_11383 [Oceanibulbus indolifex HEL-45]
          Length = 161

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 26/99 (26%), Gaps = 13/99 (13%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVE-------------KHQRELFEKSQMAWE 74
               M  C           L   Y+  + + +               Q E     Q AW 
Sbjct: 59  STYGMGGCLDRELRYWDTLLNENYRARMVQAKSADEDTAMYQPELPKQAEALRDMQRAWI 118

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            +R + C +  S    GT        CL     E+   L
Sbjct: 119 TFRDAACDYERSQWGGGTGGGPATLACLMRLTGEQALLL 157


>gi|289667082|ref|ZP_06488157.1| hypothetical protein XcampmN_00747 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 388

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 31/93 (33%), Gaps = 12/93 (12%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +     +   C   +   + ++L+  Y+ VLE   +         Q  W   R + 
Sbjct: 28  FDCKQVSTPVEKRLCAVPALGNLDDQLDEAYRGVLEATPRASIAAVRDQQRTWLRQRNA- 86

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           CA  A              +CLQ     R + L
Sbjct: 87  CAQDAKL-----------DDCLQRSLKARVDVL 108


>gi|154245844|ref|YP_001416802.1| hypothetical protein Xaut_1900 [Xanthobacter autotrophicus Py2]
 gi|154159929|gb|ABS67145.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 132

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 34/98 (34%), Gaps = 15/98 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C       +   C     A +  K+   Y  + + V   QR + + +Q AW   R S
Sbjct: 41  SFDCASARAADEKAICDSCDLAQLDVKMSTLYGVLTKLVAMGQRGMIQDAQRAWLAQR-S 99

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            C                  +CL G    R  +LE+ L
Sbjct: 100 TCGGDT--------------SCLSGAYRSRIAQLEAAL 123


>gi|257125531|ref|YP_003163645.1| hypothetical protein Lebu_0746 [Leptotrichia buccalis C-1013-b]
 gi|257049470|gb|ACV38654.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 139

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 29/90 (32%), Gaps = 1/90 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M   +       +++L   Y  +L+K+   ++  F+  Q  W   R +    A +
Sbjct: 43  GSTDGMLNASYKLTGEWEKELNKVYDLILKKLPAKEKSKFKAEQEKWIKSRKAAIKKALA 102

Query: 87  GAEEGT-AQSMIYANCLQGHAIERNEKLES 115
             E+G        A         R  +L  
Sbjct: 103 DEEDGPRMALFGAAGTEYEMTKARVLELAK 132


>gi|212704893|ref|ZP_03313021.1| hypothetical protein DESPIG_02960 [Desulfovibrio piger ATCC 29098]
 gi|212671664|gb|EEB32147.1| hypothetical protein DESPIG_02960 [Desulfovibrio piger ATCC 29098]
          Length = 160

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 36/107 (33%), Gaps = 8/107 (7%)

Query: 18  SMALN-C--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEK-----VEKHQRELFEKS 69
           +   + C      +  +M  C  +++     +L A YKK  +        K   +   K 
Sbjct: 51  APGFDRCMEQSGGVTMEMMGCFQHAYDYWDARLNANYKKARQACQNSSDPKGWSDKLLKG 110

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           Q AW  Y+           E G+   +   + L G   ++   LE  
Sbjct: 111 QRAWVQYKELFADLVQLPNEGGSMARLSAMSFLTGETRKQALLLEQL 157


>gi|126443337|ref|YP_001061413.1| hypothetical protein BURPS668_A0407 [Burkholderia pseudomallei 668]
 gi|126222828|gb|ABN86333.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 406

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 154 SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEILQNARPADEGMAYREFRDALR 213

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 214 DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 247


>gi|94314045|ref|YP_587254.1| hypothetical protein Rmet_5126 [Cupriavidus metallidurans CH34]
 gi|93357897|gb|ABF11985.1| hypothetical protein Rmet_5126 [Cupriavidus metallidurans CH34]
          Length = 307

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/100 (12%), Positives = 27/100 (27%), Gaps = 17/100 (17%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
             + +  C++    A    C         ++L   Y + ++      +      Q  W  
Sbjct: 222 ALARSFGCSKLTSVAGQLICGDAELTRADDQLARIYDQKMKT--STNKARLRADQRTWLR 279

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              + C               +   CL      R ++L+ 
Sbjct: 280 DSRNVC---------------VDKACLMRSYQRRIDELQR 304


>gi|197285790|ref|YP_002151662.1| upregulator of flagellar master operon [Proteus mirabilis HI4320]
 gi|194683277|emb|CAR43984.1| upregulator of flagellar master operon [Proteus mirabilis HI4320]
          Length = 137

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 40/123 (32%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQSM--------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +  +++I+ +  +             +    Q  +  C  +   L +E+L   Y K    
Sbjct: 12  LLTMSLISFSSFAQVNHDPLTKCYELSTDASQTTIKACLLDELRLSEEQLNVIYNKSKGD 71

Query: 58  VEKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +E           +    SQ  + ++R SEC   ++    G     +   C       R 
Sbjct: 72  LEDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRA 131

Query: 111 EKL 113
           + L
Sbjct: 132 KLL 134


>gi|261379531|ref|ZP_05984104.1| conserved hypothetical protein [Neisseria subflava NJ9703]
 gi|284797998|gb|EFC53345.1| conserved hypothetical protein [Neisseria subflava NJ9703]
          Length = 340

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGLDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|330874653|gb|EGH08802.1| hypothetical protein PSYMP_07790 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967277|gb|EGH67537.1| hypothetical protein PSYAC_22013 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 136

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 47/116 (40%), Gaps = 11/116 (9%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK----------HQR 63
            A    A  C+         +C+  S    ++ L+  +  +L++V+              
Sbjct: 20  AAQNPDASPCDGVDDDKQTLECSVYSRTTAEQLLKENFDNLLKRVQSQFVANKSQFNDFT 79

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLT 118
              + +Q AWE  R ++CA     +  G+ A ++   +C+   + ER+E LES   
Sbjct: 80  SKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIARMSDERSEYLESIAQ 135


>gi|329889055|ref|ZP_08267398.1| hypothetical protein BDIM_07270 [Brevundimonas diminuta ATCC
          11568]
 gi|328844356|gb|EGF93920.1| hypothetical protein BDIM_07270 [Brevundimonas diminuta ATCC
          11568]
          Length = 238

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 27/77 (35%), Gaps = 2/77 (2%)

Query: 5  IIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          ++ A    ++A  + A   +C       +   C+  +   +  K+   Y   +   +   
Sbjct: 16 LLGAALTASVATPAAAESADCRRASGPVETAICSTPALTALDAKIAERYGTAIRGYDAAS 75

Query: 63 RELFEKSQMAWEIYRGS 79
           E   + Q A+   R +
Sbjct: 76 AEALRRDQRAFLAARNT 92


>gi|126451849|ref|YP_001065695.1| hypothetical protein BURPS1106A_1422 [Burkholderia pseudomallei
           1106a]
 gi|242316413|ref|ZP_04815429.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|126225491|gb|ABN89031.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|242139652|gb|EES26054.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 141

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 39/106 (36%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+    +        ++   E   
Sbjct: 32  LPASEVSALLADCD--SNQTSMNFCAWRDQIVAERELQQVVDQ-QVSQHPERKAALEAKV 88

Query: 71  MAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|260776771|ref|ZP_05885665.1| hypothetical protein VIC_002159 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606437|gb|EEX32711.1| hypothetical protein VIC_002159 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 364

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 31/87 (35%), Gaps = 15/87 (17%)

Query: 40  FALVKEKLEATYKKVL---------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            A    +L ATY++V+           + K Q     + Q  W  +R + C   A+    
Sbjct: 282 LAETDRRLNATYQEVMDYLKLPSPEYALPKPQSLELREVQRQWIKHRDATCRLVAAP--- 338

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYL 117
                 +   CL     +R ++L   +
Sbjct: 339 ---HPSLKEQCLNWLTAQREQQLRDII 362


>gi|213967834|ref|ZP_03395981.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|213927610|gb|EEB61158.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 126

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 52/125 (41%), Gaps = 11/125 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---- 60
           +  A+T +  A    A  C+         +C+  S    +E L+  +  +L++V+     
Sbjct: 1   MATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNLLKRVQSQFVA 60

Query: 61  ------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
                       + +Q AWE  R ++CA     +  G+ A ++   +C+   + ER+E L
Sbjct: 61  NKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIARMSDERSEYL 120

Query: 114 ESYLT 118
           ES   
Sbjct: 121 ESIAQ 125


>gi|310765205|gb|ADP10155.1| hypothetical protein EJP617_04740 [Erwinia sp. Ejp617]
          Length = 216

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 32/101 (31%), Gaps = 19/101 (18%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF----EKSQMAWE 74
            + +C +   +++   C     + + + +   ++      E             SQ AW 
Sbjct: 127 PSFDCGKAQAESEKAICADYRLSSLDKSVFDAWRVAKALAEDVANTELLATVVASQKAWL 186

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + R  +C         G+        CL     ER EKL  
Sbjct: 187 MNRN-QC---------GSDP-----QCLAKSMTERMEKLAE 212


>gi|76818188|ref|YP_336913.1| hypothetical protein BURPS1710b_A1756 [Burkholderia pseudomallei
           1710b]
 gi|254263478|ref|ZP_04954343.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|76582661|gb|ABA52135.1| hypothetical protein BURPS1710b_A1756 [Burkholderia pseudomallei
           1710b]
 gi|254214480|gb|EET03865.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 275

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 23  SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 82

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 83  DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 116


>gi|319638867|ref|ZP_07993625.1| lipoprotein [Neisseria mucosa C102]
 gi|317399771|gb|EFV80434.1| lipoprotein [Neisseria mucosa C102]
          Length = 340

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|283956225|ref|ZP_06373706.1| hypothetical protein C1336_000240006 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792278|gb|EFC31066.1| hypothetical protein C1336_000240006 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 245

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 41/139 (29%), Gaps = 20/139 (14%)

Query: 1   MCRKIIFALTIIAIAFQS---------MALNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I     + +A  +          + +C++   + +   C         +      
Sbjct: 1   MQKFLIVLGLCLMLAISANAQSPEEAKPSFDCSKATTKVEKMICNDKSGELQKLDRLYSK 60

Query: 50  TYKKVLEKVEKH--QRELFEKSQMAW----EIYRGS-ECAFAASGAEEGTAQSMIYANCL 102
            Y  +L+ + K+  + +   +    +       R   +C F       G  +      C+
Sbjct: 61  LYFSILKSIPKNTKEGQNAREELKYFNHSVMSDRNIFQCYFIV-PFGTGKQEDFRSNYCI 119

Query: 103 QGHAIERNEKLE-SYLTCP 120
           +   +E    L    +   
Sbjct: 120 KQIYLEAIATLAFKMIDSE 138


>gi|207856479|ref|YP_002243130.1| hypothetical protein SEN1000 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708282|emb|CAR32583.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 146

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 47/146 (32%), Gaps = 29/146 (19%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M  K I  L +I  A  +  ++   CN  + Q D+  C  + +      L+       ++
Sbjct: 1   MNIKKILCLFLICGAANAHNIDPAKCNNEIQQDDVYWCLMDKYQQSVIALKKEEINAQKR 60

Query: 58  VEKHQRELFEKS------------------------QMAWEIYRGSECAFAASGAEEGTA 93
           +E+  +   ++                            + IYR  +C +A+      + 
Sbjct: 61  LERFDKNEGKERGLNEDGTLAYDSNIHLARITFPELHRYFIIYREKQCGYASLSIGSLSG 120

Query: 94  Q--SMIYANCLQGHAIERNEKLESYL 117
               +    C     I + + L  Y+
Sbjct: 121 YRVPISSLYCKTEMNISQIKWLNDYI 146


>gi|241759046|ref|ZP_04757158.1| lipoprotein [Neisseria flavescens SK114]
 gi|241320867|gb|EER57100.1| lipoprotein [Neisseria flavescens SK114]
          Length = 340

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|254248095|ref|ZP_04941416.1| hypothetical protein BCPG_02920 [Burkholderia cenocepacia PC184]
 gi|124872871|gb|EAY64587.1| hypothetical protein BCPG_02920 [Burkholderia cenocepacia PC184]
          Length = 365

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 29/85 (34%), Gaps = 1/85 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RE 64
              +T + +A    A++C + +   +   C   +      +L A Y   L+       R+
Sbjct: 102 AMFMTGVGVALPGFAMDCAKAVQPIEKRICANPALRAADARLNAAYAGALKAAPDAAIRD 161

Query: 65  LFEKSQMAWEIYRGSECAFAASGAE 89
           +  +SQ  W   R         G  
Sbjct: 162 MLVRSQRRWLDARNKRLDTDYEGHR 186


>gi|3360263|gb|AAC28927.1| UmoC [Proteus mirabilis]
          Length = 137

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 40/123 (32%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQSM--------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +  +++I+ +  +             +    Q  +  C  +   L +E+L   Y K    
Sbjct: 12  LLTMSLISFSSFAQVNHDPLTKCYELSTDASQTTIKSCLLDELRLSEEQLNVIYNKSKGD 71

Query: 58  VEKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +E           +    SQ  + ++R SEC   ++    G     +   C       R 
Sbjct: 72  LEDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRA 131

Query: 111 EKL 113
           + L
Sbjct: 132 KLL 134


>gi|238793600|ref|ZP_04637223.1| hypothetical protein yinte0001_2180 [Yersinia intermedia ATCC
          29909]
 gi|238727015|gb|EEQ18546.1| hypothetical protein yinte0001_2180 [Yersinia intermedia ATCC
          29909]
          Length = 331

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 22/70 (31%), Gaps = 3/70 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          I  L  + I+  S A+NC       +   C       + +     Y+ +L K +      
Sbjct: 9  ILFLLAMIISSSSFAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQSMLVKYDTETVYQ 68

Query: 66 FEKSQMAWEI 75
                 WE 
Sbjct: 69 QR---QIWEK 75


>gi|283956223|ref|ZP_06373704.1| hypothetical protein C1336_000240004 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792276|gb|EFC31064.1| hypothetical protein C1336_000240004 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 247

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/141 (12%), Positives = 43/141 (30%), Gaps = 24/141 (17%)

Query: 1   MCRKIIFALTIIAIAFQS---------MALNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I     + +A  +          + +C++   + +   C         +      
Sbjct: 1   MQKFLIVLGLCLMLAISANAQSPKEAKPSFDCSKATTKVEKMICNDEGGELQKLDRLYSK 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIY--------RGS-ECAFAASGAEEGTAQSMIYAN 100
            Y  +L+ + K+ +E  +  +     Y        R   +C F A   E    +      
Sbjct: 61  LYFSILKSIPKNTKEGQKTREK--LKYFNHSVMSNRNIFQCYFVA-PFETKKQEDRQSNY 117

Query: 101 CLQGHAIERNEKLE-SYLTCP 120
           C++   +E    L    +   
Sbjct: 118 CIKQIYLEAIATLAFKMIDSE 138


>gi|107029033|ref|YP_626128.1| hypothetical protein Bcen_6292 [Burkholderia cenocepacia AU 1054]
 gi|116689808|ref|YP_835431.1| hypothetical protein Bcen2424_1787 [Burkholderia cenocepacia
           HI2424]
 gi|105898197|gb|ABF81155.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116647897|gb|ABK08538.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 280

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 29/85 (34%), Gaps = 1/85 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RE 64
              +  + +A  S A++C + +   +   C   +      +L A Y   L+       R+
Sbjct: 17  AMFMMGVGVALPSFAMDCAKAVQPIEKRICASPALRAADARLNAAYAGALKAAPDAAIRD 76

Query: 65  LFEKSQMAWEIYRGSECAFAASGAE 89
           +  +SQ  W   R         G  
Sbjct: 77  MLVRSQRRWLDARNKRLDTDYEGHR 101


>gi|238750878|ref|ZP_04612375.1| hypothetical protein yrohd0001_16300 [Yersinia rohdei ATCC 43380]
 gi|238710792|gb|EEQ03013.1| hypothetical protein yrohd0001_16300 [Yersinia rohdei ATCC 43380]
          Length = 329

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 23/74 (31%), Gaps = 3/74 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          I  L ++ I+  S A+NC       +   C       + +     Y+ +L K +      
Sbjct: 7  ILFLLMMIISSSSFAINCQRATTPVEYTVCGNEDLHWLDQTFSGIYQAMLVKYDTETVYQ 66

Query: 66 FEKSQMAWEIYRGS 79
                 W     S
Sbjct: 67 QR---REWAKALNS 77


>gi|27376419|ref|NP_767948.1| hypothetical protein blr1308 [Bradyrhizobium japonicum USDA 110]
 gi|27349559|dbj|BAC46573.1| blr1308 [Bradyrhizobium japonicum USDA 110]
          Length = 458

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 10/70 (14%), Positives = 27/70 (38%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A +    + +C     + +   C      ++  ++  TY++VL+   +       ++Q
Sbjct: 365 LAANSGNGPSFDCATAKREVEKVICADPELGVLDRQIAETYERVLKSANRRSAGDLRRTQ 424

Query: 71  MAWEIYRGSE 80
             +   R S 
Sbjct: 425 RDFLATRNSS 434


>gi|53721260|ref|YP_110245.1| hypothetical protein BPSS0225 [Burkholderia pseudomallei K96243]
 gi|167818377|ref|ZP_02450057.1| hypothetical protein Bpse9_24781 [Burkholderia pseudomallei 91]
 gi|167826760|ref|ZP_02458231.1| hypothetical protein Bpseu9_24000 [Burkholderia pseudomallei 9]
 gi|167848276|ref|ZP_02473784.1| hypothetical protein BpseB_23611 [Burkholderia pseudomallei B7210]
 gi|167896828|ref|ZP_02484230.1| hypothetical protein Bpse7_24010 [Burkholderia pseudomallei 7894]
 gi|167913517|ref|ZP_02500608.1| hypothetical protein Bpse112_23720 [Burkholderia pseudomallei 112]
 gi|167921456|ref|ZP_02508547.1| hypothetical protein BpseBC_23098 [Burkholderia pseudomallei
           BCC215]
 gi|217423203|ref|ZP_03454705.1| hypothetical protein BUC_4429 [Burkholderia pseudomallei 576]
 gi|226194716|ref|ZP_03790310.1| hypothetical protein BUH_4600 [Burkholderia pseudomallei Pakistan
           9]
 gi|254189482|ref|ZP_04895992.1| hypothetical protein BURPSPAST_E0162 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|52211674|emb|CAH37670.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|157937160|gb|EDO92830.1| hypothetical protein BURPSPAST_E0162 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|217394111|gb|EEC34131.1| hypothetical protein BUC_4429 [Burkholderia pseudomallei 576]
 gi|225933282|gb|EEH29275.1| hypothetical protein BUH_4600 [Burkholderia pseudomallei Pakistan
           9]
          Length = 275

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 23  SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 82

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 83  DEQQRWRQRTRDACG--------------ARIDCLTNAYTARIAALRG 116


>gi|302382749|ref|YP_003818572.1| hypothetical protein Bresu_1638 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193377|gb|ADL00949.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 127

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 40/123 (32%), Gaps = 18/123 (14%)

Query: 10  TIIAIAFQSMALNCNETLMQADMN------------------QCTGNSFALVKEKLEATY 51
            I   A  +++    +  +QA M                    C          +L   Y
Sbjct: 1   MIALFAATALSFAQADPEIQAQMTPVYLQCMAAAGRVPERRLACMTAETERQDHRLNVVY 60

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           +++        R      + AW   R S CA   + A  G+  ++ +A+C     IER  
Sbjct: 61  RRMRTAASPEDRIELRDMERAWIQMRDSYCAADRARAGAGSRAAVAFADCYLAETIERRV 120

Query: 112 KLE 114
            LE
Sbjct: 121 WLE 123


>gi|257125530|ref|YP_003163644.1| hypothetical protein Lebu_0745 [Leptotrichia buccalis C-1013-b]
 gi|257049469|gb|ACV38653.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 143

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 33/89 (37%), Gaps = 3/89 (3%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA- 88
           ADM   + +     ++++   Y  +L+K+   ++  F+  Q  W   R S+   A     
Sbjct: 46  ADMVNASLDLDKEWEKEMNKVYDLILKKLPAKEKTKFKSEQQKWLKNRESQVQKAYDKYT 105

Query: 89  --EEGTAQSMIYANCLQGHAIERNEKLES 115
             E       + A+       ER  +L  
Sbjct: 106 KEEGPRMAGELAASERLSITKERVLELAK 134


>gi|254438983|ref|ZP_05052477.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
 gi|198254429|gb|EDY78743.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
          Length = 136

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 32/94 (34%), Gaps = 15/94 (15%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           +       +  C  + +  + ++L A Y+ +               Q  W +YR + C +
Sbjct: 58  DAGSSTVGIGMCISSEWQQLDDRLNAAYQDI---------------QRGWIVYRDTACDW 102

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                  GT        C+     ++   LE++L
Sbjct: 103 EMVQWGGGTGGGPASVACMMRLTAQQTLFLENHL 136


>gi|187478054|ref|YP_786078.1| hypothetical protein BAV1554 [Bordetella avium 197N]
 gi|115422640|emb|CAJ49166.1| putative exported protein [Bordetella avium 197N]
          Length = 146

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 8/119 (6%)

Query: 6   IFALTIIAIAFQSMALNCNETLM--QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           + A  +   +  ++A +C+  L         C   +    K  L+A Y  +  K+   + 
Sbjct: 11  LTAAVLCLASQPALADDCDAPLSEESHQALVCVQTALDRQKSALQARYDALRSKLPGEEA 70

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE------GTAQSMIYANCLQGHAIERNEKLESY 116
              ++ Q +W  +  ++C      A         T   +    C       R E+L  Y
Sbjct: 71  SKLDRDQASWASFVEADCEVFTDMAGGENDTWRQTWGEIALNACRVEMMSAREERLGQY 129


>gi|218892920|ref|YP_002441789.1| hypothetical protein PLES_42051 [Pseudomonas aeruginosa LESB58]
 gi|254234249|ref|ZP_04927572.1| hypothetical protein PACG_00086 [Pseudomonas aeruginosa C3719]
 gi|126166180|gb|EAZ51691.1| hypothetical protein PACG_00086 [Pseudomonas aeruginosa C3719]
 gi|218773148|emb|CAW28960.1| hypothetical protein PLES_42051 [Pseudomonas aeruginosa LESB58]
          Length = 111

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 27/96 (28%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   +      ++   Y  +        R   +  Q  W   R  
Sbjct: 22  SFDCEKAERADEKAICANRALNDKDVEMSVKYHFLRGLFAMGGRGAMQDRQQDWLRQRRR 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C         G        +CL     +R ++L+ 
Sbjct: 82  -C--------GG------DTDCLSRAYAQRIDELDK 102


>gi|224438779|ref|ZP_03659641.1| hypothetical protein HcinC1_12050 [Helicobacter cinaedi CCUG 18818]
          Length = 387

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/150 (10%), Positives = 45/150 (30%), Gaps = 38/150 (25%)

Query: 1   MCRKIIF--ALTIIAIAFQS-------MALNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I      +++I+  +        + +C +   + +   C  +      +   +  
Sbjct: 1   MQKILIVLGVFLMLSISVNAQSPQEAKPSFDCAKASTKVEKIICEDSSGELQNLDRYMAE 60

Query: 50  TYKKVLEKVEK-------HQRELFEKSQMAWEI-------------YRG--SECAFAASG 87
            Y ++  +++K        + +   +SQ  +               Y+   +E       
Sbjct: 61  VYTQLRNELKKSSLSDKNQRLDNLLQSQRRFITSANNINSNNAASIYKDLFNEEDEELIL 120

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYL 117
              G  + +I          +R   L   L
Sbjct: 121 RMGGNEKGIIQN-----MYKKRTIILLKLL 145


>gi|226192748|pdb|3GI7|A Chain A, Crystal Structure Of A Duf1311 Family Protein (Pp0307)
           From Pseudomonas Putida Kt2440 At 1.85 A Resolution
 gi|226192749|pdb|3GI7|B Chain B, Crystal Structure Of A Duf1311 Family Protein (Pp0307)
           From Pseudomonas Putida Kt2440 At 1.85 A Resolution
          Length = 122

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 44/115 (38%), Gaps = 8/115 (6%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL------FEKSQMAW 73
           +  C+          C   +  + + +L++ Y +++E+      +        E ++  W
Sbjct: 7   STPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEAAEKVW 66

Query: 74  EIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
              R ++C       + G+ A  + + +C+   + ER E L S L     D   P
Sbjct: 67  SQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRS-LGSQNSDEPAP 120


>gi|295675822|ref|YP_003604346.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
 gi|295435665|gb|ADG14835.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
          Length = 247

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 42/109 (38%), Gaps = 6/109 (5%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            +        QC  N+       ++  Y+++L KV   +R L+EKSQ +W   R +E   
Sbjct: 62  ADMSTTIGQVQCMDNARIGWMAAVDNAYQQLLAKVPPARRRLWEKSQSSWLASRDAEKQL 121

Query: 84  AASGAE--EGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
            A+     +G+   +  A+       +R   L S L     D   P   
Sbjct: 122 LAAVFATTQGSMYVLSEADMQLQPVRDRALVLRSAL----ADASGPAPR 166


>gi|238563611|ref|ZP_00438592.2| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|238520354|gb|EEP83815.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
          Length = 143

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +
Sbjct: 54  SSTAGQIQCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRA 113

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLE 114
             E  +GT  +M  A+       ER   L 
Sbjct: 114 VYETTQGTMYAMANADMRLQPVRERALALR 143


>gi|169836425|ref|ZP_02869613.1| hypothetical protein cdivTM_04870 [candidate division TM7
           single-cell isolate TM7a]
          Length = 135

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 5/82 (6%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                     +L   YK ++ K+   Q+      +  W   R        S  E GT   
Sbjct: 51  MDEIQNAWDNELNKVYKLLMSKLSSTQKTKLRNEEREWLKRRE---RKVNSETEGGTGMG 107

Query: 96  --MIYANCLQGHAIERNEKLES 115
             ++Y + +     +R  +L  
Sbjct: 108 FRIVYYSIMTEWTRDRAIELAR 129


>gi|330818551|ref|YP_004362256.1| hypothetical protein bgla_1g36970 [Burkholderia gladioli BSR3]
 gi|327370944|gb|AEA62300.1| hypothetical protein bgla_1g36970 [Burkholderia gladioli BSR3]
          Length = 128

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 32/96 (33%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   + +    ++   Y+ ++  V    R    ++Q  W   R +
Sbjct: 37  SFDCKQARQADERAICASRALSEQDVEMSVRYEMLMGLVAMGTRGDMGEAQQQWLK-RRA 95

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C  +               +CL     ER + L+ 
Sbjct: 96  RCGASQ--------------SCLATAYRERIDALKQ 117


>gi|237732384|ref|ZP_04562865.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226907923|gb|EEH93841.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 183

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 29/101 (28%), Gaps = 15/101 (14%)

Query: 14  IAFQSMALNCNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
                 + +C        +   C   S + +   L   YK+ L K   +     +  Q  
Sbjct: 90  STSTGPSFSCAAVAKGSIEEIICQSPSLSEMDLALNGAYKQALVKSSNN--PTLKAEQRG 147

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           W   R  EC                 + C+  +  ER  +L
Sbjct: 148 WVKGRN-ECWKEQDK-----------SACIARNYNERMAEL 176


>gi|116049045|ref|YP_792153.1| hypothetical protein PA14_49960 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254239485|ref|ZP_04932807.1| hypothetical protein PA2G_00098 [Pseudomonas aeruginosa 2192]
 gi|313106080|ref|ZP_07792338.1| hypothetical protein PA39016_000160017 [Pseudomonas aeruginosa
           39016]
 gi|115584266|gb|ABJ10281.1| hypothetical protein PA14_49960 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126192863|gb|EAZ56926.1| hypothetical protein PA2G_00098 [Pseudomonas aeruginosa 2192]
 gi|310878840|gb|EFQ37434.1| hypothetical protein PA39016_000160017 [Pseudomonas aeruginosa
           39016]
          Length = 111

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 27/96 (28%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   +      ++   Y  +        R   +  Q  W   R  
Sbjct: 22  SFDCEKAERADEKAICANRALNDKDVEMSVKYHFLRGLFAMGGRGAMQDRQQDWLRERRR 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C         G        +CL     +R ++L+ 
Sbjct: 82  -C--------GG------DTDCLSRAYAQRIDELDK 102


>gi|167905215|ref|ZP_02492420.1| hypothetical protein BpseN_23429 [Burkholderia pseudomallei NCTC
           13177]
          Length = 275

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 13/108 (12%), Positives = 28/108 (25%), Gaps = 21/108 (19%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 23  SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARSADEGMAYREFRDALR 82

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             Q  W       C                  +CL      R   L  
Sbjct: 83  DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIAALRG 116


>gi|239904891|ref|YP_002951629.1| hypothetical protein DMR_02520 [Desulfovibrio magneticus RS-1]
 gi|239794754|dbj|BAH73743.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 145

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 46  KLEATYKKVLEK--VEKHQRELFEKSQMAWEIYRGSECAFAA---SGAEEGTAQSMIYAN 100
           +L A Y  VL+K   +K+  +  + +Q AW  +R +E A         E G+A  + + N
Sbjct: 53  ELNAVYTAVLKKNADDKNFIDKLKVAQRAWVAFRDAEMAARYPARDKGEYGSAFDLCWCN 112

Query: 101 CLQGHAIERNEKLESYLT-CPEGDL 124
            L     +R E+L+ +    PEGD+
Sbjct: 113 GLAALTQQRTEQLKPWRDGIPEGDV 137


>gi|156935157|ref|YP_001439073.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533411|gb|ABU78237.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 50/139 (35%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSF-----------ALVKEKLEAT 50
            RKI+F ++ + I+   MA +  +      ++QC    +              + +L+  
Sbjct: 1   MRKIVFLVSTLLISHNLMAADQKDINADNAVDQCLDKYYEFSSECLEDLNDKTEAELKQA 60

Query: 51  YKKVLEKVEKHQR---------------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           Y+  L+ +E+                  E F KSQ  W  YR S C  A  G +E     
Sbjct: 61  YETKLKSLERVDYTKWWMGDEDRKKRMIEAFRKSQRDWLTYRDSYCEVATIGEQETHFIG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C       R ++++
Sbjct: 121 AASVGCNINMNKRRIKEIQ 139


>gi|120554246|ref|YP_958597.1| hypothetical protein Maqu_1321 [Marinobacter aquaeolei VT8]
 gi|120324095|gb|ABM18410.1| hypothetical protein Maqu_1321 [Marinobacter aquaeolei VT8]
          Length = 405

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 32/104 (30%), Gaps = 21/104 (20%)

Query: 19  MALNCNETL--MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            + +C+ T    Q +   C  +  +     L   Y  V  ++E         SQ+ W   
Sbjct: 198 PSFSCSNTSKLSQVEKQICGSSQLSRADRVLANLYNFVQVEIENDD---LRASQLNWLDK 254

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           R ++C                   C+     ER  +L   +T  
Sbjct: 255 R-AKCDDE---------------QCIYSEYSERISELVGMVTVE 282



 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 39/99 (39%), Gaps = 2/99 (2%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           N      ++ Q       +  E++ A   + L   E  Q++  + SQ  WE Y  + C  
Sbjct: 294 NAPQTMREIQQAEKLKMEIAFEEMNAYLAEAL-IAEVEQKDAIQNSQSLWEQYANAHCDA 352

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCPE 121
                  G+ +   Y  C +   +ER   + + +LT P+
Sbjct: 353 VYERWSGGSVRFFEYYRCHKELILERTRVIWKEFLTYPD 391


>gi|329119582|ref|ZP_08248264.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464320|gb|EGF10623.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 346

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 25/86 (29%), Gaps = 1/86 (1%)

Query: 36  TGNSFALVKEKLE-ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
                A   ++        V   +    ++  +  Q  W   + + C  AA+ A++    
Sbjct: 261 AELDSARSDQQASEREINAVWRGLNPTVQQSLQDEQREWIGRKNTACRRAAAKADDPARA 320

Query: 95  SMIYANCLQGHAIERNEKLESYLTCP 120
             +   C      ER   L  +    
Sbjct: 321 EYLRLQCDAQQTRERTGYLRGFGEAE 346


>gi|325497710|gb|EGC95569.1| hypothetical protein ECD227_1807 [Escherichia fergusonii ECD227]
          Length = 149

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 23/133 (17%)

Query: 2   CRKIIFALTIIAI-------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            R ++F +    I       ++ S   NC     Q ++  C  N        L+     +
Sbjct: 8   LRVLLFIIIFFMIGRVYANTSYYSSKNNCEYGE-QPEIADCLRNELIESTIMLKEAENNI 66

Query: 55  LEKVEKH--------------QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
            ++++K                    ++S  A+  YR ++CAFA S    G        +
Sbjct: 67  KQRIQKWSAEKSASLDEAIPVALYKLDESHKAFVRYRFTQCAFAGS-WGNGVGSFTRIFS 125

Query: 101 CLQGHAIERNEKL 113
           C+     +R ++L
Sbjct: 126 CMAELNRQRAKQL 138


>gi|197105877|ref|YP_002131254.1| hypothetical protein PHZ_c2416 [Phenylobacterium zucineum HLK1]
 gi|196479297|gb|ACG78825.1| hypothetical protein PHZ_c2416 [Phenylobacterium zucineum HLK1]
          Length = 251

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/98 (13%), Positives = 22/98 (22%), Gaps = 17/98 (17%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
               + +C           C     A    +L + Y+  L   +          Q AW  
Sbjct: 161 GAQPSFDCGRADTDVLRMICMIPDLANADVRLASAYQTALSTADDP--SRLRDEQRAWLE 218

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            R +               +      L      R  +L
Sbjct: 219 RRDA---------------APADPRVLLSLYQARMAEL 241


>gi|188993783|ref|YP_001905793.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167735543|emb|CAP53758.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris]
          Length = 146

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/134 (14%), Positives = 42/134 (31%), Gaps = 19/134 (14%)

Query: 3   RKIIFALTIIAIAFQSMALN------------------CNE-TLMQADMNQCTGNSFALV 43
           R ++ A   +     + A +                  C +      +   C      + 
Sbjct: 9   RLLLLAALSVGGMACAHATDRQGTDASSSRGLSTTYAACQKQARGAIEQAACISQEEMIQ 68

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
             +L   YK++L  ++   R     +Q  W + R  +    A    +   +++  A    
Sbjct: 69  DRRLNKVYKQLLASLKADSRTKLVDAQRTWLLSRTKDGNLEAVIYGDSQPENIESAEAAM 128

Query: 104 GHAIERNEKLESYL 117
                R ++LE YL
Sbjct: 129 LRLSARADQLEEYL 142


>gi|218549298|ref|YP_002383089.1| hypothetical protein EFER_1960 [Escherichia fergusonii ATCC 35469]
 gi|218356839|emb|CAQ89467.1| conserved hypothetical protein; putative exported protein
           [Escherichia fergusonii ATCC 35469]
          Length = 149

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 23/133 (17%)

Query: 2   CRKIIFALTIIAI-------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            R ++F +    I       ++ S   NC     Q ++  C  N        L+     +
Sbjct: 8   LRVLLFIVIFFMIGRVYANTSYYSSKNNCEYGE-QPEIADCLRNELIESTIMLKEAENNI 66

Query: 55  LEKVEKH--------------QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
            ++++K                    ++S  A+  YR ++CAFA S    G        +
Sbjct: 67  KQRIQKWSAEKSASLDEAIPVALYKLDESHKAFVRYRFTQCAFAGS-WGNGVGSFTRIFS 125

Query: 101 CLQGHAIERNEKL 113
           C+     +R ++L
Sbjct: 126 CMAELNRQRAKQL 138


>gi|283956226|ref|ZP_06373707.1| hypothetical protein C1336_000240007 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792279|gb|EFC31067.1| hypothetical protein C1336_000240007 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 327

 Score = 53.6 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 35/117 (29%), Gaps = 28/117 (23%)

Query: 10  TIIAIAFQSMALNCNETLMQADMNQCTGN--SFALVKEKLEATYKKVLEKV-------EK 60
            + +      + +C +   + +   C         +   +   Y ++ +++       ++
Sbjct: 1   MLQSPKEAKPSFDCAKASTEVEKIICNDEDGELQNLDRYMGEVYTQLRKELKISNFADKE 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + +    SQ A+                     ++   + ++    ER  +L   L
Sbjct: 61  QRLKDLLDSQRAFIK-------------------NLNKVDFIKDAYEERITQLLKLL 98


>gi|49079924|gb|AAT49950.1| PA1114 [synthetic construct]
          Length = 112

 Score = 53.6 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 28/96 (29%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   +      ++   Y+ +        R   +  Q  W   R  
Sbjct: 22  SFDCEKAERADEKAICANRALNDKDVEMSVKYRFLRGLFAMGGRGAMQDRQQDWLRERRR 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C         G        +CL     +R ++L+ 
Sbjct: 82  -C--------GG------DTDCLSRAYAQRIDELDK 102


>gi|172062817|ref|YP_001810468.1| hypothetical protein BamMC406_3785 [Burkholderia ambifaria MC40-6]
 gi|171995334|gb|ACB66252.1| hypothetical protein BamMC406_3785 [Burkholderia ambifaria MC40-6]
          Length = 570

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 27/95 (28%), Gaps = 17/95 (17%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++    A+   CT    A    +L A Y K    V           +  W  YR  
Sbjct: 482 SFDCSKAHSDAEHLICTDAQLAAADVELAAMYTKAKAAVTDQVAFKARTLEQ-W-NYREK 539

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            C                   CL     ++   L+
Sbjct: 540 ACHDRE---------------CLARWYADQRTVLQ 559


>gi|332871425|ref|ZP_08439942.1| hypothetical protein HMPREF0020_03597 [Acinetobacter baumannii
           6013113]
 gi|332731462|gb|EGJ62752.1| hypothetical protein HMPREF0020_03597 [Acinetobacter baumannii
           6013113]
          Length = 248

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 46/126 (36%), Gaps = 17/126 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QREL 65
            L I ++   S A +  +     +        ++  + +L + Y  +   +  +  + + 
Sbjct: 14  FLLIFSVCITSNATD-YKPEQLDEKTI-----YSNSEHELNSVYSDIKGYISDNKNEVKY 67

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--EG 122
              +Q  W   R  +C F    A  G  +      CL      + + L+ SYL     EG
Sbjct: 68  LVDTQRFWLKNRNLKCNFNGKEANSGNYK------CLSDFNNSKIKDLKNSYLDLDNLEG 121

Query: 123 DLLCPF 128
            L+ PF
Sbjct: 122 KLIKPF 127


>gi|294670919|ref|ZP_06735775.1| hypothetical protein NEIELOOT_02623 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307406|gb|EFE48649.1| hypothetical protein NEIELOOT_02623 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 302

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 11/100 (11%), Positives = 32/100 (32%), Gaps = 4/100 (4%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +   +     +  +  +   + +     ++   ++     ++   ++     Q  W   
Sbjct: 204 PAKNEDPAPPGVSDEELEQAHSDYRAADREINNVWRD----LDSVIQQGLRDEQREWINR 259

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           + + C  AA+ A+       +   C      ER + L  Y
Sbjct: 260 KNAACRRAAAQADSPERAEYLRLQCDSRQTRERIQYLRDY 299


>gi|213159103|ref|YP_002321101.1| hypothetical protein AB57_3813 [Acinetobacter baumannii AB0057]
 gi|215481879|ref|YP_002324061.1| hypothetical protein ABBFA_000120 [Acinetobacter baumannii
           AB307-0294]
 gi|332850127|ref|ZP_08432514.1| hypothetical protein HMPREF0021_00083 [Acinetobacter baumannii
           6013150]
 gi|213058263|gb|ACJ43165.1| hypothetical protein AB57_3813 [Acinetobacter baumannii AB0057]
 gi|213985972|gb|ACJ56271.1| hypothetical protein ABBFA_000120 [Acinetobacter baumannii
           AB307-0294]
 gi|332730976|gb|EGJ62282.1| hypothetical protein HMPREF0021_00083 [Acinetobacter baumannii
           6013150]
          Length = 245

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 46/126 (36%), Gaps = 17/126 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QREL 65
            L I ++   S A +  +     +        ++  + +L + Y  +   +  +  + + 
Sbjct: 11  FLLIFSVCITSNATD-YKPEQLDEKTI-----YSNSEHELNSVYSDIKGYISDNKNEVKY 64

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--EG 122
              +Q  W   R  +C F    A  G  +      CL      + + L+ SYL     EG
Sbjct: 65  LVDTQRFWLKNRNLKCNFNGKEANSGNYK------CLSDFNNSKIKDLKNSYLDLDNLEG 118

Query: 123 DLLCPF 128
            L+ PF
Sbjct: 119 KLIKPF 124


>gi|169794322|ref|YP_001712115.1| hypothetical protein ABAYE0122 [Acinetobacter baumannii AYE]
 gi|169147249|emb|CAM85108.1| hypothetical protein ABAYE0122 [Acinetobacter baumannii AYE]
          Length = 267

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 46/126 (36%), Gaps = 17/126 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QREL 65
            L I ++   S A +  +     +        ++  + +L + Y  +   +  +  + + 
Sbjct: 33  FLLIFSVCITSNATD-YKPEQLDEKTI-----YSNSEHELNSVYSDIKGYISDNKNEVKY 86

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--EG 122
              +Q  W   R  +C F    A  G  +      CL      + + L+ SYL     EG
Sbjct: 87  LVDTQRFWLKNRNLKCNFNGKEANSGNYK------CLSDFNNSKIKDLKNSYLDLDNLEG 140

Query: 123 DLLCPF 128
            L+ PF
Sbjct: 141 KLIKPF 146


>gi|242241165|ref|YP_002989346.1| hypothetical protein Dd703_3770 [Dickeya dadantii Ech703]
 gi|242133222|gb|ACS87524.1| conserved hypothetical protein [Dickeya dadantii Ech703]
          Length = 254

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 35/122 (28%), Gaps = 21/122 (17%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS---- 69
            +  + +  C +     +   C   + + + ++L   ++K    +  + +   +      
Sbjct: 19  FSALAASFPCQQAASTQEKLICQNPTLSQMDDELAKEWQKSRALLTDNPQRAAQDKNLTL 78

Query: 70  -QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            Q  W   R + C                   CL     ++  +L       +  L  P 
Sbjct: 79  FQRGWLTSRSA-CRNEE---------------CLHQSYQQQIARLRYLNDITQHTLPAPI 122

Query: 129 IN 130
           + 
Sbjct: 123 VR 124


>gi|255066701|ref|ZP_05318556.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
 gi|255049029|gb|EET44493.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
          Length = 155

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 42/112 (37%), Gaps = 4/112 (3%)

Query: 18  SMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           ++   C   +++Q D+  C   S+ L +++L   Y    ++   + R      Q  W   
Sbjct: 33  ALNKPCHVNSIIQEDILICFSKSYLLAQKELNNNYSIAQKQKNVNIRNYLIHQQRQWNKN 92

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +  EC       E G      Y  C     ++RN  L+    C  G+  C F
Sbjct: 93  KFDEC-LILPEKEVGREGIFEYLQCATDAILKRNSYLKEIYVC--GNEPCQF 141


>gi|238764418|ref|ZP_04625367.1| hypothetical protein ykris0001_27400 [Yersinia kristensenii ATCC
           33638]
 gi|238697334|gb|EEP90102.1| hypothetical protein ykris0001_27400 [Yersinia kristensenii ATCC
           33638]
          Length = 90

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 34/91 (37%), Gaps = 9/91 (9%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASG 87
           M  C        K+ +   Y+K+ + +E     +  + FE +Q +W   R + C      
Sbjct: 1   MMGCADLVSDTAKKDINIVYQKIYKIIEVRDLPYVTKNFETAQKSWLTLRENWCDVQGFI 60

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  + +Y+ C     I R  +L  +L 
Sbjct: 61  -----IGTPMYSICRMDMNISRVNELNGFLE 86


>gi|167617098|ref|ZP_02385729.1| hypothetical protein BthaB_12403 [Burkholderia thailandensis Bt4]
          Length = 275

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/109 (11%), Positives = 28/109 (25%), Gaps = 21/109 (19%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELF 66
              ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+  
Sbjct: 22  PFARAASFDCARAASAAERAICGTPALGELDVRMAAYYELLQNARPADEGIAYREFRDAL 81

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q +W       C                  +CL      R   L  
Sbjct: 82  RDGQQSWRQRVRDACG--------------ARIDCLTNAYTARIAALRG 116


>gi|241668639|ref|ZP_04756217.1| hypothetical protein FphipA2_07721 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877172|ref|ZP_05249882.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843193|gb|EET21607.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 96

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 40/108 (37%), Gaps = 21/108 (19%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R I+     + I   + +  C+      ++NQC      +  +KL+            
Sbjct: 1   MLRIIL--SLFLPILVFANSPICD--GNTYEINQCLKTQMQMYDKKLD------------ 44

Query: 61  HQRELFEKSQ-MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
                 + S    ++ YR + C+  +S    GT +S+ Y NC+     
Sbjct: 45  ----SLKNSNIKEFKKYRDNICSNISSAYNGGTYESIKYGNCIISLDR 88


>gi|225077080|ref|ZP_03720279.1| hypothetical protein NEIFLAOT_02133 [Neisseria flavescens
           NRL30031/H210]
 gi|224951637|gb|EEG32846.1| hypothetical protein NEIFLAOT_02133 [Neisseria flavescens
           NRL30031/H210]
          Length = 340

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/89 (13%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  +
Sbjct: 309 ADSAAQAEYLRLQCETRMTRERTQYLRGF 337


>gi|221209744|ref|ZP_03582725.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221170432|gb|EEE02898.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 205

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 31/98 (31%), Gaps = 17/98 (17%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C     + ++  C     A +  +L   Y   +  V + +     +SQ  W I R  
Sbjct: 110 SFDCARATAEDEIAICGDAGLAAMDRQLGQLYTAAMRTVSEPR--ALRRSQSDWVITR-H 166

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            C                  +CL+    ER  +    L
Sbjct: 167 MCNSD--------------IDCLRRAYGERIGQFMGSL 190


>gi|253988925|ref|YP_003040281.1| hypothetical protein PAU_01444 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253780375|emb|CAQ83536.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 207

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 9/66 (13%), Positives = 25/66 (37%), Gaps = 1/66 (1%)

Query: 9  LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
          + +++ +  S + +C + + +A+M  C     +   + L   Y    +  +         
Sbjct: 1  MLLVSASAHSASFDCAKAVSKAEMLICGTPELSQADDNLYVDYLSAKQVTDNSADFKALT 60

Query: 69 SQMAWE 74
           Q  W+
Sbjct: 61 KQ-NWK 65


>gi|167569206|ref|ZP_02362080.1| hypothetical protein BoklC_05135 [Burkholderia oklahomensis C6786]
          Length = 236

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 35/91 (38%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +      +++A Y+++ +      R  +++SQ  W  +R  E     +
Sbjct: 49  SSTAGQIQCMDEARQQWLAEVDAAYQRLQKAAPADARRGWQESQRRWLAWRKDEAHLVRA 108

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +  +GT  +M  A+       +R   L  
Sbjct: 109 VYDTTQGTMYAMASADMRLQPVRDRARALRG 139



 Score = 36.3 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 8/72 (11%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y K+  ++         ++Q  W  +R +                +I  +    
Sbjct: 171 FDMNRYYAKLQSRMPAASLPTLAQAQREWAAFRDA-------------MTPLISEDERVD 217

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 218 LIGARVATLKRF 229


>gi|83717801|ref|YP_440355.1| hypothetical protein BTH_II2167 [Burkholderia thailandensis E264]
 gi|83651626|gb|ABC35690.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 418

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/109 (11%), Positives = 28/109 (25%), Gaps = 21/109 (19%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELF 66
              ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+  
Sbjct: 165 PFARAASFDCARAASAAERAICGTPALGELDVRMAAYYELLQNARPADEGIAYREFRDAL 224

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q +W       C                  +CL      R   L  
Sbjct: 225 RDGQQSWRQRVRDACGA--------------RIDCLTNAYTARIAALRG 259


>gi|15596311|ref|NP_249805.1| hypothetical protein PA1114 [Pseudomonas aeruginosa PAO1]
 gi|107100567|ref|ZP_01364485.1| hypothetical protein PaerPA_01001592 [Pseudomonas aeruginosa PACS2]
 gi|9947032|gb|AAG04503.1|AE004541_8 hypothetical protein PA1114 [Pseudomonas aeruginosa PAO1]
          Length = 111

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/96 (12%), Positives = 27/96 (28%), Gaps = 15/96 (15%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     +   C   +      ++   Y+ +        R   +  Q  W   R  
Sbjct: 22  SFDCEKAERADEKAICANRALNDKDVEMSVKYRFLRGLFAMGGRGAMQDRQQDWLRERRR 81

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            C                  +CL     +R ++L+ 
Sbjct: 82  -CGGDT--------------DCLSRAYAQRIDELDK 102


>gi|283832221|ref|ZP_06351962.1| putative lipoprotein [Citrobacter youngae ATCC 29220]
 gi|291071860|gb|EFE09969.1| putative lipoprotein [Citrobacter youngae ATCC 29220]
          Length = 204

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 31/100 (31%), Gaps = 15/100 (15%)

Query: 17  QSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
              + +C+       +   C   S + +   L   YK+ L  V+       +  Q  W  
Sbjct: 114 SGPSFSCSAVEKGSIEEVICQSPSLSAMDVTLNGAYKQAL--VKSKNNPTLKAEQRGWVK 171

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            R  EC                   C+  +  ER  +L++
Sbjct: 172 GRN-ECWKEQDKP-----------ACIARNYNERMTELQN 199


>gi|255068452|ref|ZP_05320307.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
 gi|255047294|gb|EET42758.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
          Length = 338

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 28/82 (34%), Gaps = 1/82 (1%)

Query: 36  TGNSFALVKEKLEATYKK-VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
           +    A  +        K V + +E+  ++     Q AW   +   C  AA+ A+     
Sbjct: 254 SDLDNARSQNHQAEAEIKGVWDGMERTVQQEMLAEQRAWIQTKNQNCQQAAARADSPAQN 313

Query: 95  SMIYANCLQGHAIERNEKLESY 116
             +   C      ER + L  Y
Sbjct: 314 EYLKLQCDTRMTRERTQYLRGY 335


>gi|90579030|ref|ZP_01234840.1| hypothetical protein VAS14_04973 [Vibrio angustum S14]
 gi|90439863|gb|EAS65044.1| hypothetical protein VAS14_04973 [Vibrio angustum S14]
          Length = 403

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 38/119 (31%), Gaps = 18/119 (15%)

Query: 1   MCRKIIF---ALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M   ++    A+   +    +   +   C+      D   C     AL+ +++   Y++V
Sbjct: 1   MRCLVLLFVGAIATFSTTLMAANNDGSYCHSATSNIDQLICKDPKLALLHKQMSDMYQQV 60

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           L +    +  + +++Q  W   R             G         CL      R + L
Sbjct: 61  LTQSMVSEASVIKETQKNWLESRT------------GCLDKPDVQRCLVSTYDSRLDNL 107


>gi|326314868|ref|YP_004232540.1| hypothetical protein Acav_0046 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323371704|gb|ADX43973.1| hypothetical protein Acav_0046 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 134

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 33/106 (31%), Gaps = 12/106 (11%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL---------FEKSQM 71
             C+    QA M  C     +  K+ L       +  + K   +           + S  
Sbjct: 22  EECS-AHSQAGMRDCLAKKASNSKDDLRQARNNAISILSKWDEDAQYAGRAKAELDASDK 80

Query: 72  AWEIYRGSECAFAASGAEEGTA--QSMIYANCLQGHAIERNEKLES 115
            +E YR + C F AS +  G      +    C+      R  +L  
Sbjct: 81  DFEKYRDAHCKFRASLSGGGAGNSHEIQRLACIAELNTTRARQLRD 126


>gi|324114184|gb|EGC08157.1| hypothetical protein ERIG_01298 [Escherichia fergusonii B253]
          Length = 149

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 23/133 (17%)

Query: 2   CRKIIFALTIIAI-------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            R ++F +    I       ++ S   NC     Q ++  C  N        L+     +
Sbjct: 8   LRVLLFIVIFFMIGRVYANTSYYSNKNNCEYGE-QPEIADCLRNELIESTIMLKEAENNI 66

Query: 55  LEKVEKH--------------QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
            ++++K                    ++S  A+  YR ++CAFA S    G        +
Sbjct: 67  KQRIQKWSAEKSASLDEAIPVALYKLDESHKAFVRYRFTQCAFAES-WGNGVGSFTRIFS 125

Query: 101 CLQGHAIERNEKL 113
           C+     +R ++L
Sbjct: 126 CMAELNRQRAKQL 138


>gi|330998664|ref|ZP_08322394.1| conserved domain protein [Parasutterella excrementihominis YIT
           11859]
 gi|329576525|gb|EGG58033.1| conserved domain protein [Parasutterella excrementihominis YIT
           11859]
          Length = 231

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 42/126 (33%), Gaps = 14/126 (11%)

Query: 1   MCRK---IIFALTIIAIAFQSMALN-------CNE-TLMQADMNQCTGNSFALVKEKLEA 49
           M R    +   +  ++ A  +           C +  +    +  C       +   +  
Sbjct: 1   MKRLSLSLAVVILALSSAVSASDFEEDKQYISCRKGAVNDRQLTACQERLLERLDMSIAK 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
              + +  + + +R   ++ Q  WE +R S C ++     +   Q  +   C    A +R
Sbjct: 61  ALDRNMTLLAESERITAQRYQSQWESWRQSHCDYSLRKQND---QQHLSLACYLQAARDR 117

Query: 110 NEKLES 115
            + LE 
Sbjct: 118 LDMLEG 123


>gi|218513871|ref|ZP_03510711.1| hypothetical protein Retl8_09238 [Rhizobium etli 8C-3]
          Length = 96

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 36/99 (36%), Gaps = 16/99 (16%)

Query: 16  FQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
            Q+ + +C+ + L   +   C   +      K+  +++ +   +    R   +  Q AW 
Sbjct: 2   AQAASFDCDGKELKPDEKVICDNRALNDADVKMATSFELLSGLLAMGSRGTLQDEQTAWL 61

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             R  EC   A+              CL+    ER ++L
Sbjct: 62  KKR-QECGADAA--------------CLKAAYEERLKQL 85


>gi|209548965|ref|YP_002280882.1| hypothetical protein Rleg2_1362 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534721|gb|ACI54656.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 117

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 43/115 (37%), Gaps = 17/115 (14%)

Query: 1   MCRKIIFALTIIAI-AFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M     FA++I A    Q+ + +C+ + L   +   C   +      K+  T++ +   +
Sbjct: 7   MMMSFGFAISIFASDMAQAASFDCDAKELKPDEKTICDNRALNDADVKMVTTFELLSGLL 66

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               R   +  Q AW   R  ECA  A               C++    ER ++L
Sbjct: 67  AMGARGTLQDEQTAWLKKR-QECAADAV--------------CIKAAYDERLKQL 106


>gi|241204196|ref|YP_002975292.1| hypothetical protein Rleg_1461 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858086|gb|ACS55753.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 117

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 37/109 (33%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
              L I +   Q+ + +C+ + L   +   C   +      K+  T+  +   +    R 
Sbjct: 13  FAILLIASNLAQAASFDCDAKELKPDEKAICDNRALNDADVKMVTTFDLLSGLLAMGSRG 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A+              C++    ER ++ 
Sbjct: 73  TLQDEQTAWLKKR-QECGADAA--------------CIKAAYDERLKQF 106


>gi|170735556|ref|YP_001774670.1| lipoprotein-like protein [Burkholderia cenocepacia MC0-3]
 gi|169821594|gb|ACA96175.1| lipoprotein-like protein [Burkholderia cenocepacia MC0-3]
          Length = 245

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 28/94 (29%), Gaps = 17/94 (18%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + NC +     +   C     A +  +L   Y   L+     +     +S+  W   R  
Sbjct: 154 SFNCLQASHDDEWAICHDPGLAAMDRRLAQLYSAALQNSSDTE--ALRQSESNWVTAR-H 210

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +C                  +CL+    ER  + 
Sbjct: 211 QCGKD--------------LDCLRRAYGERIGQF 230


>gi|303258325|ref|ZP_07344328.1| hypothetical protein HMPREF0189_01713 [Burkholderiales bacterium
           1_1_47]
 gi|302858771|gb|EFL81859.1| hypothetical protein HMPREF0189_01713 [Burkholderiales bacterium
           1_1_47]
          Length = 231

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 42/126 (33%), Gaps = 14/126 (11%)

Query: 1   MCRK---IIFALTIIAIAFQSMALN-------CNE-TLMQADMNQCTGNSFALVKEKLEA 49
           M R    +   +  ++ A  +           C +  +    +  C       +   +  
Sbjct: 1   MKRLSLSLAVVILALSSAVSASDFEEDEQYISCRKGAVNDRQLTACQERLLERLDMSIAK 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
              + +  + + +R   ++ Q  WE +R S C ++     +   Q  +   C    A +R
Sbjct: 61  ALDRNMTLLAESERITAQRYQSQWESWRQSHCDYSLRKQND---QQHLSLACYLQAARDR 117

Query: 110 NEKLES 115
            + LE 
Sbjct: 118 LDMLEG 123


>gi|116251570|ref|YP_767408.1| hypothetical protein RL1804 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256218|emb|CAK07299.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 117

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 39/109 (35%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
              L I +   Q+ + +C+   ++A +   C   +      K+  T++ +   +    R 
Sbjct: 13  FAILLIGSNLAQAASFDCDAKELKADEKAICDNRALNDADVKMVTTFELLSGLLAMGSRG 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A               C++    ER ++L
Sbjct: 73  TLQDEQTAWLKKR-QECGADA--------------TCIKAAYDERLKQL 106


>gi|315637378|ref|ZP_07892592.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315478325|gb|EFU69044.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 159

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-----EGTAQ 94
           + L  ++L   Y+K++ K+   ++EL ++SQ  W  +R     F +   +     EGT  
Sbjct: 67  YELWDKELNIYYRKLMSKLTAKEKELLKESQKKWLEFRDKTIEFNSLMLDRNYDQEGTMF 126

Query: 95  SMIYANC----LQGHAIERNEKLESYLT 118
            +  A+     +      R   L+++  
Sbjct: 127 LLDRASVADSDISEIIKNRVLYLKNWYD 154


>gi|218680037|ref|ZP_03527934.1| hypothetical protein RetlC8_14555 [Rhizobium etli CIAT 894]
          Length = 111

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 37/109 (33%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  L   +    S + +C+       +   C   +      K+  T++ +   +    R 
Sbjct: 7   LAILISTSGPAWSASFDCDGQELKPDEKTICDNRALNDADVKMATTFELLSGLLAMGSRG 66

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R + C   A+              CLQG   ER ++L
Sbjct: 67  TLQDEQTAWLKKRQA-CGADAA--------------CLQGAYDERLKQL 100


>gi|257140989|ref|ZP_05589251.1| hypothetical protein BthaA_17569 [Burkholderia thailandensis E264]
          Length = 283

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/109 (11%), Positives = 28/109 (25%), Gaps = 21/109 (19%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELF 66
              ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+  
Sbjct: 22  PFARAASFDCARAASAAERAICGTPALGELDVRMAAYYELLQNARPADEGIAYREFRDAL 81

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q +W       C                  +CL      R   L  
Sbjct: 82  RDGQQSWRQRVRDACGA--------------RIDCLTNAYTARIAALRG 116


>gi|269119003|ref|YP_003307180.1| hypothetical protein Sterm_0365 [Sebaldella termitidis ATCC 33386]
 gi|268612881|gb|ACZ07249.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 194

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 29/77 (37%), Gaps = 8/77 (10%)

Query: 42  LVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
              ++L A Y+ +++K+   Q+E     Q  W   R ++           +   ++ A+ 
Sbjct: 123 AWDDELNAVYQALMKKLTPSQQEELRTEQRKWIKQRDAKLNE--------SGDHLVNADL 174

Query: 102 LQGHAIERNEKLESYLT 118
                ++R  +L     
Sbjct: 175 FYNLTMDRTYELAELYD 191


>gi|83748392|ref|ZP_00945415.1| Hypothetical Protein RRSL_01787 [Ralstonia solanacearum UW551]
 gi|83724908|gb|EAP72063.1| Hypothetical Protein RRSL_01787 [Ralstonia solanacearum UW551]
          Length = 154

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 52/153 (33%), Gaps = 33/153 (21%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGN------------------- 38
           M RK+   + ++  A  + A +   C        +  C                      
Sbjct: 1   MRRKLKLLIPLLMCASLTYAADRASCAREESTDRIVACIEAGTYDPCDWGGGPHSFSAAQ 60

Query: 39  ----SFALVKEKLEATYKKVLEKVEKHQREL----FEKSQMAWEIYRGSECAFAASGAEE 90
               S  +    L AT ++V +++ +  R      FE++Q  W  +R + C F A    +
Sbjct: 61  CGRVSLEIADRTLRATIQRVAQRLRQGNRVATLADFERTQQQWATFRKNYCRFVAGLDPD 120

Query: 91  GTA---QSMIYANCLQGHAIERNEKLESYLTCP 120
           G+A   Q +    C       RN +LE  +   
Sbjct: 121 GSAGNWQVLTSDACEVRLIKARNAELEILIDAD 153


>gi|222084733|ref|YP_002543262.1| hypothetical protein Arad_0710 [Agrobacterium radiobacter K84]
 gi|221722181|gb|ACM25337.1| hypothetical protein Arad_0710 [Agrobacterium radiobacter K84]
          Length = 118

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 37/106 (34%), Gaps = 6/106 (5%)

Query: 16  FQSMALNCNET------LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS 69
             + + +  +        + ++M +C          +L A Y  + ++    +R   +  
Sbjct: 7   AMAQSEDEMKACVDRSEGVTSEMLKCGQVEIDKFDARLNAAYNILTDRKHGAERLRLQGE 66

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           Q AW  +   E    A+   +G+A  ++           R  +LE 
Sbjct: 67  QRAWLKHHLQEAHRLAADPNDGSAALLVSQGFELDDLTARTLELEK 112


>gi|71278831|ref|YP_269035.1| hypothetical protein CPS_2315 [Colwellia psychrerythraea 34H]
 gi|71144571|gb|AAZ25044.1| hypothetical protein CPS_2315 [Colwellia psychrerythraea 34H]
          Length = 143

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 50/138 (36%), Gaps = 20/138 (14%)

Query: 1   MCR-KIIFALTIIAI-----AFQSMA--LNC----NETLMQADMNQCTGNSFALVKEKLE 48
           M R KI+ A T +          +      C     E +  A M++C     +LV  +L+
Sbjct: 1   MIRNKILLASTFLCPLLMINPVHAAKNIEECQQQNAEKISSAPMSRCLDGVISLVDRELQ 60

Query: 49  ATYKKVLEKVEKHQR--------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
                    +E+           ++F++SQ  +  YR ++C +            ++Y  
Sbjct: 61  TWVNLHTFNLEEKALVNGRYSALKMFKRSQNNFITYRENDCRWQYLAVSPERGADLVYKT 120

Query: 101 CLQGHAIERNEKLESYLT 118
           C    +  R  +L   +T
Sbjct: 121 CYVQSSQNRITELSKIIT 138


>gi|167010538|ref|ZP_02275469.1| hypothetical protein Ftulh_07457 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|282159058|gb|ADA78449.1| hypothetical protein NE061598_04370 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 91

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 34/106 (32%), Gaps = 17/106 (16%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
              I     +    C+      ++N C  +   +   KL                     
Sbjct: 2   TLTILPTLVAADKVCD--GNTYEINACLKSQMQIYDTKLNDVQN---------------H 44

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
               ++ YR + C   +S  + GT Q++ Y NC+        ++L+
Sbjct: 45  DIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 90


>gi|325265902|ref|ZP_08132588.1| lipoprotein [Kingella denitrificans ATCC 33394]
 gi|324982540|gb|EGC18166.1| lipoprotein [Kingella denitrificans ATCC 33394]
          Length = 348

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 24/75 (32%)

Query: 42  LVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
               +   + +     ++   ++     Q  WE  + + C  AA+          +   C
Sbjct: 271 DAHNQANDSIRSAWRNIDPTIQQDLVDEQRDWERRKATSCGNAAAKGNSAVESQYLRMQC 330

Query: 102 LQGHAIERNEKLESY 116
                 ER + L+ +
Sbjct: 331 DTRLTRERVQYLKGF 345


>gi|254560615|ref|YP_003067710.1| hypothetical protein METDI2158 [Methylobacterium extorquens DM4]
 gi|254267893|emb|CAX23759.1| conserved hypothetical protein, putative exported protein, putative
           lipoprotein [Methylobacterium extorquens DM4]
          Length = 113

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 26/96 (27%), Gaps = 15/96 (15%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C +     +   C       +  ++   +  + + +    R   +  Q AW   R + C 
Sbjct: 25  CVKAETPDEKTICDTRPLNDLDVEMAVRFDILKDLLPMGNRTKMQDDQEAWLKDRRA-CG 83

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                             CL      R + L   L+
Sbjct: 84  AD--------------VACLTAAYEGRLKVLRGVLS 105


>gi|167561958|ref|ZP_02354874.1| hypothetical protein BoklE_05295 [Burkholderia oklahomensis EO147]
          Length = 236

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 36/91 (39%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +      +++A Y+++ +      R  +++SQ  W ++R  E     +
Sbjct: 49  SSTAGQIQCMDEARQQWLAEVDAAYQRLQKAAPADARRGWQESQRRWLVWRKDEAHLVRA 108

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +  +GT  +M  A+       +R   L  
Sbjct: 109 VYDTTQGTMYAMASADMRLQPVRDRARALRG 139



 Score = 36.7 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/72 (11%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y K+  ++         ++Q  W  +R +                +I  +    
Sbjct: 171 FDMNRYYAKLQSRMPAASLPTLAQAQREWAAFRDA-------------MTPLISEDERVD 217

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 218 LIGARVATLKRF 229


>gi|295675294|ref|YP_003603818.1| hypothetical protein BC1002_0200 [Burkholderia sp. CCGE1002]
 gi|295435137|gb|ADG14307.1| conserved hypothetical protein [Burkholderia sp. CCGE1002]
          Length = 147

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 43/122 (35%), Gaps = 12/122 (9%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ A  +   + +++   C+    QA M  C        K+ L    +K+   + +   +
Sbjct: 19  VLAASAVPVASERALREECS-AFSQAGMRDCLAEKAEASKKTLRRAEEKMAGTLARWDED 77

Query: 65  ---------LFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKL 113
                        S   +  YR S+C FAAS      G A  +    C+      R E+L
Sbjct: 78  EKYVNQARAQLAASNRKFVRYRESQCDFAASLTGGAAGNAHEISRLACVSELNNRRAEQL 137

Query: 114 ES 115
             
Sbjct: 138 RD 139


>gi|115360446|ref|YP_777583.1| hypothetical protein Bamb_5702 [Burkholderia ambifaria AMMD]
 gi|115285774|gb|ABI91249.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 100

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 32/102 (31%), Gaps = 17/102 (16%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           +     + + +C++     +   C     A +  +L   Y   L+ V   +     +S+ 
Sbjct: 1   MQTHTFATSFDCSQASHADEAAICHDPGLAAMDRRLAQLYVAALQTVSDPE--SLRQSES 58

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            W   R  +C                  +CL+    ER  + 
Sbjct: 59  DWFATR-HQCGQN--------------LDCLRRAYGERIGQF 85


>gi|222148828|ref|YP_002549785.1| hypothetical protein Avi_2487 [Agrobacterium vitis S4]
 gi|221735814|gb|ACM36777.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 99

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 33/99 (33%), Gaps = 16/99 (16%)

Query: 18  SMALNCNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           + + +C +T ++A +   C       +  K+  T++ +   +    R   +  Q  W   
Sbjct: 7   AASFDCTKTDLKADEKAICDNRDLNDLDVKMVTTFELISGLLPMGNRGELQDQQTVWLKT 66

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R   C                  +C+      R + L+S
Sbjct: 67  R-QSCNAD--------------NDCITKAYDARLKALKS 90


>gi|293610540|ref|ZP_06692840.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826884|gb|EFF85249.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 257

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 45/126 (35%), Gaps = 17/126 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QREL 65
            L + +++  S A +  +     +        +   +  L  TY  V   +  +  + + 
Sbjct: 22  VLLVFSLSACSNAAD-YKPQHLDEKTV-----YKNSEHDLNNTYSDVKSYISDNKNEVKY 75

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--EG 122
              +Q +W   R  +C F       G   +     CL      + + L  SYL     EG
Sbjct: 76  LIDTQRSWLRNRNLKCNF------NGKEANNENYKCLSDFNNSKIKDLRISYLDFDSLEG 129

Query: 123 DLLCPF 128
           +L+ PF
Sbjct: 130 NLIKPF 135


>gi|170733147|ref|YP_001765094.1| hypothetical protein Bcenmc03_1811 [Burkholderia cenocepacia MC0-3]
 gi|169816389|gb|ACA90972.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
          Length = 280

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 29/85 (34%), Gaps = 1/85 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RE 64
              +  + +A  S A+NC + +   +   C   +      +L A Y   L+       R+
Sbjct: 17  AMFMMGVGLALPSFAMNCAKAVQPIEKRICASPALRAADTRLSAAYAGALKAAPDTAIRD 76

Query: 65  LFEKSQMAWEIYRGSECAFAASGAE 89
           +  +SQ  W   R         G  
Sbjct: 77  MLVRSQRRWLDARNKRLDTDYEGHR 101


>gi|107022966|ref|YP_621293.1| hypothetical protein Bcen_1414 [Burkholderia cenocepacia AU 1054]
 gi|116686791|ref|YP_840038.1| hypothetical protein Bcen2424_6415 [Burkholderia cenocepacia
           HI2424]
 gi|105893155|gb|ABF76320.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116652506|gb|ABK13145.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 245

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 28/94 (29%), Gaps = 17/94 (18%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + NC +     +   C     A +  +L   Y   L+     +     +S+  W   R  
Sbjct: 154 SFNCLQASHDDEWAICHDPGLAAMDRRLAQLYSTALQNSSDTE--ALRQSETNWVTAR-H 210

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +C                  +CL+    ER  + 
Sbjct: 211 QCGKD--------------LDCLRRAYGERIGQF 230


>gi|261365652|ref|ZP_05978535.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
 gi|288565815|gb|EFC87375.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
          Length = 335

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 31/89 (34%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q+D++    +       +++  +  +   V+K         Q AW   +   C  AA+ 
Sbjct: 249 SQSDLDN-ARSQNRNADSEIQRIWDGMEHTVQKE----LLTEQRAWIQNKIQNCQQAAAQ 303

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 304 ADSPAHAEYLKLQCDTRMTRERTQYLRGY 332


>gi|121583448|ref|YP_973879.1| hypothetical protein Pnap_4726 [Polaromonas naphthalenivorans CJ2]
 gi|120596702|gb|ABM40137.1| hypothetical protein Pnap_4726 [Polaromonas naphthalenivorans CJ2]
          Length = 339

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 31/116 (26%), Gaps = 20/116 (17%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
            A    + +C +     +   C+    A +  +L   Y +              ++   W
Sbjct: 239 AAPPGPSFDCAKARSMPEKMICSDAELARLDRELGRVYARAKSAAADGAAFG-RQNSEEW 297

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
              R + C                   CL      R+++L   +   EG    P  
Sbjct: 298 RR-REATCRDRE---------------CLLRWYANRHDQL---MHVIEGPKQEPAP 334


>gi|298207245|ref|YP_003715424.1| putative periplasmic protein [Croceibacter atlanticus HTCC2559]
 gi|83849881|gb|EAP87749.1| putative periplasmic protein [Croceibacter atlanticus HTCC2559]
          Length = 124

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 43/123 (34%), Gaps = 13/123 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVE 59
            + I+  ++I   +          +  QA++ +   + +    ++L++ +  +L      
Sbjct: 1   MKHILLVVSICFFSLT-------YSQNQAELEKVAYSEYLQSDKELKSLFNSILKGHNEN 53

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAE----EGTAQSMIYANCLQGHAIERNEKLES 115
               +  ++SQ  W  +R  E       +E          +  +  L    ++R +   +
Sbjct: 54  PEFSKRLKQSQELWLGFRNFELESRFPNSEVNRSSNNNYGICESMFLTEFTLDRIKYFNT 113

Query: 116 YLT 118
           +  
Sbjct: 114 WFN 116


>gi|22127350|ref|NP_670773.1| hypothetical protein y3476 [Yersinia pestis KIM 10]
 gi|45442775|ref|NP_994314.1| hypothetical protein YP_3015 [Yersinia pestis biovar Microtus
          str. 91001]
 gi|108809082|ref|YP_652998.1| hypothetical protein YPA_3091 [Yersinia pestis Antiqua]
 gi|108810724|ref|YP_646491.1| hypothetical protein YPN_0559 [Yersinia pestis Nepal516]
 gi|150260270|ref|ZP_01916998.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|153949461|ref|YP_001399611.1| hypothetical protein YpsIP31758_0619 [Yersinia pseudotuberculosis
          IP 31758]
 gi|165924841|ref|ZP_02220673.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165939085|ref|ZP_02227637.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|166009047|ref|ZP_02229945.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166212173|ref|ZP_02238208.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|167398941|ref|ZP_02304465.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167418995|ref|ZP_02310748.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167425219|ref|ZP_02316972.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167466362|ref|ZP_02331066.1| hypothetical protein YpesF_00360 [Yersinia pestis FV-1]
 gi|170022948|ref|YP_001719453.1| hypothetical protein YPK_0699 [Yersinia pseudotuberculosis YPIII]
 gi|186896794|ref|YP_001873906.1| hypothetical protein YPTS_3496 [Yersinia pseudotuberculosis
          PB1/+]
 gi|218927891|ref|YP_002345766.1| hypothetical protein YPO0702 [Yersinia pestis CO92]
 gi|229837384|ref|ZP_04457547.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|229840597|ref|ZP_04460756.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229842852|ref|ZP_04463004.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229900921|ref|ZP_04516045.1| putative exported protein [Yersinia pestis Nepal516]
 gi|294502768|ref|YP_003566830.1| hypothetical protein YPZ3_0658 [Yersinia pestis Z176003]
 gi|21960433|gb|AAM87024.1|AE013950_9 hypothetical [Yersinia pestis KIM 10]
 gi|45437641|gb|AAS63191.1| putative exported protein [Yersinia pestis biovar Microtus str.
          91001]
 gi|108774372|gb|ABG16891.1| hypothetical protein YPN_0559 [Yersinia pestis Nepal516]
 gi|108780995|gb|ABG15053.1| hypothetical protein YPA_3091 [Yersinia pestis Antiqua]
 gi|115346502|emb|CAL19377.1| putative exported protein [Yersinia pestis CO92]
 gi|149289678|gb|EDM39755.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|152960956|gb|ABS48417.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
          31758]
 gi|165913041|gb|EDR31666.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|165923041|gb|EDR40192.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165992386|gb|EDR44687.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166206919|gb|EDR51399.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|166962989|gb|EDR59010.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167051445|gb|EDR62853.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167055982|gb|EDR65763.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169749482|gb|ACA67000.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          YPIII]
 gi|186699820|gb|ACC90449.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          PB1/+]
 gi|229682260|gb|EEO78352.1| putative exported protein [Yersinia pestis Nepal516]
 gi|229690119|gb|EEO82176.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229696963|gb|EEO87010.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229705507|gb|EEO91517.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|262360800|gb|ACY57521.1| hypothetical protein YPD4_0612 [Yersinia pestis D106004]
 gi|262364745|gb|ACY61302.1| hypothetical protein YPD8_0612 [Yersinia pestis D182038]
 gi|294353227|gb|ADE63568.1| hypothetical protein YPZ3_0658 [Yersinia pestis Z176003]
 gi|320016734|gb|ADW00306.1| putative exported protein [Yersinia pestis biovar Medievalis str.
          Harbin 35]
          Length = 331

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 27/69 (39%), Gaps = 3/69 (4%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
          F L ++ I+  S+A+NC       +   C+      + +   + Y+ +L K         
Sbjct: 10 FFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHWLDQTFNSIYQVLLVKYNTEMVYQQ 69

Query: 67 EKSQMAWEI 75
           ++   WE 
Sbjct: 70 RQT---WEK 75


>gi|296159509|ref|ZP_06842333.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
 gi|295890217|gb|EFG70011.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
          Length = 284

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 36/113 (31%), Gaps = 17/113 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEA-TYKKVLEKVE 59
           M    I A   +A    + + +C     + +   C     + + E L       +   + 
Sbjct: 1   MRHAYIMAALALATTAHAASFDCARAGSRVEATVCADGRLSRLDEVLAQDYQYTMASDIG 60

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
              R+  + +Q AW + R S C  A                C++     R ++
Sbjct: 61  DGARKDLKATQRAWVLSRNS-CTDAE---------------CIRTAYAARIDQ 97


>gi|295699342|ref|YP_003607235.1| hypothetical protein BC1002_3702 [Burkholderia sp. CCGE1002]
 gi|295438555|gb|ADG17724.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
          Length = 245

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 28/94 (29%), Gaps = 17/94 (18%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +     ++  C     A    +L   Y   L+ +        +KS+  W + R  
Sbjct: 130 SFDCAQASNDDEIAVCGDPGLAAQDRQLGQLYDAALKTISDP--LALKKSESDWLLTR-H 186

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            C                   CL+    ER  + 
Sbjct: 187 MCNRD--------------LECLRHVYGERIGQF 206


>gi|295675223|ref|YP_003603747.1| hypothetical protein BC1002_0128 [Burkholderia sp. CCGE1002]
 gi|295435066|gb|ADG14236.1| hypothetical protein BC1002_0128 [Burkholderia sp. CCGE1002]
          Length = 549

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 30/103 (29%), Gaps = 17/103 (16%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C +    A+   C     A    +L + +               E +++ W  YR  
Sbjct: 262 SFDCAKARSDAERLICNDTELAAADIELASLFASAKSTATDQDAFK-EHARVQW-NYRER 319

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            C                  +CL      + + L   ++ P G
Sbjct: 320 NCHDR---------------DCLTQWYATQRQWLTGIVSNPRG 347


>gi|222085710|ref|YP_002544240.1| hypothetical protein Arad_2023 [Agrobacterium radiobacter K84]
 gi|221723158|gb|ACM26314.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 121

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 33/102 (32%), Gaps = 16/102 (15%)

Query: 15  AFQSMALNCNETLMQ-ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
             ++ + NC+   +Q  +   C   +      K+  T+  +   +    R   +  Q AW
Sbjct: 26  TSRAASFNCDAQNLQPDEKAICDVRALNDADVKMVTTFDLLSGLLAMGSRGTLQDEQSAW 85

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R + C                   CL     ER ++L+ 
Sbjct: 86  LKKRQA-CGAD--------------VGCLTSSYQERMKELDE 112


>gi|78049966|ref|YP_366141.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78038396|emb|CAJ26141.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 146

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 1/95 (1%)

Query: 23  CNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           C +      +   C      L   +L   YK +L  ++   R    ++Q AW   R  + 
Sbjct: 47  CQKQARGAVERAACVSQEETLQDRRLNKAYKLLLSSLKADVRTKLVEAQRAWLQSRTKDG 106

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              A+   +  A+++  A         R ++LE Y
Sbjct: 107 NLEAAIYGDSQAENIESAEAAMLRLTARADQLEKY 141


>gi|257126849|ref|YP_003164963.1| hypothetical protein Lebu_2113 [Leptotrichia buccalis C-1013-b]
 gi|257050788|gb|ACV39972.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 198

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 29/94 (30%), Gaps = 11/94 (11%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
            G  F    ++L   YK ++ ++ + Q+      + AW   +  E   AA     G  ++
Sbjct: 100 AGEVFEAWDKELNKIYKLIISELPESQKIKLRNEERAWLKRKDKEMDKAAEEMAMGRDEN 159

Query: 96  MIYANC-----------LQGHAIERNEKLESYLT 118
                C                 ER  +L     
Sbjct: 160 GELVGCGTGCGHASRAMNIEMTKERTIELARMYD 193


>gi|190572348|ref|YP_001970193.1| hypothetical protein Smlt0274 [Stenotrophomonas maltophilia K279a]
 gi|190010270|emb|CAQ43878.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 143

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 36/97 (37%), Gaps = 4/97 (4%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++     +   C  +  A   ++L   Y+++  K+   ++     +Q AW   R  +   
Sbjct: 46  DKAQGAIEQAACLTSESARQDQRLNQAYRQLQAKLSGAKKTKLVNAQRAWLQSRSRDSEL 105

Query: 84  AASGAEEGTAQSMIYANCLQGHAI--ERNEKLESYLT 118
             +  ++  +Q       L        R ++L+ YL 
Sbjct: 106 DTALYDD--SQPGNLQGELNDVMRLSARADQLQKYLQ 140


>gi|86357335|ref|YP_469227.1| hypothetical protein RHE_CH01705 [Rhizobium etli CFN 42]
 gi|86281437|gb|ABC90500.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 115

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 40/115 (34%), Gaps = 17/115 (14%)

Query: 1   MCRKIIFALTIIAI-AFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M   +  A+ I       S + +C+ + L   +   C   +      K+  T++ +   +
Sbjct: 5   MSAALGLAILIFPSDPAWSASFDCDAKELKPDEKAICDNRALNDADVKMVTTFELLSGLL 64

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               R   +  Q AW   R  EC   A+              C++    ER ++L
Sbjct: 65  AMGSRGTLQDEQTAWLKKR-QECGADAA--------------CIKAAYDERMKQL 104


>gi|315637135|ref|ZP_07892358.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315478671|gb|EFU69381.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 130

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 34/100 (34%), Gaps = 18/100 (18%)

Query: 19  MALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEK-VEKHQRELFEKSQMAWEIY 76
            + +C++      +   CT N  +   E L   Y  +L   + +  +   + SQ  W I 
Sbjct: 30  PSFDCSKVKKDSVEHMICTDNILSKSDEILTENYWSMLYSDIGEGAKLALKISQKKWIIK 89

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           R   C+                 +C+     +R  ++  Y
Sbjct: 90  RNL-CS---------------TKDCIYEEYKQRINEICDY 113


>gi|296164418|ref|ZP_06846992.1| lipoprotein, LprL [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295900200|gb|EFG79632.1| lipoprotein, LprL [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 211

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 29/93 (31%), Gaps = 13/93 (13%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C +    A    C       +  +L+A Y++ L +     +     +Q  W   R    
Sbjct: 46  DCGKPANAAQQLVCGEPHLTDLDHRLQAAYQQALAR-PGADQAALTAAQNTWAAARD--- 101

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                    G AQ+     CL      R  +L 
Sbjct: 102 ---------GCAQNPQPGTCLAEAYQTRLVELA 125


>gi|323496279|ref|ZP_08101337.1| hypothetical protein VISI1226_12021 [Vibrio sinaloensis DSM 21326]
 gi|323318556|gb|EGA71509.1| hypothetical protein VISI1226_12021 [Vibrio sinaloensis DSM 21326]
          Length = 410

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (37%), Gaps = 15/87 (17%)

Query: 40  FALVKEKLEATYKKVL---------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            +    +L ATYKK++           + K + +   + Q  W  +R + C         
Sbjct: 327 LSKTDSQLNATYKKLMIALKQPSEDYAMSKPEVDDVREVQRRWIKHRDATCNLIV----- 381

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYL 117
            + +  +   CL     +R ++L+  +
Sbjct: 382 -SVEPKLKEQCLNWLTAQREQELQGII 407


>gi|226328197|ref|ZP_03803715.1| hypothetical protein PROPEN_02089 [Proteus penneri ATCC 35198]
 gi|225202930|gb|EEG85284.1| hypothetical protein PROPEN_02089 [Proteus penneri ATCC 35198]
          Length = 115

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 30/91 (32%), Gaps = 7/91 (7%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-------ELFEKSQMAWEIYRGSECA 82
             +  C  +   L ++++   Y K    +E           +    SQ  +  +R +EC 
Sbjct: 22  TAVQACLLDELKLAEQQMNVIYDKSKSDLEDTDSIAAKSAIDALASSQQHFIQFRSAECQ 81

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             ++    GT    +   C       R + L
Sbjct: 82  RQSALLMGGTGAGDVLLACEIKLNQWRAKVL 112


>gi|85703224|ref|ZP_01034328.1| hypothetical protein ROS217_20822 [Roseovarius sp. 217]
 gi|85672152|gb|EAQ27009.1| hypothetical protein ROS217_20822 [Roseovarius sp. 217]
          Length = 152

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 30/91 (32%), Gaps = 10/91 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----------KHQRELFEKSQMAWEIYRGSECAFA 84
           C     A     L   Y+++  K+             Q E     Q AW  +R ++C + 
Sbjct: 57  CLDRERAQWDGWLNTVYQQLYAKLAAQDAQIQSYAPKQAEALRDMQRAWIEFRDAKCGYE 116

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           A+    GT       NC       +   L+S
Sbjct: 117 AAQWGGGTGAGPAAVNCHLHATARQMLYLQS 147


>gi|327394478|dbj|BAK11900.1| hypothetical protein PAJ_1820 [Pantoea ananatis AJ13355]
          Length = 356

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 7/77 (9%), Positives = 20/77 (25%), Gaps = 2/77 (2%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          ++  L +   A  + + +C       +   C   + +     +   +    +        
Sbjct: 17 LMSGLMLAFQASAAPSFSCAHP-SAIEKVICQSQTLSAKDRLMAHFFDLAKKNATAGPSG 75

Query: 65 LFEKSQMAWEIYRGSEC 81
              +Q  W       C
Sbjct: 76 -LITAQRQWLKNLTKMC 91


>gi|322832423|ref|YP_004212450.1| hypothetical protein Rahaq_1705 [Rahnella sp. Y9602]
 gi|321167624|gb|ADW73323.1| conserved hypothetical protein; putative exported protein [Rahnella
           sp. Y9602]
          Length = 167

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/152 (9%), Positives = 45/152 (29%), Gaps = 32/152 (21%)

Query: 2   CRKIIFALTIIAIA-----------------FQSMALNCNET--LMQADMNQCTGNSFAL 42
            +K++  L ++                     ++ A++C         DMN C       
Sbjct: 1   MKKLVITLALLGFTHSLFAADKQPSSVLDNGAETFAIDCAGNPQQTTLDMNDCYAEKIDK 60

Query: 43  VKEKLEATYKKVLEKV---------EKHQRELFE---KSQMAWEIYRGSECAFAASGAEE 90
           +    +       +++         +     + +   +   AW+ +         +  + 
Sbjct: 61  LNWVKQTYLVAARKRIEQTATGPNPDPDAAAVLKAFDEETQAWDAFEEKATFATYTDYQG 120

Query: 91  GTAQSMIYANCLQGHAIERNEKL-ESYLTCPE 121
           GT + ++  +        R + +  ++L   +
Sbjct: 121 GTIRGVMSLSRKMELIELRVKDIWSNWLQYQD 152


>gi|208779115|ref|ZP_03246461.1| hypothetical protein FTG_1409 [Francisella novicida FTG]
 gi|208744915|gb|EDZ91213.1| hypothetical protein FTG_1409 [Francisella novicida FTG]
          Length = 91

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 32/92 (34%), Gaps = 17/92 (18%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+      ++N C  +   +   KL                         ++ YR + C 
Sbjct: 16  CD--GNTYEINACLKSQMQIYDTKLNDVQN---------------HDIKNFKKYRDNICY 58

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             +S  + GT Q++ Y NC+        ++L+
Sbjct: 59  DISSTYKGGTYQAIKYGNCVISLDKWYLQQLK 90


>gi|187919302|ref|YP_001888333.1| hypothetical protein Bphyt_4591 [Burkholderia phytofirmans PsJN]
 gi|187717740|gb|ACD18963.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 166

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/112 (14%), Positives = 40/112 (35%), Gaps = 19/112 (16%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE-KVEKHQR 63
           ++ A  ++A+   + +  C      ++   C   + + + ++L A +++  E  ++    
Sbjct: 26  MLLAGAMLAVDASAASFKCTSKSSVSEKIVCKEPTLSALDDRLTAAWQRAKEATLDTAAL 85

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           E     Q  W   R   C   A               C++     R  +L++
Sbjct: 86  EAARTHQWLW---RQHNCTDEA---------------CVKSWYDRRIAELDA 119


>gi|15608679|ref|NP_216057.1| lipoprotein LprI [Mycobacterium tuberculosis H37Rv]
 gi|15841008|ref|NP_336045.1| hypothetical protein MT1593 [Mycobacterium tuberculosis CDC1551]
 gi|31792727|ref|NP_855220.1| lipoprotein LprI [Mycobacterium bovis AF2122/97]
 gi|121637462|ref|YP_977685.1| putative lipoprotein lprI [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661337|ref|YP_001282860.1| putative lipoprotein LprI [Mycobacterium tuberculosis H37Ra]
 gi|148822765|ref|YP_001287519.1| lipoprotein lprI [Mycobacterium tuberculosis F11]
 gi|167968096|ref|ZP_02550373.1| lipoprotein lprI [Mycobacterium tuberculosis H37Ra]
 gi|215403397|ref|ZP_03415578.1| lipoprotein lprI [Mycobacterium tuberculosis 02_1987]
 gi|215426885|ref|ZP_03424804.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|215430435|ref|ZP_03428354.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|215445739|ref|ZP_03432491.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|218753262|ref|ZP_03532058.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|219557452|ref|ZP_03536528.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|224989937|ref|YP_002644624.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799404|ref|YP_003032405.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 1435]
 gi|254231770|ref|ZP_04925097.1| lipoprotein lprI [Mycobacterium tuberculosis C]
 gi|254364413|ref|ZP_04980459.1| lipoprotein lprI [Mycobacterium tuberculosis str. Haarlem]
 gi|254550561|ref|ZP_05141008.1| lipoprotein lprI [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260186492|ref|ZP_05763966.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|260200602|ref|ZP_05768093.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|260204827|ref|ZP_05772318.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289442995|ref|ZP_06432739.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|289447152|ref|ZP_06436896.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|289554667|ref|ZP_06443877.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 605]
 gi|289569576|ref|ZP_06449803.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|289574225|ref|ZP_06454452.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289745297|ref|ZP_06504675.1| lipoprotein LprI [Mycobacterium tuberculosis 02_1987]
 gi|289750108|ref|ZP_06509486.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|289753628|ref|ZP_06513006.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|289757657|ref|ZP_06517035.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|289761704|ref|ZP_06521082.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|294996508|ref|ZP_06802199.1| lipoprotein lprI [Mycobacterium tuberculosis 210]
 gi|297634110|ref|ZP_06951890.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 4207]
 gi|297731097|ref|ZP_06960215.1| lipoprotein lprI [Mycobacterium tuberculosis KZN R506]
 gi|306775731|ref|ZP_07414068.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu001]
 gi|306779555|ref|ZP_07417892.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu002]
 gi|306784286|ref|ZP_07422608.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu003]
 gi|306788654|ref|ZP_07426976.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu004]
 gi|306792993|ref|ZP_07431295.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu005]
 gi|306797372|ref|ZP_07435674.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu006]
 gi|306803253|ref|ZP_07439921.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu008]
 gi|306807832|ref|ZP_07444500.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu007]
 gi|306967652|ref|ZP_07480313.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu009]
 gi|306971840|ref|ZP_07484501.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu010]
 gi|307079555|ref|ZP_07488725.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu011]
 gi|307084120|ref|ZP_07493233.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu012]
 gi|313658429|ref|ZP_07815309.1| lipoprotein lprI [Mycobacterium tuberculosis KZN V2475]
 gi|54037752|sp|P65319|LPRI_MYCBO RecName: Full=Putative lipoprotein lprI; Flags: Precursor
 gi|54041443|sp|P65318|LPRI_MYCTU RecName: Full=Putative lipoprotein lprI; Flags: Precursor
 gi|1403501|emb|CAA98321.1| Possible lipoprotein lprI [Mycobacterium tuberculosis H37Rv]
 gi|13881217|gb|AAK45859.1| hypothetical protein MT1593 [Mycobacterium tuberculosis CDC1551]
 gi|31618317|emb|CAD96235.1| Possible lipoprotein lprI [Mycobacterium bovis AF2122/97]
 gi|121493109|emb|CAL71580.1| Possible lipoprotein lprI [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|124600829|gb|EAY59839.1| lipoprotein lprI [Mycobacterium tuberculosis C]
 gi|134149927|gb|EBA41972.1| lipoprotein lprI [Mycobacterium tuberculosis str. Haarlem]
 gi|148505489|gb|ABQ73298.1| putative lipoprotein LprI [Mycobacterium tuberculosis H37Ra]
 gi|148721292|gb|ABR05917.1| lipoprotein lprI [Mycobacterium tuberculosis F11]
 gi|224773050|dbj|BAH25856.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320907|gb|ACT25510.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 1435]
 gi|289415914|gb|EFD13154.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|289420110|gb|EFD17311.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|289439299|gb|EFD21792.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 605]
 gi|289538656|gb|EFD43234.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289543330|gb|EFD46978.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|289685825|gb|EFD53313.1| lipoprotein LprI [Mycobacterium tuberculosis 02_1987]
 gi|289690695|gb|EFD58124.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|289694215|gb|EFD61644.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|289709210|gb|EFD73226.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|289713221|gb|EFD77233.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|308215823|gb|EFO75222.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu001]
 gi|308327490|gb|EFP16341.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu002]
 gi|308330951|gb|EFP19802.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu003]
 gi|308334772|gb|EFP23623.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu004]
 gi|308338560|gb|EFP27411.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu005]
 gi|308342262|gb|EFP31113.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu006]
 gi|308345757|gb|EFP34608.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu007]
 gi|308350057|gb|EFP38908.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu008]
 gi|308354711|gb|EFP43562.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu009]
 gi|308358697|gb|EFP47548.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu010]
 gi|308362577|gb|EFP51428.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu011]
 gi|308366241|gb|EFP55092.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu012]
 gi|323719989|gb|EGB29101.1| lipoprotein lprI [Mycobacterium tuberculosis CDC1551A]
 gi|326903171|gb|EGE50104.1| lipoprotein lprI [Mycobacterium tuberculosis W-148]
 gi|328459154|gb|AEB04577.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 4207]
          Length = 197

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 37/120 (30%), Gaps = 25/120 (20%)

Query: 5   IIFALTIIAIAF----------QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           ++ AL + A A              +L+C +         C       +  +L   Y++ 
Sbjct: 7   LVTALVLSACAANPPANTTSPTAGQSLDCTKPATIVQQLVCHDRQLTSLDHRLSTAYQQA 66

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L      +    E +Q +W + R + CA                  C+Q     R  +L 
Sbjct: 67  LAH---RRSAALEAAQSSWTMLRDA-CAQDTDP-----------RTCVQEAYQTRLVQLA 111


>gi|217976215|ref|YP_002360362.1| hypothetical protein Msil_0017 [Methylocella silvestris BL2]
 gi|217501591|gb|ACK49000.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 129

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 39/115 (33%), Gaps = 12/115 (10%)

Query: 4   KIIFALTIIA-----IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           K++FA   +A      A Q  + +C    + A+   C+  +      K+ A Y+ +    
Sbjct: 5   KLLFAAACLAGLPATAAAQMASFDCARAELPAEKAICSVPALGARDIKMAAYYQVLTSVE 64

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                         +  +R ++    A+ A +          CL      R ++L
Sbjct: 65  PAWSGMA-------YREFRDNQRELQANWASKIRNVCAEDVACLSEAYDRRIDEL 112


>gi|184159877|ref|YP_001848216.1| hypothetical protein ACICU_03560 [Acinetobacter baumannii ACICU]
 gi|183211471|gb|ACC58869.1| hypothetical protein ACICU_03560 [Acinetobacter baumannii ACICU]
 gi|322509792|gb|ADX05246.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
          Length = 233

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 40/113 (35%), Gaps = 13/113 (11%)

Query: 23  CNETLMQADMNQCTGNS--FALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWEIYRG 78
           C  +       +       ++  + +L + Y  +   +  +  + +    +Q  W   R 
Sbjct: 6   CITSNATDYKLEQLDEKTIYSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRN 65

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--EGDLLCPF 128
            +C F    A  G  +      CL      + + L+ SYL     EG L+ PF
Sbjct: 66  LKCNFNGKEANSGNYK------CLSDFNNSKIKDLKNSYLDLDNLEGKLIKPF 112


>gi|322614774|gb|EFY11703.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618881|gb|EFY15769.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322623588|gb|EFY20427.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629113|gb|EFY25892.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631834|gb|EFY28588.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637429|gb|EFY34131.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322645862|gb|EFY42383.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652324|gb|EFY48679.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653227|gb|EFY49560.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660624|gb|EFY56860.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664776|gb|EFY60969.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669171|gb|EFY65321.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670717|gb|EFY66850.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679045|gb|EFY75100.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322685098|gb|EFY81095.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323193009|gb|EFZ78232.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196909|gb|EFZ82051.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203894|gb|EFZ88911.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207021|gb|EFZ91974.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323214224|gb|EFZ98982.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214453|gb|EFZ99204.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219205|gb|EGA03702.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323230224|gb|EGA14344.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233962|gb|EGA18051.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238344|gb|EGA22402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244031|gb|EGA28040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323257814|gb|EGA41493.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261171|gb|EGA44763.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264898|gb|EGA48397.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272462|gb|EGA55869.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 311

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYTCQLEMTIARTAYLDG 273


>gi|330815832|ref|YP_004359537.1| hypothetical protein bgla_1g08940 [Burkholderia gladioli BSR3]
 gi|327368225|gb|AEA59581.1| hypothetical protein bgla_1g08940 [Burkholderia gladioli BSR3]
          Length = 141

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 32/90 (35%), Gaps = 4/90 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I     + A   Q++  +C+    Q  MN C      + + +L+    +        ++ 
Sbjct: 26  IAARSGLPASQVQALLQDCD--SNQTSMNFCAWRDQIVAERELQQVVDQ-RISEHPDRKS 82

Query: 65  LFEKSQMAWEIYRGSECAFAAS-GAEEGTA 93
             E     W+  R + C  +A     +G+ 
Sbjct: 83  ALESKIAKWKKARDASCDKSARKEWSDGSM 112


>gi|323246619|gb|EGA30593.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
          Length = 312

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 197 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 252

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 253 KRISIYTCQLEMTIARTAYLDG 274


>gi|302878712|ref|YP_003847276.1| hypothetical protein Galf_1493 [Gallionella capsiferriformans ES-2]
 gi|302581501|gb|ADL55512.1| hypothetical protein Galf_1493 [Gallionella capsiferriformans ES-2]
          Length = 133

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 46/120 (38%), Gaps = 9/120 (7%)

Query: 5   IIFALTIIAIAFQSMALNCN-ETLMQADMNQC----TGNSFALVKEKLEATYKKVLEKVE 59
           ++  L+       + A  C  +     + + C       +     ++L   Y+++L +  
Sbjct: 6   VVLCLSSFPFQCHAEAWVCPPDIASSDNGDFCGAAHAEFNANQADKRLNEVYRQLLSEFP 65

Query: 60  -KHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TAQSMIYANCLQGHAIERNEKLESY 116
            K +R+ +  +Q AW  +  + C  A S       T   M   +C     + R ++LE Y
Sbjct: 66  TKEERQPWITAQRAWLKFSDAHCVAALSKFIGAPFTMAEME-HSCRAEQILNRTKELERY 124


>gi|332185598|ref|ZP_08387346.1| hypothetical protein SUS17_667 [Sphingomonas sp. S17]
 gi|332014576|gb|EGI56633.1| hypothetical protein SUS17_667 [Sphingomonas sp. S17]
          Length = 125

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 36/112 (32%), Gaps = 13/112 (11%)

Query: 8   ALTIIAIAFQSMALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQR 63
           A+  I+    +   NC +           CT    A+  ++L   Y++V+ ++      +
Sbjct: 19  AVAQISPNISAAYTNCMDRAGSNTVQSGVCTQREAAVQDDRLNKAYQQVMRQLASRPAAK 78

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                 Q  W   R   C       + G         C+      R ++LE 
Sbjct: 79  TALRDQQRRWIRERDYSCKINGDTIDTG---------CIVTKTALRADELER 121


>gi|283477121|emb|CAY73021.1| putative lipoprotein lprI; Flags: Precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 121

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 30/101 (29%), Gaps = 19/101 (18%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF----EKSQMAWE 74
            + +C +   +++   C     + + + +   ++      +             SQ AW 
Sbjct: 32  PSFDCGKAQAESEKAICADYRLSSLDKSVFDAWRVAKALAKDVANTELLATVVASQKAWL 91

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + R  +C                   CL     ER EKL  
Sbjct: 92  MNRN-QCGSDP--------------QCLAKSMTERMEKLAE 117


>gi|218674588|ref|ZP_03524257.1| hypothetical protein RetlG_25537 [Rhizobium etli GR56]
          Length = 117

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 37/109 (33%), Gaps = 16/109 (14%)

Query: 6   IFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
             A    +   Q+ +  C+ + L   +   C   +      K+  T++ +   +    R 
Sbjct: 13  FAAAIFASDMAQAASFACDAKELKPDEKTICDNRALNDADVKMATTFELLSGLLAMGSRG 72

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +  Q AW   R  EC   A+              CL+    ER ++L
Sbjct: 73  TLQDEQTAWLKKR-QECGADAA--------------CLKAAYEERLKQL 106


>gi|89074580|ref|ZP_01161052.1| hypothetical protein SKA34_11955 [Photobacterium sp. SKA34]
 gi|89049684|gb|EAR55243.1| hypothetical protein SKA34_11955 [Photobacterium sp. SKA34]
          Length = 403

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 39/119 (32%), Gaps = 18/119 (15%)

Query: 1   MCRKIIF---ALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M   ++    A+   +    +   +   C+          C     AL+ +++   Y++V
Sbjct: 1   MRCFVLLFVGAIATFSTTLMAANNDGSYCHSVTSNIVQLICKDPKLALLHKQMSEIYQQV 60

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           L +    +  + +++Q  W   R + C              +    CL      R + L
Sbjct: 61  LTQSMVSEASVIKETQKNWLESR-ASC-----------LDQIDVQRCLVSAYDSRLDNL 107


>gi|168239014|ref|ZP_02664072.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734675|ref|YP_002113529.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194710177|gb|ACF89398.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288204|gb|EDY27589.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 278

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYTCQLEMTIARTAYLDG 273


>gi|224582335|ref|YP_002636133.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224466862|gb|ACN44692.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 275

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|16763877|ref|NP_459492.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167990488|ref|ZP_02571588.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16419006|gb|AAL19451.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205331046|gb|EDZ17810.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261245779|emb|CBG23576.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992217|gb|ACY87102.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157106|emb|CBW16590.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911530|dbj|BAJ35504.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226076|gb|EFX51127.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323128817|gb|ADX16247.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332987446|gb|AEF06429.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 275

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|226198549|ref|ZP_03794115.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|225929292|gb|EEH25313.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 91

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS-GAEE 90
           MN C      + + +L+    + + +    ++   E     W+  R + C  +A    ++
Sbjct: 1   MNFCAWRDQLVAERELQQVVDQQISE-HPERKTALEAKVAKWKKARDASCEKSARKEWDD 59

Query: 91  GTAQSMIYANCLQGHAIERNEKLES 115
           G+ +    A C      +  +KL +
Sbjct: 60  GSMRPAAQAICATASTKKMTKKLSA 84


>gi|270487699|ref|ZP_06204773.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|270336203|gb|EFA46980.1| conserved hypothetical protein [Yersinia pestis KIM D27]
          Length = 318

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 11/65 (16%), Positives = 25/65 (38%), Gaps = 3/65 (4%)

Query: 11 IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
          ++ I+  S+A+NC       +   C+      + +   + Y+ +L K          ++ 
Sbjct: 1  MMLISTSSLAINCQRASTPVEYTVCSNEDLHWLDQTFNSIYQVLLVKYNTEMVYQQRQT- 59

Query: 71 MAWEI 75
            WE 
Sbjct: 60 --WEK 62


>gi|187923022|ref|YP_001894664.1| hypothetical protein Bphyt_1021 [Burkholderia phytofirmans PsJN]
 gi|187714216|gb|ACD15440.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 248

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                  QC  N+    K  L+  ++++ +K+   QR+ ++KSQ +W+  R +E    A+
Sbjct: 64  SSTTGQVQCMDNARIGWKTALDNAWQQLQQKLPPAQRKRWDKSQASWQASRDAEKQLLAA 123

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 G+   +  A+       +R   L S
Sbjct: 124 VFATTHGSMYVLAEADMQLQPVRDRALALRS 154


>gi|298291351|ref|YP_003693290.1| Uncharacterized protein lipoprotein-like protein [Starkeya novella
           DSM 506]
 gi|296927862|gb|ADH88671.1| Uncharacterized protein putative lipoprotein-like protein [Starkeya
           novella DSM 506]
          Length = 117

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 10/105 (9%), Positives = 27/105 (25%), Gaps = 16/105 (15%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV-LEKVEKHQRELFEKSQ 70
           ++    + + +C +     +   C   + + +  ++   +       +            
Sbjct: 16  LSAPAHAASFDCGKAQAADERAVCADPALSALDSEMGGLWFAYGRLPMLMGANGNRHDEA 75

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            A+   R + C   A               CL      R   L+ 
Sbjct: 76  RAFLTSR-AACGANA--------------TCLTALYQARIAALKQ 105


>gi|50119710|ref|YP_048877.1| hypothetical protein ECA0765 [Pectobacterium atrosepticum SCRI1043]
 gi|49610236|emb|CAG73679.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 148

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 31/90 (34%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
             +  C          +L A YK +L K     ++   +++ AW  +  +   F +S   
Sbjct: 55  IALAACQSAEKKRQDARLNAAYKALLSKQSGTAKDNLIRAERAWLDFHSASKTFESSLYG 114

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLTC 119
             T  S            ER   LE YL+ 
Sbjct: 115 SETVSSFEVMQREIFRLCERTNVLEEYLSI 144


>gi|91790660|ref|YP_551612.1| hypothetical protein Bpro_4838 [Polaromonas sp. JS666]
 gi|91699885|gb|ABE46714.1| hypothetical protein Bpro_4838 [Polaromonas sp. JS666]
          Length = 172

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 34/82 (41%), Gaps = 3/82 (3%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKH---QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
            S   V++++   Y+++L  +++    +      SQ  W  +R S C             
Sbjct: 89  QSLTEVEQQMAIEYRQLLAMLQQQGRIRTNSLVLSQRTWAKFRESHCTLEVERVMGNYRS 148

Query: 95  SMIYANCLQGHAIERNEKLESY 116
               A CL+  A +R+E L+ +
Sbjct: 149 PHRLAACLEAEARKRSEYLKGF 170


>gi|238760698|ref|ZP_04621820.1| hypothetical protein yaldo0001_38950 [Yersinia aldovae ATCC 35236]
 gi|238701091|gb|EEP93686.1| hypothetical protein yaldo0001_38950 [Yersinia aldovae ATCC 35236]
          Length = 306

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 31/96 (32%), Gaps = 6/96 (6%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            A    +   Q        + F  V ++L   +      ++K +++     Q  W   + 
Sbjct: 215 PAQEKIQQQSQVMTVNEARDKFMSVDQQLGDAWHA----LDKEKQKTLLNEQRQWIKNKE 270

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           + C   ++   +     M    C      +R  +L+
Sbjct: 271 AICGKISAKGTDLEITKMF--ECQYDMTKKRISELQ 304


>gi|293610786|ref|ZP_06693086.1| predicted protein [Acinetobacter sp. SH024]
 gi|292827130|gb|EFF85495.1| predicted protein [Acinetobacter sp. SH024]
          Length = 138

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 46/142 (32%), Gaps = 34/142 (23%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK----------------- 44
           C+ I+ +    +    +      +   Q + NQC   +   ++                 
Sbjct: 6   CKLIVLSSLFCSPWLYAQ----TDADEQDEYNQCVEQTIKEMQLESINNMVVHSCSEQAK 61

Query: 45  --------EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                     ++    +  E  +  + +   KSQ  W+ Y   EC  A S        S 
Sbjct: 62  KTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECNNAGSY-----IGSP 116

Query: 97  IYANCLQGHAIERNEKLESYLT 118
           +Y+ C      ER ++LE Y+ 
Sbjct: 117 MYSYCPMQEYAERVKQLEEYVN 138


>gi|168240330|ref|ZP_02665262.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194450974|ref|YP_002044530.1| hypothetical protein SeHA_C0605 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197262438|ref|ZP_03162512.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194409278|gb|ACF69497.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197240693|gb|EDY23313.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205339755|gb|EDZ26519.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 275

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+S
Sbjct: 252 KRISIYKCQLEMTIARTAYLDS 273


>gi|85373067|ref|YP_457129.1| hypothetical protein ELI_01200 [Erythrobacter litoralis HTCC2594]
 gi|84786150|gb|ABC62332.1| hypothetical protein ELI_01200 [Erythrobacter litoralis HTCC2594]
          Length = 495

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 31/97 (31%), Gaps = 23/97 (23%)

Query: 19  MALNCNETLMQADMNQCTGNS--FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            + +C +  ++A++  C         +   L + Y+  +++    Q     + Q AW   
Sbjct: 275 PSFDCAKASIKAEVLICAEYQSGLRHMDRDLSSLYRHAVKRGATSQ-----REQRAWLRQ 329

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R   C                 A C+      R + L
Sbjct: 330 RNR-CD---------------SAECVAQAYQARMDAL 350


>gi|312883787|ref|ZP_07743506.1| hypothetical protein VIBC2010_14339 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368536|gb|EFP96069.1| hypothetical protein VIBC2010_14339 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 126

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 4/124 (3%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M  K+I +  I   +  S++  C      +++  C     A  + K++  Y  + E +  
Sbjct: 1   MNTKLIISTLIFLFSSVSVSA-CTNLSSSSELLSCKKEVEATSRAKMQKAYLNLDEYLSG 59

Query: 61  --HQRELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIERNEKLESYL 117
               ++  + SQ +W       C   +  AEEG+    +  + C+      R E + S  
Sbjct: 60  AVDYQKKIKLSQESWAKSATQNCDVYSYFAEEGSIAHDIAISECMASEYKSREEFIISLS 119

Query: 118 TCPE 121
              E
Sbjct: 120 DVVE 123


>gi|167031348|ref|YP_001666579.1| hypothetical protein PputGB1_0330 [Pseudomonas putida GB-1]
 gi|166857836|gb|ABY96243.1| protein of unknown function DUF1311 [Pseudomonas putida GB-1]
          Length = 133

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 43/129 (33%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M       L  +    Q+       C+          C   +    + +L+A Y  ++++
Sbjct: 1   MKSLAWLVLLAVVSGAQAGEEESTPCDNVETDQQTYACAAFNKQTAERELKAAYDDLIQR 60

Query: 58  VEKHQREL----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN-CLQGHA 106
           +     E            + ++  W   R ++C       + G+       + C+   +
Sbjct: 61  IRDQYAEEGDQATALIGRMDAAEKLWTQLRDADCKAETYAEKPGSKAFQAAWDTCVAQRS 120

Query: 107 IERNEKLES 115
            +R+E L+S
Sbjct: 121 DDRSEYLQS 129


>gi|161615300|ref|YP_001589265.1| hypothetical protein SPAB_03069 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168261062|ref|ZP_02683035.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|161364664|gb|ABX68432.1| hypothetical protein SPAB_03069 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205349984|gb|EDZ36615.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 275

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|158425298|ref|YP_001526590.1| hypothetical protein AZC_3674 [Azorhizobium caulinodans ORS 571]
 gi|158332187|dbj|BAF89672.1| uncharacterized protein [Azorhizobium caulinodans ORS 571]
          Length = 119

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 32/97 (32%), Gaps = 15/97 (15%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C +     +   C     + +  +    Y  +   V   +R + +  Q A+  YR + C
Sbjct: 30  DCTKARSPDEKAVCVNRDLSDLDVRAATLYDVLTHLVAMGERGIIQDQQRAFLAYR-ATC 88

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                    G+        C++    +   +L + L 
Sbjct: 89  ---------GSRVP-----CIRKVYEQHVAQLTAGLQ 111


>gi|184159636|ref|YP_001847975.1| hypothetical protein ACICU_03318 [Acinetobacter baumannii ACICU]
 gi|332876121|ref|ZP_08443905.1| hypothetical protein HMPREF0022_03551 [Acinetobacter baumannii
           6014059]
 gi|183211230|gb|ACC58628.1| hypothetical protein ACICU_03318 [Acinetobacter baumannii ACICU]
 gi|322509546|gb|ADX05000.1| Putative uncharacterized protein precursor [Acinetobacter baumannii
           1656-2]
 gi|323519566|gb|ADX93947.1| hypothetical protein ABTW07_3530 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735739|gb|EGJ66782.1| hypothetical protein HMPREF0022_03551 [Acinetobacter baumannii
           6014059]
          Length = 138

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 45/142 (31%), Gaps = 34/142 (23%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK----------------- 44
           C+ I+ +    +    +      E   Q + NQC   +   ++                 
Sbjct: 6   CKLIVLSSLFGSPWLYAQ----TEADEQDEYNQCVDQTIKEMQLESINNMVVHSCSEQAK 61

Query: 45  --------EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                     ++    +  E  +  + +   KSQ  W+ Y   EC  A S        S 
Sbjct: 62  KTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECNNAGSY-----IGSP 116

Query: 97  IYANCLQGHAIERNEKLESYLT 118
           +Y+ C       R ++LE Y+ 
Sbjct: 117 MYSYCPMQEYAARVKQLEEYVN 138


>gi|104784091|ref|YP_610589.1| hypothetical protein PSEEN5179 [Pseudomonas entomophila L48]
 gi|95113078|emb|CAK17806.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 133

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 45/129 (34%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M       L  +A   Q+       C+          C   +    + +L+A Y  ++++
Sbjct: 1   MKSMAWLVLLAVACGAQAAEEESTPCDNVESDQQGYACAAYNKQTAERELKAAYDDLIQR 60

Query: 58  VEKHQRE----------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +     +            E ++  W   R ++C       + G+ A    +  C+   +
Sbjct: 61  IRDQYADESDKAAALSAKMEAAEKLWAQLRDADCKVETYAEKPGSKAFEAAWNTCVAQRS 120

Query: 107 IERNEKLES 115
            ER+E L+S
Sbjct: 121 DERSEYLQS 129


>gi|91781537|ref|YP_556743.1| hypothetical protein Bxe_A4308 [Burkholderia xenovorans LB400]
 gi|91685491|gb|ABE28691.1| hypothetical protein Bxe_A4308 [Burkholderia xenovorans LB400]
          Length = 413

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 25/99 (25%), Gaps = 17/99 (17%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C+     A+   C+    A    +L   + +    V           Q  W  YR  
Sbjct: 325 SFDCSSARSDAEHIICSDPELAADDVELSRIFARAKAAVTDQAAFRERTRQQ-W-NYREQ 382

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            C                  NCL     ++   L     
Sbjct: 383 SCHDR---------------NCLVRWYADQKTALTQIAQ 406



 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 27/83 (32%), Gaps = 5/83 (6%)

Query: 37  GNSFALVKEKL---EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA--SGAEEG 91
             +    +  +         V     K  R+     Q  W   R ++C   A  SG  + 
Sbjct: 215 EAALQKAQSDMKMANDAINVVWNAGSKEWRQALLPEQRLWLAQRENDCKIKALDSGTPDT 274

Query: 92  TAQSMIYANCLQGHAIERNEKLE 114
           TA      NC     ++R + L+
Sbjct: 275 TAFQTNKLNCQVQMTVDRTQALK 297


>gi|313145128|ref|ZP_07807321.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313130159|gb|EFR47776.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 375

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/138 (10%), Positives = 43/138 (31%), Gaps = 31/138 (22%)

Query: 6   IFALTIIAIAFQSM--ALNCNETLMQADMNQCTGN--SFALVKEKLEATYKKVLEKVEK- 60
           + ++++ A + Q    + +C +   + +   C  +      +   +   Y ++  +++K 
Sbjct: 1   MLSISVNAQSPQEAKPSFDCAKASTKVEKIICEDSSGELQNLDRYMAEVYTQLRNELKKS 60

Query: 61  ------HQRELFEKSQMAWEI-------------YRG--SECAFAASGAEEGTAQSMIYA 99
                  + +   +SQ  +               Y+   +E          G  + +I  
Sbjct: 61  SLSDKNQRLDNLLQSQRRFITSANNINSNNAASIYKDLFNEEDEELILRMGGNEKGIIQN 120

Query: 100 NCLQGHAIERNEKLESYL 117
                   +R   L   L
Sbjct: 121 -----MYKKRTIILLKLL 133


>gi|260654983|ref|ZP_05860471.1| hypothetical protein GCWU000246_00933 [Jonquetella anthropi E3_33
           E1]
 gi|260630298|gb|EEX48492.1| hypothetical protein GCWU000246_00933 [Jonquetella anthropi E3_33
           E1]
          Length = 283

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 7/101 (6%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE---- 80
           +++  AD+     +     K+++    +++L+ +    +E F+K+Q AWE +  +E    
Sbjct: 49  DSMSTADVVDFYDSLMDGWKKEIARADEELLKVLPAAGKEKFKKTQKAWEAFSQAENDVL 108

Query: 81  ---CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                    G   GT    I AN        R  +L +YL 
Sbjct: 109 DLAIEKVNEGPYGGTMWVSIQANSHAEFTRVRAMELLTYLD 149


>gi|299768630|ref|YP_003730656.1| hypothetical protein AOLE_01900 [Acinetobacter sp. DR1]
 gi|298698718|gb|ADI89283.1| hypothetical protein AOLE_01900 [Acinetobacter sp. DR1]
          Length = 138

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 46/142 (32%), Gaps = 34/142 (23%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK----------------- 44
           C+ I+ +    +    +      +   Q + NQC   +   ++                 
Sbjct: 6   CKLIVLSSLFCSPWLYAQ----TDADEQDEYNQCVDQTIKEMQLESINNMVVHSCSEQAK 61

Query: 45  --------EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                     ++    +  E  +  + +   KSQ  W+ Y   EC+ A S        S 
Sbjct: 62  KTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECSNAGSY-----IGSP 116

Query: 97  IYANCLQGHAIERNEKLESYLT 118
           +Y+ C       R ++LE Y+ 
Sbjct: 117 MYSYCPMQEYAARVKQLEEYVN 138


>gi|260889230|ref|ZP_05900493.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260861290|gb|EEX75790.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 143

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 32/89 (35%), Gaps = 3/89 (3%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA- 88
           ADM   + +     ++++   Y  +L+K+   ++  F+  Q  W   R  +   A     
Sbjct: 46  ADMVNASLDLDKEWEKEMNKAYDLILKKLPAKEKIKFKAEQNKWLKDRKVKVQKAYDKYT 105

Query: 89  --EEGTAQSMIYANCLQGHAIERNEKLES 115
             E       + A+       ER  +L  
Sbjct: 106 KEEGPRMAGELAASERLSITKERALELAK 134


>gi|209550118|ref|YP_002282035.1| hypothetical protein Rleg2_2536 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209535874|gb|ACI55809.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 231

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/91 (10%), Positives = 25/91 (27%), Gaps = 10/91 (10%)

Query: 2  CRKIIFALT------IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           + I+  +       + A    +   +C++     +   C  +  + + E     Y    
Sbjct: 1  MKSILNFIIVFGVGILFATVADAAGFDCSKAGSADEKIVCGDSQLSRLDELFNQRYAAQK 60

Query: 56 EKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
          +                +   R  +CA   S
Sbjct: 61 KAAPDEDTVHVA---RNFLADRR-DCADDRS 87


>gi|200390101|ref|ZP_03216712.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602546|gb|EDZ01092.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|194444338|ref|YP_002039742.1| hypothetical protein SNSL254_A0551 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|205351804|ref|YP_002225605.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207855976|ref|YP_002242627.1| hypothetical protein SEN0478 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|194403001|gb|ACF63223.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|205271585|emb|CAR36406.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206707779|emb|CAR32064.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326626841|gb|EGE33184.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|330821649|ref|YP_004350511.1| hypothetical protein bgla_2g25710 [Burkholderia gladioli BSR3]
 gi|327373644|gb|AEA64999.1| hypothetical protein bgla_2g25710 [Burkholderia gladioli BSR3]
          Length = 284

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/100 (13%), Positives = 26/100 (26%), Gaps = 2/100 (2%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-FEKSQMAWEIY 76
           + A++C +     +   C           + A Y   L+             SQ  W + 
Sbjct: 22  AQAIDCRKAASPIERMICADPRLQAADAAMGAAYAATLKAAGDEGIRAMLVASQRRWLLR 81

Query: 77  RGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLES 115
           R +      +  +  G          +     +R   L  
Sbjct: 82  RDARLGHLDAVDDGQGPPDEAARREIVLKAIRDRARVLSQ 121


>gi|168465597|ref|ZP_02699479.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631784|gb|EDX50304.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|329927807|ref|ZP_08281868.1| hypothetical protein HMPREF9412_5970 [Paenibacillus sp. HGF5]
 gi|328938208|gb|EGG34603.1| hypothetical protein HMPREF9412_5970 [Paenibacillus sp. HGF5]
          Length = 148

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 39/101 (38%), Gaps = 4/101 (3%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
              +          +  ++L+  YKK+L K+++  RE   +SQ  W  Y   E  F    
Sbjct: 40  TTLEWGAFESKYTEIWDDELDHIYKKLLSKLDREPREALIESQKEWLQYHLRETKFVEKT 99

Query: 88  AEE----GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
                  G+  S+     ++    ER  +L  Y    +G++
Sbjct: 100 FINNGYLGSQGSVSLGRVIKERIRERTMQLFEYRYLRDGEV 140


>gi|261406383|ref|YP_003242624.1| hypothetical protein GYMC10_2542 [Paenibacillus sp. Y412MC10]
 gi|261282846|gb|ACX64817.1| conserved hypothetical protein [Paenibacillus sp. Y412MC10]
          Length = 217

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 39/101 (38%), Gaps = 4/101 (3%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
              +          +  ++L+  YKK+L K+++  RE   +SQ  W  Y   E  F    
Sbjct: 109 TTLEWGAFESKYTEIWDDELDHIYKKLLSKLDREPREALIESQKEWLQYHLRETKFVEKT 168

Query: 88  AEE----GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
                  G+  S+     ++    ER  +L  Y    +G++
Sbjct: 169 FINNGYLGSQGSVSLGRVIKERIRERTMQLFEYRYLRDGEV 209


>gi|330820713|ref|YP_004349575.1| lipoprotein-like protein [Burkholderia gladioli BSR3]
 gi|327372708|gb|AEA64063.1| lipoprotein-like protein [Burkholderia gladioli BSR3]
          Length = 259

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 29/94 (30%), Gaps = 17/94 (18%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +CN      ++  C     A + ++L   Y   ++ +         +S+  W   R  
Sbjct: 164 SFDCNLASHDDEVAICGDAGLAAMDKRLGQLYGATMKTIADPD--ALRQSEAEWVGVR-H 220

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            C                  +CL+    ER  + 
Sbjct: 221 GCNSD--------------LDCLRHAYGERIGQF 240


>gi|197250398|ref|YP_002145481.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214101|gb|ACH51498.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|168818882|ref|ZP_02830882.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205344268|gb|EDZ31032.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320084773|emb|CBY94563.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|198244471|ref|YP_002214453.1| hypothetical protein SeD_A0546 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938987|gb|ACH76320.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622200|gb|EGE28545.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 275

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|126463961|ref|YP_001045074.1| hypothetical protein Rsph17029_3205 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105772|gb|ABN78302.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 351

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 25/97 (25%), Gaps = 18/97 (18%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
              + +C+     A+   C   S     +     Y  V +            +Q  W   
Sbjct: 266 SGPSFDCSMARSNAEHGICDHESLWARDKLSSKLYAFVRQGSPDGH---ILNNQREWLRG 322

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R S C + A              +CL      R  + 
Sbjct: 323 RDS-CGYDA--------------DCLVRTYDNRIRQF 344


>gi|168231491|ref|ZP_02656549.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194469409|ref|ZP_03075393.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455773|gb|EDX44612.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205334057|gb|EDZ20821.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 275

 Score = 49.4 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 ATKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|167550973|ref|ZP_02344729.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205324283|gb|EDZ12122.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 275

 Score = 49.4 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 23/82 (28%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +K     +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|186476884|ref|YP_001858354.1| heat shock protein DnaJ domain-containing protein [Burkholderia
           phymatum STM815]
 gi|184193343|gb|ACC71308.1| heat shock protein DnaJ domain protein [Burkholderia phymatum
           STM815]
          Length = 436

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/66 (15%), Positives = 26/66 (39%), Gaps = 2/66 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +CN+    +++  C  +  A +   L +T+ +        +    + ++  W  +R  
Sbjct: 290 SFDCNKAHGPSEVLICGDDDLAAMDRALASTFAQAKAATSDKKSFG-DTARRNW-NWRNK 347

Query: 80  ECAFAA 85
            C   A
Sbjct: 348 NCRDKA 353


>gi|325123643|gb|ADY83166.1| hypothetical protein BDGL_002580 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 138

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 46/141 (32%), Gaps = 34/141 (24%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK------------------ 44
           + I+ +    +    +      +   Q + NQC   +   ++                  
Sbjct: 7   KLIVLSSLFCSTWLYAQ----TDADQQDEYNQCVDQTIKEMQLESINNMVVHSCSEQAKK 62

Query: 45  -------EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
                    ++    +  E  +  + +   KSQ  W+ Y   EC+ A S        S +
Sbjct: 63  IYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECSNAGSY-----IGSPM 117

Query: 98  YANCLQGHAIERNEKLESYLT 118
           Y+ C      ER ++LE Y+ 
Sbjct: 118 YSYCPMQKYAERVKQLEEYVN 138


>gi|146301124|ref|YP_001195715.1| hypothetical protein Fjoh_3382 [Flavobacterium johnsoniae UW101]
 gi|146155542|gb|ABQ06396.1| hypothetical lipoprotein [Flavobacterium johnsoniae UW101]
          Length = 134

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 38/131 (29%), Gaps = 20/131 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-----------CNETLMQADMNQCTGNSFALVKEKLEA 49
           M + I+    + ++   S  L            C        M  C    +      L  
Sbjct: 2   MQKSILLVFVLASMYCNSQTLETVYKMKSDYQKCLNKGQN--MRNCALEYYNQSDSLLNV 59

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGS-------ECAFAASGAEEGTAQSMIYANCL 102
           +YK +  K+   ++   +K Q+ W   R         +     +  E      MI  +  
Sbjct: 60  SYKNLKSKISSKEQSKLKKEQLEWLKKRDQFFQKVYSDTKKEGNFIEGTQDFEMIIYDEQ 119

Query: 103 QGHAIERNEKL 113
                 R ++L
Sbjct: 120 AKFVFGRVKEL 130


>gi|110636723|ref|YP_676930.1| hypothetical protein CHU_0299 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279404|gb|ABG57590.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 176

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 29/97 (29%), Gaps = 5/97 (5%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
             QA++     +S       +   YK +L   +   ++L   +Q  W  YR  E      
Sbjct: 74  TSQAELVTAIVDSEIEYDILMNKYYKALLGLHDDEGKKLLTAAQKKWLKYRDEEIVMTEK 133

Query: 87  GAEEGTAQS-----MIYANCLQGHAIERNEKLESYLT 118
              E          +  A         R  +L  ++ 
Sbjct: 134 FYNEQHIGDAKTKEIAKAREHLELTKARVIELFKHIE 170


>gi|332527371|ref|ZP_08403427.1| hypothetical protein RBXJA2T_15593 [Rubrivivax benzoatilyticus JA2]
 gi|332111780|gb|EGJ11760.1| hypothetical protein RBXJA2T_15593 [Rubrivivax benzoatilyticus JA2]
          Length = 282

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 23/71 (32%), Gaps = 3/71 (4%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C       +   C     A    ++ A Y  + ++ E+ +     ++Q  W 
Sbjct: 48  ADAQPGFDCQRARTPVERLVCADPDLARADARMAAAYSALTQRWEEDR--SLRRTQRRWL 105

Query: 75  IYRGSECAFAA 85
             R + C    
Sbjct: 106 RERNA-CGADT 115


>gi|148252519|ref|YP_001237104.1| hypothetical protein BBta_0942 [Bradyrhizobium sp. BTAi1]
 gi|146404692|gb|ABQ33198.1| hypothetical protein BBta_0942 [Bradyrhizobium sp. BTAi1]
          Length = 238

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 7/61 (11%), Positives = 21/61 (34%), Gaps = 1/61 (1%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQRELFEKSQMAWEIYR 77
            + NC       +   C     A +  +++    +++ +  +       ++ Q A+   R
Sbjct: 151 PSFNCATARRAVEKAICADPELANLDREIDGAQTRIMREAVQPAAARALQQEQDAFIARR 210

Query: 78  G 78
            
Sbjct: 211 N 211


>gi|167561003|ref|ZP_02353919.1| putative lipoprotein [Burkholderia oklahomensis EO147]
          Length = 297

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 24/66 (36%), Gaps = 2/66 (3%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q  + +C++     +   C     A    +L   Y++  E V        ++++  W  Y
Sbjct: 206 QQTSFDCSKARSIPEYLICHDPELAASDRELAIIYQQAKEAVSDKAAFA-DRTRKQW-NY 263

Query: 77  RGSECA 82
           R   C 
Sbjct: 264 RQKNCR 269


>gi|78067231|ref|YP_370000.1| hypothetical protein Bcep18194_A5762 [Burkholderia sp. 383]
 gi|77967976|gb|ABB09356.1| hypothetical protein Bcep18194_A5762 [Burkholderia sp. 383]
          Length = 279

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 36/91 (39%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++L+      +  ++ SQ  W  +R  E     +
Sbjct: 57  SSPAGQIQCMGEAQQQWQAVMDGAYQRLLKDAPADAKRGWQDSQRHWLTWRKDEVHLLKA 116

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +   GT+ +M  A+       +R   L S
Sbjct: 117 VYDTTRGTSYAMSSADLQLQPVRDRALALRS 147



 Score = 33.6 bits (75), Expect = 9.0,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 214 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVGFRDA 248


>gi|332561207|ref|ZP_08415525.1| hypothetical protein RSWS8N_19214 [Rhodobacter sphaeroides WS8N]
 gi|332275005|gb|EGJ20321.1| hypothetical protein RSWS8N_19214 [Rhodobacter sphaeroides WS8N]
          Length = 262

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 25/97 (25%), Gaps = 18/97 (18%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
              + +C+     A+   C   S     +     Y  V +            +Q  W   
Sbjct: 177 SGPSFDCSMARSNAEHGICDHESLWARDKLSSKLYAFVRQGSPDGH---ILNNQREWLRG 233

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R S C + A              +CL      R  + 
Sbjct: 234 RDS-CGYDA--------------DCLVRTYDNRIRQF 255


>gi|167568263|ref|ZP_02361137.1| putative lipoprotein [Burkholderia oklahomensis C6786]
          Length = 123

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 32/111 (28%), Gaps = 19/111 (17%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q  + +C++     +   C     A    +L   Y++  E V        ++++  W  Y
Sbjct: 32  QQTSFDCSKARSIPEYLICHDPELAASDRELAIIYQQAKEAVSDKAAFA-DRTRKQW-NY 89

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           R   C                   CL      + E L        GD+   
Sbjct: 90  RQKNCRDKR---------------CLVSWYAHQKEVLTKIAQT--GDVSAQ 123


>gi|160901195|ref|YP_001566777.1| hypothetical protein Daci_5764 [Delftia acidovorans SPH-1]
 gi|160366779|gb|ABX38392.1| conserved hypothetical protein [Delftia acidovorans SPH-1]
          Length = 137

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 39/104 (37%), Gaps = 1/104 (0%)

Query: 14  IAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
            A  + + NC E+    +++  C       + +    +    L+       E  E +Q  
Sbjct: 26  AANPTSSGNCEESSTNMSEVRACLHEQNVAMVKAAYVSLSLKLKARMPQASEELEVAQRN 85

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           W  Y  S C F +       A+    ANC    A  R ++L+S+
Sbjct: 86  WVQYARSACEFLSEFNSASFAKDDARANCWSDFARARAKQLKSW 129


>gi|213612352|ref|ZP_03370178.1| hypothetical protein SentesTyp_07524 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 283

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 201 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 256

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 257 KRISIYKCQLEMTIARTTYLDG 278


>gi|328676813|gb|AEB27683.1| hypothetical protein FNFX1_0735 [Francisella cf. novicida Fx1]
          Length = 91

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 33/92 (35%), Gaps = 17/92 (18%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+      ++N C  +   +   KL                     +   ++ YR + C 
Sbjct: 16  CD--GNTYEINACLKSQMQIYDTKLNDVQN---------------HNIKNFKKYRDNLCY 58

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             +S  + GT Q++ Y NC+        ++L+
Sbjct: 59  DISSTYKSGTYQAIKYGNCVISLDKWYLQQLK 90


>gi|291563230|emb|CBL42046.1| Protein of unknown function (DUF1311) [butyrate-producing bacterium
           SS3/4]
          Length = 293

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 35/90 (38%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++T+ Q            L   +L   Y  + +++++   E   + ++ W   R      
Sbjct: 191 DQTMSQTSRYATAEYVRNLWDRELNLIYSSIHKEMDESAAEALRREEVEWIRKRDLAADK 250

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           A++ +    +QS+ Y        ++R  +L
Sbjct: 251 ASAKSNSTPSQSIEYVRTSASVTMDRCYEL 280


>gi|238911373|ref|ZP_04655210.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 275

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQPEMTIARTAYLDG 273


>gi|257126947|ref|YP_003165061.1| hypothetical protein Lebu_2218 [Leptotrichia buccalis C-1013-b]
 gi|257050886|gb|ACV40070.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 202

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/113 (10%), Positives = 29/113 (25%), Gaps = 11/113 (9%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             + Q    +       + M      ++    ++L   YK ++ ++   Q+      + A
Sbjct: 90  MSSVQDTGFD----GSDSQMYYQAEAAYQAWDKELNKVYKLLMSELPDSQKTKLRNEERA 145

Query: 73  WEIYRGSECAFA-------ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           W     +E                 G+   +            R  +L     
Sbjct: 146 WLKGMVNETKKIVYEECGEEGENGCGSIVHLRKIGTKMDMVKSRTIELARMYD 198


>gi|188532615|ref|YP_001906412.1| hypothetical protein ETA_04610 [Erwinia tasmaniensis Et1/99]
 gi|188027657|emb|CAO95507.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 344

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 23/74 (31%), Gaps = 3/74 (4%)

Query: 1  MCRKIIFALTIIAIAF--QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
          + + +   +    IA    + AL+C  T   A+   CT      +       + +     
Sbjct: 16 LKKILPLFVFAWLIAAIDPARALDCGRTSNMAEYTVCTNPQLLWLDRLYNDAFHQ-RMTE 74

Query: 59 EKHQRELFEKSQMA 72
          + H   L    Q  
Sbjct: 75 DPHHAALLVAPQRQ 88


>gi|91978681|ref|YP_571340.1| tetratricopeptide TPR_2 [Rhodopseudomonas palustris BisB5]
 gi|91685137|gb|ABE41439.1| Tetratricopeptide TPR_2 [Rhodopseudomonas palustris BisB5]
          Length = 254

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 8/65 (12%), Positives = 22/65 (33%), Gaps = 3/65 (4%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE---KVEKHQRELFEKSQMAWEI 75
            + +C       +   C     A +  ++ A Y +VL+     +  +     ++   +  
Sbjct: 165 PSFDCRRARRAVEKAICGDRELANLDREINAIYIRVLQDNATAKPAELRALTRAHEQFIA 224

Query: 76  YRGSE 80
            R + 
Sbjct: 225 ARNAS 229


>gi|16759475|ref|NP_455092.1| hypothetical protein STY0543 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142753|ref|NP_806095.1| hypothetical protein t2363 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213650635|ref|ZP_03380688.1| hypothetical protein SentesTy_27400 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865243|ref|ZP_03387362.1| hypothetical protein SentesT_36075 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828664|ref|ZP_06546463.1| hypothetical protein Salmonellentericaenterica_19341 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25380619|pir||AD0564 probable secreted protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16501767|emb|CAD04982.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138385|gb|AAO69955.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 278

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 196 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 251

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTTYLDG 273


>gi|32266770|ref|NP_860802.1| hypothetical protein HH1271 [Helicobacter hepaticus ATCC 51449]
 gi|32262822|gb|AAP77868.1| hypothetical protein HH_1271 [Helicobacter hepaticus ATCC 51449]
          Length = 467

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 9/72 (12%), Positives = 21/72 (29%), Gaps = 14/72 (19%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--------------KHQR 63
           + + +C +     +   C     A++   +   YK V + +               K  +
Sbjct: 58  APSFDCTKAHNAIEQMICKDKELAMLDALMAQRYKYVKDYIPTLVESNSQLQAIGQKELK 117

Query: 64  ELFEKSQMAWEI 75
            +    Q  W  
Sbjct: 118 NMLLSMQRDWLK 129


>gi|145597794|ref|YP_001161870.1| hypothetical protein YPDSF_0486 [Yersinia pestis Pestoides F]
 gi|145209490|gb|ABP38897.1| hypothetical protein YPDSF_0486 [Yersinia pestis Pestoides F]
          Length = 331

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 27/69 (39%), Gaps = 3/69 (4%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
          F L ++ I+  S+A+NC       +   C+      + +   + Y+ +L K         
Sbjct: 10 FFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHWLAQTFNSIYQVLLVKYNTEMVYQQ 69

Query: 67 EKSQMAWEI 75
           ++   WE 
Sbjct: 70 RQT---WEK 75


>gi|213581788|ref|ZP_03363614.1| hypothetical protein SentesTyph_11539 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 190

 Score = 48.2 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 22/82 (26%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TA 93
               F     +L   +      +    R   ++ Q  W   +  +C   +    E     
Sbjct: 108 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 163

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +    C     I R   L+ 
Sbjct: 164 KRISIYKCQLEMTIARTTYLDG 185


>gi|171912775|ref|ZP_02928245.1| hypothetical protein VspiD_16385 [Verrucomicrobium spinosum DSM
           4136]
          Length = 255

 Score = 48.2 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 34/117 (29%), Gaps = 13/117 (11%)

Query: 6   IFALTIIAIAF--QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           +FA   +       + + +                 F    + L A +     ++ + + 
Sbjct: 22  LFASFSLPFPAGLTAASPD----------VVAAKGRFDKADQDLNAAWVTAKAQLGEERM 71

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           +     Q  W +YR  +   A   A   T  S  Y       + +R   L+  +   
Sbjct: 72  KHVSTVQRQWVVYRDIQADAAQEKAGGKTRSSAWYEK-AAFLSSDRAAWLQRVIKNE 127


>gi|320198572|gb|EFW73172.1| hypothetical protein ECoL_03996 [Escherichia coli EC4100B]
          Length = 120

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 38/117 (32%), Gaps = 28/117 (23%)

Query: 1   MCRKIIFALTIIAIAFQS------------MALNCNETLMQAD-----MNQCTGNSFALV 43
           M + ++  L II+    +               +C +     D     +  C    + LV
Sbjct: 1   MFKFLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLV 60

Query: 44  KEKLEATYKKVLEKV-----------EKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
             +L   Y +    +           +  Q  L +KSQ AW  +R  EC    S  +
Sbjct: 61  DAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED 117


>gi|206560979|ref|YP_002231744.1| hypothetical protein BCAL2640 [Burkholderia cenocepacia J2315]
 gi|198037021|emb|CAR52942.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 273

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 35/91 (38%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++L+      +  ++ SQ  W  +R  E     +
Sbjct: 57  SSPAGQIQCMGEAQQQWQTVMDGAYQRLLKDAPADAKRGWQDSQRRWLTWRKDEVLLLKA 116

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +   GTA +M  A+       +R   L  
Sbjct: 117 VYDTTRGTAYAMSSADLQLQPVRDRALALRG 147



 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 208 FDLNRYYQKLRRKMPAHSAGTLVRAQRAWVAFRDA 242


>gi|262280262|ref|ZP_06058046.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258040|gb|EEY76774.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 138

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 47/142 (33%), Gaps = 34/142 (23%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK----------------- 44
           C+ I+ +    +    +      +T  Q + NQC   +   ++                 
Sbjct: 6   CKLIVLSSLFCSPWLYAQ----TDTDEQDEYNQCVDQTIKEMQLESINNMVVHSCSEQAK 61

Query: 45  --------EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                     ++    +  E  +  + +   KSQ  W+ Y   EC+ A S        S 
Sbjct: 62  KTYEEKIVALIDQIRTQSEEYKQPQRYQDILKSQRLWKAYVDQECSNAGSY-----IGSP 116

Query: 97  IYANCLQGHAIERNEKLESYLT 118
           +Y+ C       R ++LE Y+ 
Sbjct: 117 MYSYCPMQEYAARVKQLEEYIN 138


>gi|283834529|ref|ZP_06354270.1| conserved hypothetical protein [Citrobacter youngae ATCC 29220]
 gi|291070081|gb|EFE08190.1| conserved hypothetical protein [Citrobacter youngae ATCC 29220]
          Length = 152

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 34/99 (34%), Gaps = 5/99 (5%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYK---KVLEKVEKHQRELFEKSQMAWE 74
           +   +C       +       +   ++ ++    +     L+          +KS   + 
Sbjct: 43  AELFDCLRNE-VIESTITLRKAEDNIRLRINKWSEVKSAALDDAIPIALHRLDKSNQEFI 101

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            YR ++C+FA S    G        +C+     +R E+L
Sbjct: 102 RYRLAQCSFAES-WGNGVGSFTRIYSCMAELNRQRAEQL 139


>gi|317404912|gb|EFV85280.1| hypothetical protein HMPREF0005_04353 [Achromobacter xylosoxidans
           C54]
          Length = 149

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 36/120 (30%), Gaps = 21/120 (17%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-- 59
           C  +  A  +      +   +C       +   C   S + + ++++  Y ++  +    
Sbjct: 34  CAVLASAPFLPVKVAHAAGFDCKAAKTHVEHLICADPSLSRLDDQVKDLYDRIQAETAGR 93

Query: 60  ----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                 +R+     Q  W       C  AA               CL+   ++R   ++ 
Sbjct: 94  DGETGERRDPVANEQTQWRTTVRDRCPDAA---------------CLESAYVDRIAAMKK 138


>gi|317405175|gb|EFV85516.1| hypothetical protein HMPREF0005_04025 [Achromobacter xylosoxidans
           C54]
          Length = 129

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 42/131 (32%), Gaps = 20/131 (15%)

Query: 1   MCRKIIFALTIIAIAFQ--SMALN-------C---NETLMQADMNQCTGNSFALVKEKLE 48
           M R  +    +++ A    +   +       C           +  C     A  K ++ 
Sbjct: 1   MIRHALALSLMLSPALVLGASTPDYMGQYDRCLRDAGVTNNGTVGACAEGVSAAAKREIN 60

Query: 49  ATYKKVLEKVE---KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
             Y +V  ++           E++Q AW  YR   CA A +        S +Y  C    
Sbjct: 61  TLYARVQARLATDYPDDAAKLEQTQKAWLAYRNGHCALAGAH-----VGSPMYEYCPMLL 115

Query: 106 AIERNEKLESY 116
            I R ++L   
Sbjct: 116 NINRADELREL 126


>gi|323530194|ref|YP_004232346.1| hypothetical protein BC1001_5922 [Burkholderia sp. CCGE1001]
 gi|323387196|gb|ADX59286.1| conserved membrane protein of unknown function [Burkholderia sp.
           CCGE1001]
          Length = 574

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 29/102 (28%), Gaps = 17/102 (16%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
            +F   + +C++    A+   C+    A    +L A Y K                +  W
Sbjct: 480 ASFLQTSFDCSKARSDAEHIICSDAELASDDVQLAAIYAKAKAAAGDPAAFKERT-RAQW 538

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             YR  +C                   CL     ++N  L  
Sbjct: 539 -NYREQQCHERE---------------CLIRWYADQNVALAE 564


>gi|325267321|ref|ZP_08133983.1| hypothetical protein HMPREF9098_1711 [Kingella denitrificans ATCC
           33394]
 gi|324981258|gb|EGC16908.1| hypothetical protein HMPREF9098_1711 [Kingella denitrificans ATCC
           33394]
          Length = 175

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 38/101 (37%), Gaps = 11/101 (10%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKH---------QRELFEKSQMAWEIYRGS 79
           Q ++  C   +  +    L    ++   K+             ++  + ++ ++  YR +
Sbjct: 71  QTEVRDCVRRAAEISAANLRQAQRQATAKIRAWNEDRRYVLAAQQKLKAAEHSFATYRQN 130

Query: 80  ECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKLESYLT 118
            C++AAS      GTA  M    C+      R E+L   + 
Sbjct: 131 HCSWAASLGGGAIGTANEMRRNACIAETNNRRAEELRGIMQ 171


>gi|220904092|ref|YP_002479404.1| hypothetical protein Ddes_0818 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868391|gb|ACL48726.1| hypothetical protein Ddes_0818 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 181

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 42/111 (37%), Gaps = 3/111 (2%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + + ++Q+  ++ +   +  DM  C       +++ +      +   + + + +   ++ 
Sbjct: 74  LFSPSYQA-CMD-SAAGVTTDMQDCINAELERLEKIIAVRQIALPPVLGEERSKSLRETL 131

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            AW+  R S  + A    + GT   ++ +           + + +    PE
Sbjct: 132 AAWDAMRKSG-SAAMYDPDGGTLSPLMASLWYLEQTARMAQWMNALGESPE 181


>gi|296162314|ref|ZP_06845108.1| protein of unknown function DUF1311 [Burkholderia sp. Ch1-1]
 gi|295887468|gb|EFG67292.1| protein of unknown function DUF1311 [Burkholderia sp. Ch1-1]
          Length = 243

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 13/124 (10%)

Query: 5   IIFALTIIAIAFQSMALN--------C---NETLMQADMNQCTGNSFALVKEKLEATYKK 53
           ++F    +    +  A +        C   ++    A   QC  N+    +  L+  +++
Sbjct: 26  VVFGAASLPAHAEVAAADPIDASMRACLARSDMSSTAGQVQCMDNARIGWRTALDNAWQQ 85

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EGTAQSMIYANCLQGHAIERNE 111
           + +KV   +R+ +EKSQ +W+  R +E    A+      G+   +  A+       +R  
Sbjct: 86  LQQKVPPARRKQWEKSQASWQASRDAEKPLLAAVFATTRGSMYVLAEADMQLQPVRDRAL 145

Query: 112 KLES 115
            L S
Sbjct: 146 ALRS 149


>gi|167843742|ref|ZP_02469250.1| putative lipoprotein [Burkholderia pseudomallei B7210]
 gi|254258162|ref|ZP_04949216.1| hypothetical protein BURPS1710A_0373 [Burkholderia pseudomallei
           1710a]
 gi|254216851|gb|EET06235.1| hypothetical protein BURPS1710A_0373 [Burkholderia pseudomallei
           1710a]
          Length = 229

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 141 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 198

Query: 80  ECA 82
            C 
Sbjct: 199 NCR 201


>gi|134295640|ref|YP_001119375.1| putative lipoprotein [Burkholderia vietnamiensis G4]
 gi|134138797|gb|ABO54540.1| putative lipoprotein [Burkholderia vietnamiensis G4]
          Length = 305

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 22/67 (32%), Gaps = 2/67 (2%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
            Q  + +C++     +   C     A     L  TY++  E           +++  W  
Sbjct: 211 VQQTSFDCSKAKSIPEFLICHDPDLAAADRDLADTYRQAKEAAVDKTAFN-NRTRRQW-N 268

Query: 76  YRGSECA 82
           +R   C 
Sbjct: 269 FREKNCR 275


>gi|192293356|ref|YP_001993961.1| Tetratricopeptide TPR_2 repeat protein [Rhodopseudomonas palustris
           TIE-1]
 gi|192287105|gb|ACF03486.1| Tetratricopeptide TPR_2 repeat protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 248

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 26/63 (41%), Gaps = 2/63 (3%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIY 76
            + +C  T    D   C   + A +  +++A Y++ L     +       +K+Q ++   
Sbjct: 160 PSFDCRRTRKAVDKAICADPALADLDRRIDALYRRALRDSAGQPAAVRALKKAQTSFVAA 219

Query: 77  RGS 79
           R +
Sbjct: 220 RDA 222


>gi|262373793|ref|ZP_06067071.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311546|gb|EEY92632.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 246

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 41/116 (35%), Gaps = 15/116 (12%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQR 63
           +  L +  ++  S A    +     +        +   + +L + Y  +   +   K++ 
Sbjct: 9   LIVLLVFGLSACSNAAE-YKPQRLDEKTV-----YKNSEHELNSIYFDIKIYIGDNKNEV 62

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           +    +Q +W   R  +C F       G  ++     CL      + + L +SYL 
Sbjct: 63  KYLVDTQRSWLKNRNLKCDF------NGKEENYENYKCLSDFNNSKIKDLRKSYLN 112


>gi|91782355|ref|YP_557561.1| hypothetical protein Bxe_A3476 [Burkholderia xenovorans LB400]
 gi|91686309|gb|ABE29509.1| Hypothetical protein Bxe_A3476 [Burkholderia xenovorans LB400]
          Length = 243

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 13/124 (10%)

Query: 5   IIFALTIIAIAFQSMALN--------C---NETLMQADMNQCTGNSFALVKEKLEATYKK 53
           ++F    +    +  A +        C   ++    A   QC  N+    +  L+  +++
Sbjct: 26  VVFGAASLPAHAEVAAADPIDASMRACLARSDMSSTAGQVQCMDNARIGWRTALDNAWQQ 85

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EGTAQSMIYANCLQGHAIERNE 111
           + +KV   +R+ +EKSQ +W+  R +E    A+      G+   +  A+       +R  
Sbjct: 86  LQQKVPPARRKQWEKSQASWQASRDAEKPLLAAVFATTRGSMYVLAEADMQLQPVRDRAL 145

Query: 112 KLES 115
            L S
Sbjct: 146 ALRS 149


>gi|239503273|ref|ZP_04662583.1| hypothetical protein AbauAB_13263 [Acinetobacter baumannii AB900]
          Length = 138

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 36/88 (40%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKV----EKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+ A   ++  +     +  + +   KSQ  W+ Y   EC  A S    
Sbjct: 56  CSEQAKKTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECNNAGSY--- 112

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
               S +Y+ C       R ++LE Y+ 
Sbjct: 113 --IGSPMYSYCPMQEYAARVKQLEEYVN 138


>gi|316936007|ref|YP_004110989.1| TPR repeat-containing protein [Rhodopseudomonas palustris DX-1]
 gi|315603721|gb|ADU46256.1| TPR repeat-containing protein [Rhodopseudomonas palustris DX-1]
          Length = 252

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 24/63 (38%), Gaps = 2/63 (3%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIY 76
            + +C       D   C   + A +  +++A Y++ L     +       +K+  ++   
Sbjct: 164 PSFDCRGARKAVDKAICADPALADLDRRIDALYRRALRDRAGQPAVLRALKKAHTSFVAA 223

Query: 77  RGS 79
           R +
Sbjct: 224 RDA 226


>gi|27383037|ref|NP_774566.1| hypothetical protein blr7926 [Bradyrhizobium japonicum USDA 110]
 gi|27356211|dbj|BAC53191.1| blr7926 [Bradyrhizobium japonicum USDA 110]
          Length = 374

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 30/96 (31%), Gaps = 3/96 (3%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C      A    C   S AL + +L      ++ K++             W   R   
Sbjct: 133 FDCLAANTAAGALICAEPSLALAETELNGQVLGLIGKLDPTAARFAFAEYGRWTRERDRR 192

Query: 81  CAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLES 115
           C            Q +  A +CL  +   + +++ +
Sbjct: 193 CNLVGKENV--PLQELESAESCLADYLAHKIDEIRA 226


>gi|86751429|ref|YP_487925.1| TPR repeat-containing protein [Rhodopseudomonas palustris HaA2]
 gi|86574457|gb|ABD09014.1| TPR repeat protein [Rhodopseudomonas palustris HaA2]
          Length = 261

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 7/65 (10%), Positives = 24/65 (36%), Gaps = 3/65 (4%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE---KVEKHQRELFEKSQMAWEI 75
            + +C       +   C     A +  ++ A + ++L+     +  +    +++Q  +  
Sbjct: 171 PSFDCRRARRAVEKAICGDRDLANLDREIAAMHLRILQDKASAKPAELRALKRAQADFLA 230

Query: 76  YRGSE 80
            R + 
Sbjct: 231 NRNAS 235


>gi|294651681|ref|ZP_06728983.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822400|gb|EFF81301.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 138

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 35/88 (39%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKV----EKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+     ++  +     +  + +   KSQ  W+ Y   EC  A      
Sbjct: 56  CSDKAKKAYEEKIVVLIDQIRAQSEEYKQPKRYQDILKSQRLWKAYVEQECHNAGEY--- 112

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
               S +Y+ C      ER ++LE Y+ 
Sbjct: 113 --IGSPMYSYCPMQKYAERVKQLEEYIH 138


>gi|205352284|ref|YP_002226085.1| hypothetical protein SG1025 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205272065|emb|CAR36913.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326627331|gb|EGE33674.1| Putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 152

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 40/133 (30%), Gaps = 26/133 (19%)

Query: 5   IIFALTIIAIAFQSMAL----------NCNETLMQADMNQCTGNS-------FALVKEKL 47
           II A  I + +                NC     +A++  C  N            +E +
Sbjct: 9   IILATLIFSFSSIHSTYANNVYYPSKNNCESGE-EAELVDCLRNEVIESTITLRKAEENI 67

Query: 48  -------EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
                         L+          +KS   +  YR ++C+FA S    G         
Sbjct: 68  RLRINKWSEVKNAALDDAIPIALYRLDKSNQEFIRYRLAQCSFAES-WGNGVGSFTRIYF 126

Query: 101 CLQGHAIERNEKL 113
           C+     +R E+L
Sbjct: 127 CMAELNKQRAEQL 139


>gi|76812097|ref|YP_331730.1| putative lipoprotein [Burkholderia pseudomallei 1710b]
 gi|254186638|ref|ZP_04893155.1| putative lipoprotein [Burkholderia pseudomallei Pasteur 52237]
 gi|76581550|gb|ABA51025.1| putative lipoprotein [Burkholderia pseudomallei 1710b]
 gi|157934323|gb|EDO89993.1| putative lipoprotein [Burkholderia pseudomallei Pasteur 52237]
          Length = 295

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 207 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 264

Query: 80  ECA 82
            C 
Sbjct: 265 NCR 267


>gi|126438931|ref|YP_001057162.1| hypothetical protein BURPS668_0107 [Burkholderia pseudomallei 668]
 gi|126218424|gb|ABN81930.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 244

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCH 216


>gi|254184168|ref|ZP_04890759.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184214700|gb|EDU11743.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 244

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|90425869|ref|YP_534239.1| tetratricopeptide TPR_2 [Rhodopseudomonas palustris BisB18]
 gi|90107883|gb|ABD89920.1| Tetratricopeptide TPR_2 [Rhodopseudomonas palustris BisB18]
          Length = 253

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/99 (12%), Positives = 28/99 (28%), Gaps = 16/99 (16%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWEIY 76
            + +C +         C     A +  +++A ++  L         R    ++Q A+   
Sbjct: 165 PSFDCKQAKRPVQKAICADPELADLDREIDAAHQAKLRHAAAGTVSRRALLRAQDAYLAE 224

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R +    +                 L+     R  +L  
Sbjct: 225 RNAAFGRSTDE--------------LRAAMKARLRQLRG 249


>gi|53717732|ref|YP_106718.1| putative lipoprotein [Burkholderia pseudomallei K96243]
 gi|52208146|emb|CAH34076.1| putative lipoprotein [Burkholderia pseudomallei K96243]
          Length = 295

 Score = 47.1 bits (110), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 207 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 264

Query: 80  ECA 82
            C 
Sbjct: 265 NCR 267


>gi|310722448|ref|YP_003969272.1| hypothetical protein phiAS4_ORF0254 [Aeromonas phage phiAS4]
 gi|306021291|gb|ADM79826.1| hypothetical protein phiAS4_ORF0254 [Aeromonas phage phiAS4]
          Length = 152

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 37/120 (30%), Gaps = 23/120 (19%)

Query: 2   CRKIIFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            + +  AL   A    + + +C  + L   +   C     +L+ +++   +K V      
Sbjct: 1   MKALTIALLFAASTASAASFDCQVKNLNAIEKAICAVPEISLLDDQMAEAFKAVSH---- 56

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
                 +  Q A+   R +                    + L+ +  +R  +L+      
Sbjct: 57  --IPEVKADQRAYIKERNAS----------------TSLSSLKDNMTDRIIELQIIAELE 98


>gi|320085351|emb|CBY95134.1| hypothetical protein SENTW_1054 [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 152

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 40/133 (30%), Gaps = 26/133 (19%)

Query: 5   IIFALTIIAIAFQSMAL----------NCNETLMQADMNQCTGNS-------FALVKEKL 47
           II A  + + +                NC     +A++  C  N            +E +
Sbjct: 9   IILATLMFSFSSIHSTYANNVYYPSKNNCESGE-EAELVDCLRNEVIESTITLRKAEENI 67

Query: 48  -------EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
                         L+          +KS   +  YR ++C+FA S    G         
Sbjct: 68  RLRINKWSEVKNAALDDAIPIALYRLDKSNQEFIRYRLAQCSFAES-WGNGVGSFTRIYF 126

Query: 101 CLQGHAIERNEKL 113
           C+     +R E+L
Sbjct: 127 CMAELNRQRAEQL 139


>gi|167908948|ref|ZP_02496039.1| hypothetical protein Bpse112_00525 [Burkholderia pseudomallei 112]
          Length = 244

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|134281440|ref|ZP_01768148.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134247107|gb|EBA47193.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 258

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 170 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 227

Query: 80  ECA 82
            C 
Sbjct: 228 NCR 230


>gi|218659275|ref|ZP_03515205.1| hypothetical protein RetlI_06221 [Rhizobium etli IE4771]
          Length = 253

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 42/124 (33%), Gaps = 27/124 (21%)

Query: 1   MCRKIIFALTIIAI-------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKK 53
           M   +  A+ I  I       A  +M     + L   +   C   +      ++  T++ 
Sbjct: 142 MTMALGLAILIFGIGDGPRRRASNAM----RKKLKPDEKAICDNRALNDADVRMVTTFEL 197

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +   +    R   +  Q AW   R  EC   A+              C++    ER ++L
Sbjct: 198 LSGLMAMGSRGTLQDEQTAWLKKR-QECGADAA--------------CIKAAYDERMKQL 242

Query: 114 -ESY 116
            ESY
Sbjct: 243 GESY 246


>gi|167717472|ref|ZP_02400708.1| hypothetical protein BpseD_00540 [Burkholderia pseudomallei DM98]
 gi|167813595|ref|ZP_02445275.1| hypothetical protein Bpse9_00565 [Burkholderia pseudomallei 91]
 gi|167892222|ref|ZP_02479624.1| hypothetical protein Bpse7_00565 [Burkholderia pseudomallei 7894]
 gi|167916979|ref|ZP_02504070.1| hypothetical protein BpseBC_00425 [Burkholderia pseudomallei
           BCC215]
 gi|217423853|ref|ZP_03455353.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254194714|ref|ZP_04901145.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254298578|ref|ZP_04966029.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157808479|gb|EDO85649.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|169651464|gb|EDS84157.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|217392916|gb|EEC32938.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
          Length = 244

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|207856477|ref|YP_002243128.1| hypothetical protein SEN0998 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708280|emb|CAR32581.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 152

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 40/133 (30%), Gaps = 26/133 (19%)

Query: 5   IIFALTIIAIAFQSMAL----------NCNETLMQADMNQCTGNS-------FALVKEKL 47
           II A  I + +                NC     +A++  C  N            +E +
Sbjct: 9   IILATLIFSFSSIHSTYANNVYYPSKNNCESGE-EAELVDCLRNEVLESTITLRKAEENI 67

Query: 48  -------EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
                         L+          +KS   +  YR ++C+FA S    G         
Sbjct: 68  RLRINKWSEVKNAALDDAIPIALYRLDKSNQEFIRYRLAQCSFAES-WGNGVGSFTRIYF 126

Query: 101 CLQGHAIERNEKL 113
           C+     +R E+L
Sbjct: 127 CMAELNKQRAEQL 139


>gi|39937563|ref|NP_949839.1| TPR repeat-containing protein [Rhodopseudomonas palustris CGA009]
 gi|39651422|emb|CAE29945.1| TPR repeat [Rhodopseudomonas palustris CGA009]
          Length = 248

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIY 76
            + +C  TL   D   C   + A +  +++A Y++ L     +       +K+Q ++   
Sbjct: 160 PSFDCRRTLKAVDKAICADPALADLDRRIDALYRRALRDSAGQPAAVRALKKAQTSFVAA 219

Query: 77  RGS 79
           R +
Sbjct: 220 RDA 222


>gi|126452129|ref|YP_001064408.1| hypothetical protein BURPS1106A_0123 [Burkholderia pseudomallei
           1106a]
 gi|167822140|ref|ZP_02453611.1| hypothetical protein Bpseu9_00585 [Burkholderia pseudomallei 9]
 gi|242315012|ref|ZP_04814028.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|126225771|gb|ABN89311.1| hypothetical protein BURPS1106A_0123 [Burkholderia pseudomallei
           1106a]
 gi|242138251|gb|EES24653.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 244

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|209521538|ref|ZP_03270240.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209498038|gb|EDZ98191.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 206

 Score = 47.1 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            +        QC  N+       +++ Y+++L K+   +R L++KSQ +W   R +E   
Sbjct: 21  ADMSTTTGQVQCMDNARIGWMAAVDSAYQQLLAKLPTARRGLWQKSQSSWLASRDAEKQL 80

Query: 84  AASGAE--EGTAQSMIYANCLQGHAIERNEKLESYL 117
            A+     +G+   +  A+       +R   L S L
Sbjct: 81  LAAVFATTKGSMYVLAEADMQLQPVRDRALVLRSAL 116


>gi|289806841|ref|ZP_06537470.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 48

 Score = 47.1 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 20/48 (41%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEA 49
           ++I      +  + Q++A  C     Q +MN+C    +    +KL  
Sbjct: 1  MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNE 48


>gi|167736521|ref|ZP_02409295.1| hypothetical protein Bpse14_00580 [Burkholderia pseudomallei 14]
          Length = 244

 Score = 47.1 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|237810303|ref|YP_002894754.1| hypothetical protein GBP346_A0025 [Burkholderia pseudomallei
           MSHR346]
 gi|237503824|gb|ACQ96142.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 244

 Score = 47.1 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 156 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 213

Query: 80  ECA 82
            C 
Sbjct: 214 NCR 216


>gi|157157453|ref|YP_001463309.1| putative lipoprotein [Escherichia coli E24377A]
 gi|209919435|ref|YP_002293519.1| hypothetical protein ECSE_2244 [Escherichia coli SE11]
 gi|157079483|gb|ABV19191.1| putative lipoprotein [Escherichia coli E24377A]
 gi|209912694|dbj|BAG77768.1| conserved hypothetical protein [Escherichia coli SE11]
          Length = 307

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 27/77 (35%), Gaps = 6/77 (7%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY 98
           +FA     L   +     K+   +++    SQ  W   + + C   +    +   + M+ 
Sbjct: 236 AFANADSDLNTVW----SKLTPAKKKELLPSQRQWIKTKDAMCGKVSMQGTDAEVKKMV- 290

Query: 99  ANCLQGHAIERNEKLES 115
            +C     + R   L +
Sbjct: 291 -DCQTQMTLSRIAFLRN 306


>gi|299068265|emb|CBJ39484.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 414

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/73 (13%), Positives = 21/73 (28%), Gaps = 2/73 (2%)

Query: 10  TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS 69
            +      + + +C++    A+   C+    A    +L   + +                
Sbjct: 318 ALAGTPALTTSFDCSKAKSDAERLICSDPVLAANDVELAKIFVRAKAAATDQAAFRERVR 377

Query: 70  QMAWEIYRGSECA 82
           Q  W  YR   C 
Sbjct: 378 QQ-W-NYREQNCH 388



 Score = 43.6 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 24/76 (31%), Gaps = 2/76 (2%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA--SGAEEGTAQSMIYANCL 102
           +        V     K  R+     Q  W   R + C   A  SG+ +          C 
Sbjct: 226 KAANEAINIVWNAGSKEWRQELLPEQRLWLAQRENGCKIKALDSGSADSLVFQTTRLQCE 285

Query: 103 QGHAIERNEKLESYLT 118
               ++R + L++ L 
Sbjct: 286 VQMTVDRTQVLKASLQ 301


>gi|157147130|ref|YP_001454449.1| hypothetical protein CKO_02907 [Citrobacter koseri ATCC BAA-895]
 gi|157084335|gb|ABV14013.1| hypothetical protein CKO_02907 [Citrobacter koseri ATCC BAA-895]
          Length = 329

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 29/77 (37%), Gaps = 5/77 (6%)

Query: 1  MCRKII--FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
          M  ++I    L +   A  + A+NC    M  +   C  ++   +   +   Y  +L + 
Sbjct: 1  MIGRLINCLILLVSFSAASAYAVNCQRASMPLENTICNNDNLHWLDSTMTVIYHTMLVRN 60

Query: 59 EKHQRELFEKSQMAWEI 75
             Q    +K Q  WE 
Sbjct: 61 PSQQVH--KKYQ-EWEK 74


>gi|323525142|ref|YP_004227295.1| hypothetical protein BC1001_0781 [Burkholderia sp. CCGE1001]
 gi|323382144|gb|ADX54235.1| hypothetical protein BC1001_0781 [Burkholderia sp. CCGE1001]
          Length = 233

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 38/91 (41%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    K  L+  ++++  ++   +R+ ++KSQ AW+  R +E    A+
Sbjct: 48  SSTAGQVQCMETARIGWKTALDNAWQQLQPELPPVRRKQWDKSQAAWQASRDAEKQLLAA 107

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 GT   +  A+       +R   L S
Sbjct: 108 VFATTRGTMYVLAEADMQLQPVRDRALVLRS 138


>gi|226193215|ref|ZP_03788825.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|225934815|gb|EEH30792.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 232

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 2/63 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           + +C++     +   C     A    +L   Y++  + V           +  W  +R  
Sbjct: 144 SFDCSKVGSIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAART-RRQW-NFRQR 201

Query: 80  ECA 82
            C 
Sbjct: 202 NCR 204


>gi|148251635|ref|YP_001236220.1| hypothetical protein BBta_0009 [Bradyrhizobium sp. BTAi1]
 gi|146403808|gb|ABQ32314.1| putative exported protein of unknown function [Bradyrhizobium sp.
          BTAi1]
          Length = 245

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/66 (13%), Positives = 25/66 (37%), Gaps = 5/66 (7%)

Query: 2  CRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           +K+  AL  + +     +  S + +C+      +   C  +  A + + +   +K+ L 
Sbjct: 5  LKKLSPALFPLLLGHAPASATSPSFDCSRAKSSDEKLICEDDHLAELDQAVAIAFKQALT 64

Query: 57 KVEKHQ 62
            +   
Sbjct: 65 AKKADA 70


>gi|239905268|ref|YP_002952007.1| hypothetical protein DMR_06300 [Desulfovibrio magneticus RS-1]
 gi|239795132|dbj|BAH74121.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 277

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/73 (12%), Positives = 18/73 (24%), Gaps = 3/73 (4%)

Query: 13 AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
          +   ++  ++C +     +   C       +                          Q A
Sbjct: 16 SGPARAGGIDCAKAQTAVEKTICADPQL--LAADAAVAEAFAAAVAASPDPAAVRAGQRA 73

Query: 73 WEIYRGSECAFAA 85
          W   R + C  AA
Sbjct: 74 WLAIRNA-CPDAA 85


>gi|218680862|ref|ZP_03528759.1| hypothetical protein RetlC8_19241 [Rhizobium etli CIAT 894]
          Length = 88

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 23/74 (31%), Gaps = 4/74 (5%)

Query: 8  ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
          A  ++A A ++   +C+      +   C  N  +   E     Y    +           
Sbjct: 13 AGVLVATAAEAAGFDCSRASSADEKIVCGDNRLSRFDELFNERYAATKKASPDED---IV 69

Query: 68 KSQMAWEIYRGSEC 81
           +   +   R S+C
Sbjct: 70 HTARNFLADR-SDC 82


>gi|330817982|ref|YP_004361687.1| hypothetical protein bgla_1g31230 [Burkholderia gladioli BSR3]
 gi|327370375|gb|AEA61731.1| hypothetical protein bgla_1g31230 [Burkholderia gladioli BSR3]
          Length = 246

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 30/91 (32%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                  QC   +       ++  ++++        R  +++SQ  W ++R  E     +
Sbjct: 59  SSTVGQIQCMDEARTKWLAAVDEAFQQLTNVAPPAARRGWQESQRRWLLWRKDETLLTQA 118

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 GT  +M  A+       +R   L  
Sbjct: 119 VYATTSGTMYAMASADMRIQPVRDRALSLRD 149



 Score = 35.1 bits (79), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 28/86 (32%), Gaps = 14/86 (16%)

Query: 32  MNQCTGNSF-ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           +  C+ ++        L   Y K+ +++    R +  ++Q AW  +R             
Sbjct: 167 VRACSDDAACEHALFDLNRYYVKLQKRMPARSRPMLVRAQRAWVSFRD------------ 214

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
           GT   MI           R   L+  
Sbjct: 215 GT-TPMISEEQRVDLIGARVATLKRL 239


>gi|269120619|ref|YP_003308796.1| hypothetical protein Sterm_2010 [Sebaldella termitidis ATCC 33386]
 gi|268614497|gb|ACZ08865.1| hypothetical protein Sterm_2010 [Sebaldella termitidis ATCC 33386]
          Length = 501

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA------EEGTAQ 94
               E+L   Y+ +   +   Q+     SQ AW  YR SE  F  S              
Sbjct: 322 EKADEELNKVYQHLTGILNDDQKSKLTSSQKAWLDYRDSEFKFLNSVFFIKDIPNSAEIS 381

Query: 95  SMIYANCLQGHAIERNEKLESY 116
           +             R  +L +Y
Sbjct: 382 NRFSEKYKIKIIENRISELNTY 403


>gi|37526845|ref|NP_930189.1| hypothetical protein plu2955 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|36786277|emb|CAE15329.1| unnamed protein product [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 99

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 8/69 (11%), Positives = 22/69 (31%), Gaps = 1/69 (1%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +   L  ++      + +C +   +A+   C+  + +   + L   Y +       +   
Sbjct: 8  LALILCSMSFLSFGASFDCAKATSKAEKLICSTPALSQADDNLYINYLQAKLATGNNVDF 67

Query: 65 LFEKSQMAW 73
               Q  W
Sbjct: 68 KALVKQ-NW 75


>gi|289807292|ref|ZP_06537921.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 46

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 5/44 (11%), Positives = 15/44 (34%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVK 44
          M R +I    +  ++  + + +C +     +   C   +     
Sbjct: 1  MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKD 44


>gi|115526448|ref|YP_783359.1| TPR repeat-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115520395|gb|ABJ08379.1| Tetratricopeptide TPR_2 repeat protein [Rhodopseudomonas palustris
           BisA53]
          Length = 253

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/97 (11%), Positives = 27/97 (27%), Gaps = 16/97 (16%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIY 76
            + +C    ++ +   C     A +  ++   + +VL      K   +   +S   +   
Sbjct: 165 PSFDCARARLKVEKAICADPELADLDREVAGAFDRVLRDAVRAKINVKQLRRSHAVYLAR 224

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R +                      L+     R  +L
Sbjct: 225 RAASFGRPGYD--------------LRAAMKARIREL 247


>gi|221199346|ref|ZP_03572390.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221205752|ref|ZP_03578767.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221174590|gb|EEE07022.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221180631|gb|EEE13034.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 256

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 30/80 (37%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    +  ++  Y ++L+      +  +++SQ  W  +R  E     +
Sbjct: 45  SSTAGQIQCMNEAQQQWQAAMDDAYARLLKNAPADAKRGWQESQRRWLTWRKDEAHLLKA 104

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GT  +M  A+    
Sbjct: 105 VYDTTSGTMYTMASADMQLQ 124



 Score = 34.0 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 9/43 (20%), Positives = 17/43 (39%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             +       L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 183 DAACEHAVFDLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDA 225


>gi|107023369|ref|YP_621696.1| hypothetical protein Bcen_1820 [Burkholderia cenocepacia AU 1054]
 gi|116690451|ref|YP_836074.1| hypothetical protein Bcen2424_2431 [Burkholderia cenocepacia
           HI2424]
 gi|105893558|gb|ABF76723.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116648540|gb|ABK09181.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 271

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 34/91 (37%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +
Sbjct: 57  SSPAGQIQCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWLTWRKDEVLLLKA 116

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +   GTA +M  A+       +R   L  
Sbjct: 117 VYDTTRGTAYAMSSADLQLQPVRDRALALRG 147



 Score = 34.0 bits (76), Expect = 7.6,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 206 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDA 240


>gi|170733772|ref|YP_001765719.1| hypothetical protein Bcenmc03_2436 [Burkholderia cenocepacia MC0-3]
 gi|169817014|gb|ACA91597.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
          Length = 271

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 34/91 (37%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +
Sbjct: 57  SSPAGQIQCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWLTWRKDEVLLLKA 116

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +   GTA +M  A+       +R   L  
Sbjct: 117 VYDTTRGTAYAMSSADLQLQPVRDRALALRG 147



 Score = 34.0 bits (76), Expect = 7.6,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 206 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDA 240


>gi|254247506|ref|ZP_04940827.1| Hypothetical protein BCPG_02305 [Burkholderia cenocepacia PC184]
 gi|124872282|gb|EAY63998.1| Hypothetical protein BCPG_02305 [Burkholderia cenocepacia PC184]
          Length = 273

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 34/91 (37%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +
Sbjct: 59  SSPAGQIQCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWVTWRKDEMLLLKA 118

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
             +   GTA +M  A+       +R   L  
Sbjct: 119 VYDTTRGTAYAMSSADLQLQPVRDRALALRG 149



 Score = 34.0 bits (76), Expect = 6.5,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 208 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDA 242


>gi|260598977|ref|YP_003211548.1| hypothetical protein CTU_31850 [Cronobacter turicensis z3032]
 gi|260218154|emb|CBA32980.1| hypothetical protein CTU_31850 [Cronobacter turicensis z3032]
          Length = 358

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 25/84 (29%), Gaps = 11/84 (13%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
           C       +  K+  +Y +    +           Q AW   R + CA        G+A 
Sbjct: 2   CQQPPLGELDSKINDSYLRATGSMSAQDAAALRTEQRAWLKTRNA-CA--------GSAN 52

Query: 95  SMIYANCLQGHAIERNEKLESYLT 118
            +    CL      R + L+    
Sbjct: 53  EL--NACLTASMTPRAQALKDIAQ 74


>gi|94313172|ref|YP_586381.1| hypothetical protein Rmet_4245 [Cupriavidus metallidurans CH34]
 gi|93357024|gb|ABF11112.1| hypothetical protein (secreted) [Cupriavidus metallidurans CH34]
          Length = 144

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 33/104 (31%), Gaps = 11/104 (10%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-----------HQRELFEKSQM 71
           C      A+  +C   +    + +L A  KK    +                  F+K++ 
Sbjct: 36  CAAKETNAEQRECYPAAVRQSEVELVAAEKKARAAMVDLERESEGSRSLQPVMAFDKAER 95

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           A+  +R +E     +    G    +          + R ++L+ 
Sbjct: 96  AYRAFRTAESNRVVASYGSGNGGGLASYKATIEMNLTRIKQLQG 139


>gi|298290650|ref|YP_003692589.1| hypothetical protein Snov_0637 [Starkeya novella DSM 506]
 gi|296927161|gb|ADH87970.1| protein of unknown function DUF1311 [Starkeya novella DSM 506]
          Length = 126

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 35/92 (38%), Gaps = 13/92 (14%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH---------QRELFEKSQMA 72
           NC++ L    M  C     A   + L A Y+K+L  +++           R+    +Q A
Sbjct: 34  NCDK-LDGYAMEDCLTKEAAEADKALNAAYQKMLAAIDQDATPSDPKATWRDNLVAAQRA 92

Query: 73  WEIYRGSECAFAASGAEEGTA---QSMIYANC 101
           W  YR + C F  S     +A   +      C
Sbjct: 93  WIAYRDANCKFDLSVRNGISAAAPRPRSSNAC 124


>gi|307728933|ref|YP_003906157.1| hypothetical protein BC1003_0882 [Burkholderia sp. CCGE1003]
 gi|307583468|gb|ADN56866.1| hypothetical protein BC1003_0882 [Burkholderia sp. CCGE1003]
          Length = 231

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    K  L+  ++++  ++   +R+ ++KSQ +WE  R ++    A+
Sbjct: 46  SSTAGQVQCMETARIGWKTALDNAWQQLQPELPPARRKQWQKSQASWEALRDADKQLLAA 105

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 GT   +  A+       +R   L  
Sbjct: 106 VFATTRGTMYLLAEADMQLQPVRDRALLLRG 136


>gi|238028336|ref|YP_002912567.1| hypothetical protein bglu_1g27970 [Burkholderia glumae BGR1]
 gi|237877530|gb|ACR29863.1| Hypothetical protein bglu_1g27970 [Burkholderia glumae BGR1]
          Length = 235

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 32/91 (35%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                  QC   + A     ++  + ++        +  +++SQ  W+++R  E   A +
Sbjct: 48  SSTVGQIQCMDEARAKWLAAVDDAFAQLNTVAPAAAKRGWQESQRRWQLWRKDETLLAQA 107

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 GT  +M  A+       +R   L  
Sbjct: 108 VYATTSGTMYAMASADMRIQPVRDRALSLRD 138



 Score = 36.7 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 27/86 (31%), Gaps = 14/86 (16%)

Query: 32  MNQCTGNSF-ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           +  C+ ++        L   Y K+ +++    R    ++Q AW  +R +           
Sbjct: 156 VRACSDDAACEHALFDLNRYYVKLQKRMPSRSRPTLVRAQRAWVAFRDAT---------- 205

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
                MI           R   L+ +
Sbjct: 206 ---TPMISEQQRVDLIGARVATLKRF 228


>gi|238786303|ref|ZP_04630243.1| hypothetical protein yberc0001_37090 [Yersinia bercovieri ATCC
           43970]
 gi|238712786|gb|EEQ04858.1| hypothetical protein yberc0001_37090 [Yersinia bercovieri ATCC
           43970]
          Length = 142

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 32/104 (30%), Gaps = 11/104 (10%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----------EKHQRELFEKSQM 71
           C       +  +C        + +L A  KKV   +             H  + F+ ++ 
Sbjct: 38  CQAKQTTVEQRECYPLVAKQSEVELVAAEKKVRTAMVELEKVSEGSRSMHPVKAFDNAER 97

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           A+  +R +E     +    G    +     +    + R  +L  
Sbjct: 98  AYRAFRTAESHRVLASYGSGNGGGLASYQTIIEMNMMRIHQLND 141


>gi|148653770|ref|YP_001280863.1| hypothetical protein PsycPRwf_1973 [Psychrobacter sp. PRwf-1]
 gi|148572854|gb|ABQ94913.1| hypothetical protein PsycPRwf_1973 [Psychrobacter sp. PRwf-1]
          Length = 310

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           + K+  K  K  ++  E  Q  W  +R   C   A  AE    Q ++   C+     ER 
Sbjct: 242 FNKLWGKASKEAQDSLEYDQKDWVEWRDEVCVDEARSAEP-ARQEIVRMQCITRLLSERY 300

Query: 111 EKLESYLT 118
            +++ Y  
Sbjct: 301 YEVKEYFD 308


>gi|115522091|ref|YP_779002.1| hypothetical protein RPE_0061 [Rhodopseudomonas palustris BisA53]
 gi|115516038|gb|ABJ04022.1| protein of unknown function DUF1311 [Rhodopseudomonas palustris
           BisA53]
          Length = 153

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 32/85 (37%), Gaps = 3/85 (3%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVE--KHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
            C           LEA Y   +  ++    Q E   +SQ +W  ++ + C FA +     
Sbjct: 67  ACLKRLIRREAASLEAAYSATMSSLQSMPSQTERLRQSQRSWLQFQTANCEFAKAI-SGN 125

Query: 92  TAQSMIYANCLQGHAIERNEKLESY 116
                 Y +C+    I+R  +L S 
Sbjct: 126 ENADESYHDCVLRSTIDRRVELRSL 150


>gi|146343366|ref|YP_001208414.1| TPR repeat-containing protein [Bradyrhizobium sp. ORS278]
 gi|146196172|emb|CAL80199.1| conserved hypothetical protein with two TPR repeat domains;
           putative exported protein [Bradyrhizobium sp. ORS278]
          Length = 256

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 24/63 (38%), Gaps = 1/63 (1%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIYR 77
            + NC      A+   C     A +  +++ ++ + + +          ++ Q A+   R
Sbjct: 169 PSFNCAAARRAAEKAICADPELANLDREIDGSHARAVREAPGPAAARALQREQDAFIARR 228

Query: 78  GSE 80
            ++
Sbjct: 229 NAD 231


>gi|309779123|ref|ZP_07673888.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308922084|gb|EFP67716.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 151

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 33/92 (35%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                 +  C     A   ++L+ TYK +L  ++    +    S+ AW+ +     AF  
Sbjct: 55  PDNADAIGACLSAEKAAQTKRLDRTYKTLLGTLDGKANDALVSSEQAWQDFHTRTAAFET 114

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +   +G    +           ER   L+ YL
Sbjct: 115 AIYGKGKLDDLQRLENEIFRLSERANALDKYL 146


>gi|329118566|ref|ZP_08247270.1| hypothetical protein HMPREF9123_0698 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465301|gb|EGF11582.1| hypothetical protein HMPREF9123_0698 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 113

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 41/117 (35%), Gaps = 16/117 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFA--LVKEKLEATYKKVLEKV 58
           M + +     ++A+   + A  C           C+G+         +L A  ++    +
Sbjct: 1   MKKHLF--ALLLAVCATAQAEVCINV-------ICSGDEERERQAAAELSAELQRSQTLL 51

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           E H+      +Q  WE +   +C +  +   + +        C   H  +R E++  
Sbjct: 52  EPHRFAGLVHTQQTWETFVKEDCRYNHTRYVQYS-----RHTCFMKHYRDRLEEIRQ 103


>gi|88809190|ref|ZP_01124699.1| hypothetical protein WH7805_05841 [Synechococcus sp. WH 7805]
 gi|88787132|gb|EAR18290.1| hypothetical protein WH7805_05841 [Synechococcus sp. WH 7805]
          Length = 104

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 25/91 (27%), Gaps = 14/91 (15%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                +M  C   ++    + L+    +   +               W+      CA A 
Sbjct: 26  GENTIEMRFCASQNWEESNQALKEQLPQATLE--------------KWKAATQEVCAAAY 71

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +   +GT    +   C         E+L+  
Sbjct: 72  APYRQGTIYPQMVVGCDDRLNRVLLEELKGL 102


>gi|121583380|ref|YP_973811.1| hypothetical protein Pnap_4652 [Polaromonas naphthalenivorans CJ2]
 gi|120596634|gb|ABM40069.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 314

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 25/78 (32%), Gaps = 2/78 (2%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF--AASGAEEGTAQS 95
               L   +  A        + K +RE     Q  W   R  +C     A  A + TAQ 
Sbjct: 229 EEAQLAITQANAKINVAWNAISKIEREAMLPEQRVWLKRRELDCKTKGVAEQATDLTAQE 288

Query: 96  MIYANCLQGHAIERNEKL 113
            +   C      +R + L
Sbjct: 289 TVRLLCEVEMTQKRTDYL 306


>gi|221211561|ref|ZP_03584540.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221168922|gb|EEE01390.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 256

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 31/80 (38%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    +  ++A Y ++L+      +  +++SQ  W  +R  E     +
Sbjct: 45  SSTAGQIQCMNEAQQQWQAAMDAAYARLLKDAPADAKRGWQESQRRWLTWRKDEAQLLKA 104

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GT  +M  A+    
Sbjct: 105 VYDTTSGTMYTMASADMQLQ 124



 Score = 33.6 bits (75), Expect = 8.7,   Method: Composition-based stats.
 Identities = 9/43 (20%), Positives = 17/43 (39%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             +       L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 183 DAACEHAVFDLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDA 225


>gi|323170549|gb|EFZ56199.1| hypothetical protein ECLT68_4613 [Escherichia coli LT-68]
          Length = 95

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 32/79 (40%), Gaps = 4/79 (5%)

Query: 39  SFALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRG--SECAFAASGAEEGTAQ 94
           +     + L   YK+++   +  K  ++  +KSQ+ W  YR   ++        E+G+  
Sbjct: 2   AIKSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEQGSYW 61

Query: 95  SMIYANCLQGHAIERNEKL 113
            ++    +      +  +L
Sbjct: 62  GIVGTENIMNITKNKAIEL 80


>gi|225389082|ref|ZP_03758806.1| hypothetical protein CLOSTASPAR_02828 [Clostridium asparagiforme
           DSM 15981]
 gi|225044860|gb|EEG55106.1| hypothetical protein CLOSTASPAR_02828 [Clostridium asparagiforme
           DSM 15981]
          Length = 73

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 20/62 (32%)

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
             +L+K+ +         Q  W   R +      +    G+ + +     L     +R  
Sbjct: 1   NALLDKLNEEDAASLAAEQQEWMKSREARAVENNAKNNAGSLEGVGVTTSLTALTRDRAY 60

Query: 112 KL 113
           +L
Sbjct: 61  EL 62


>gi|167585796|ref|ZP_02378184.1| hypothetical protein BuboB_10698 [Burkholderia ubonensis Bu]
          Length = 256

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++A YK++L       +  +++SQ  W ++R  E     +
Sbjct: 45  SSTAGQIQCMGEAQQQWQTVMDAAYKRLLNDAPADAKRGWQESQRRWLMWRKDEAHLLKA 104

Query: 87  GAE--EGTAQSMIYANCLQGHAIE 108
             +   GT  +M  A+       E
Sbjct: 105 VYDTTRGTMYTMASADMQLQPVRE 128



 Score = 34.4 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 10/35 (28%), Positives = 15/35 (42%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H       +Q AW  YR +
Sbjct: 191 FDLNRYYQKLRRKMPAHSAATLVHAQRAWVAYRDA 225


>gi|161524042|ref|YP_001579054.1| hypothetical protein Bmul_0863 [Burkholderia multivorans ATCC
           17616]
 gi|189351197|ref|YP_001946825.1| hypothetical protein BMULJ_02395 [Burkholderia multivorans ATCC
           17616]
 gi|160341471|gb|ABX14557.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189335219|dbj|BAG44289.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 265

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 31/80 (38%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    +  ++A Y ++L+      +  +++SQ  W  +R  E     +
Sbjct: 54  SSTAGQIQCMNEAQQQWQAAMDAAYARLLKDAPADAKRGWQESQRRWLTWRKDEAQLLKA 113

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GT  +M  A+    
Sbjct: 114 VYDTTSGTMYTMASADMQLQ 133



 Score = 33.6 bits (75), Expect = 8.9,   Method: Composition-based stats.
 Identities = 9/43 (20%), Positives = 17/43 (39%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             +       L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 192 DAACEHAVFDLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDA 234


>gi|33862571|ref|NP_894131.1| hypothetical protein PMT0298 [Prochlorococcus marinus str. MIT
           9313]
 gi|33640684|emb|CAE20473.1| hypothetical [Prochlorococcus marinus str. MIT 9313]
          Length = 107

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/91 (12%), Positives = 24/91 (26%), Gaps = 14/91 (15%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                +M  C         +        +  ++     E        W+      CA A 
Sbjct: 28  GQNTLEMRYCASLDLEDSNK-------NLRSQLPAGTFER-------WQQTTKEVCAKAY 73

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +  ++GT    +   C         ++L+  
Sbjct: 74  APYKKGTIYPQVIIRCDDNLNRALLKELKGL 104


>gi|332969802|gb|EGK08813.1| hypothetical protein HMPREF9373_2297 [Psychrobacter sp. 1501(2011)]
          Length = 311

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           + K+  K  K  +   E  Q  W  +R   C   A GAE    Q ++   C+     +R 
Sbjct: 243 FNKLWGKASKEAQASIEYDQKEWVEWRDQVCVDEARGAEP-ARQEIVRMQCITRLLSDRY 301

Query: 111 EKLESYLT 118
            +++ Y  
Sbjct: 302 YEVKEYFD 309


>gi|187926083|ref|YP_001892428.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|241665571|ref|YP_002983930.1| hypothetical protein Rpic12D_4005 [Ralstonia pickettii 12D]
 gi|187727837|gb|ACD29001.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|240867598|gb|ACS65258.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 151

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 32/92 (34%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                 +  C     A   E+L+ TYK +L  +     +    S+ AW+ +     AF  
Sbjct: 55  PDNADAIGACLSAEKAAQNERLDRTYKTLLGTLNSKANDALVSSEQAWQDFHTRTAAFET 114

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +   +G    +           ER   L+ YL
Sbjct: 115 AIYGKGKLDDLQRLENEIFRLSERANALDKYL 146


>gi|238022328|ref|ZP_04602754.1| hypothetical protein GCWU000324_02235 [Kingella oralis ATCC 51147]
 gi|237866942|gb|EEP67984.1| hypothetical protein GCWU000324_02235 [Kingella oralis ATCC 51147]
          Length = 174

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 39/135 (28%), Gaps = 22/135 (16%)

Query: 1   MCR-KIIFALTIIAIAFQSMALNCNETLMQADMNQ-----------------CTGNSFAL 42
           M R   +F   ++  AF + A    +     +M+Q                 CT      
Sbjct: 42  MKRISTLFTAFLLVGAFAAPAF--AKEYSYPEMDQCFEQPEAQNGVTAAMLNCTNAEIDR 99

Query: 43  VKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
            + ++     K++ K    +    +K Q  W            +    GT   +  +   
Sbjct: 100 QETRMNNVLAKLVAK-HPKKAARLKKEQADWLRKMKRATRKEYTRT-GGTMDLLNGSGLA 157

Query: 103 QGHAIERNEKLESYL 117
                 R E LE  L
Sbjct: 158 LDMITARAEALEKRL 172


>gi|227114104|ref|ZP_03827760.1| probable secreted protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 265

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 23/77 (29%), Gaps = 6/77 (7%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMI 97
            F      L A +      +  + +   ++    W   +  +C    + A    + +   
Sbjct: 184 EFREADSALNAYW----SNLPDYIKGQLKEDARQWIKNKNKKCGAIETIANNNRSMEDQA 239

Query: 98  -YANCLQGHAIERNEKL 113
               C Q    ER  +L
Sbjct: 240 KIYTCQQQMTRERLVQL 256


>gi|124023752|ref|YP_001018059.1| hypothetical protein P9303_20581 [Prochlorococcus marinus str. MIT
           9303]
 gi|123964038|gb|ABM78794.1| hypothetical protein P9303_20581 [Prochlorococcus marinus str. MIT
           9303]
          Length = 116

 Score = 44.8 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 35/110 (31%), Gaps = 15/110 (13%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
             +  + +  ++    C       +++ C   +       LE+  K    +         
Sbjct: 18  LIIWAVLVPSKANEFKC-PGGNNYELSYCASQALKRSNSSLESQLKASTFE--------- 67

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                AW+   G  CA A +   +GT   ++   C +       E+++  
Sbjct: 68  -----AWKSAVGEVCAEAYAPYSQGTIYPLMLMRCDENLNQTLLEEMKGL 112


>gi|322835272|ref|YP_004215298.1| secreted protein [Rahnella sp. Y9602]
 gi|321170473|gb|ADW76171.1| putative secreted protein [Rahnella sp. Y9602]
          Length = 269

 Score = 44.4 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 28/80 (35%), Gaps = 6/80 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT--A 93
           + N++A     L   +K     +    +   +KSQ AW   +  +C   +    E T   
Sbjct: 189 SKNNYARSDRNLNDIWKS----LPDSIKTSMKKSQQAWVNEKALKCGKLSDADMEITPIQ 244

Query: 94  QSMIYANCLQGHAIERNEKL 113
             +   +C      ER   L
Sbjct: 245 NRINIYDCQTKMTNERIAFL 264


>gi|332097003|gb|EGJ01987.1| hypothetical protein SD15574_0831 [Shigella dysenteriae 155-74]
          Length = 103

 Score = 44.4 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 31/79 (39%), Gaps = 4/79 (5%)

Query: 39  SFALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRG--SECAFAASGAEEGTAQ 94
           +     + L   YK+++   +  K  ++  +KSQ+ W  YR   ++        E G+  
Sbjct: 10  AIKSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHGSYW 69

Query: 95  SMIYANCLQGHAIERNEKL 113
            ++    +      +  +L
Sbjct: 70  GIVGTENIMNITKNKAIEL 88


>gi|332094619|gb|EGI99665.1| hypothetical protein SB521682_0468 [Shigella boydii 5216-82]
          Length = 95

 Score = 44.4 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 31/79 (39%), Gaps = 4/79 (5%)

Query: 39  SFALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRG--SECAFAASGAEEGTAQ 94
           +     + L   YK+++   +  K  ++  +KSQ+ W  YR   ++        E G+  
Sbjct: 2   AIKSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHGSYW 61

Query: 95  SMIYANCLQGHAIERNEKL 113
            ++    +      +  +L
Sbjct: 62  GIVGTENIMNITKNKAIEL 80


>gi|186473758|ref|YP_001861100.1| hypothetical protein Bphy_4963 [Burkholderia phymatum STM815]
 gi|184196090|gb|ACC74054.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 209

 Score = 44.4 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 27/81 (33%), Gaps = 3/81 (3%)

Query: 41  ALVK-EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMI 97
           A    +        V     K  R+     Q  W   R ++C   A   GA +  A    
Sbjct: 122 AQADIKAANDAINVVWNAGSKEWRQSMLPEQRLWLAQRENDCKIKALDIGASDSVAYQTA 181

Query: 98  YANCLQGHAIERNEKLESYLT 118
             NC     ++R + L+S L 
Sbjct: 182 KLNCEVQMTVDRTQVLKSGLQ 202


>gi|13470742|ref|NP_102311.1| hypothetical protein mlr0530 [Mesorhizobium loti MAFF303099]
 gi|14021485|dbj|BAB48097.1| mlr0530 [Mesorhizobium loti MAFF303099]
          Length = 262

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 5/49 (10%), Positives = 18/49 (36%), Gaps = 2/49 (4%)

Query: 5  IIFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATY 51
          I+    +   + ++   + +C +  + A+   C     + +   +   Y
Sbjct: 32 ILAGGMLATPSARADGPSFDCAKASLPAEKAICADPQLSAIDLLVAKAY 80


>gi|238752831|ref|ZP_04614297.1| hypothetical protein yrohd0001_16060 [Yersinia rohdei ATCC 43380]
 gi|238708927|gb|EEQ01179.1| hypothetical protein yrohd0001_16060 [Yersinia rohdei ATCC 43380]
          Length = 294

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 25/77 (32%), Gaps = 6/77 (7%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY 98
           +FA     L   +      +   +R+    SQ  W   + + C   +    +   + M+ 
Sbjct: 223 AFANADSDLNTAW----STLTPVKRKELLPSQRQWIKTKDAMCGKVSMQGTDSEVKKMV- 277

Query: 99  ANCLQGHAIERNEKLES 115
            +C     + R     +
Sbjct: 278 -DCQTQMTLARTAFFRN 293


>gi|253689209|ref|YP_003018399.1| hypothetical protein PC1_2834 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755787|gb|ACT13863.1| hypothetical protein PC1_2834 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 265

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/77 (12%), Positives = 22/77 (28%), Gaps = 6/77 (7%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMI 97
            F      L A +      +  + +   ++    W   +  +C    +      + +   
Sbjct: 184 EFREADSALNAYW----SNLPDYIKGQLKEDARQWIKNKNKKCGAIETITNNNRSMEDQA 239

Query: 98  -YANCLQGHAIERNEKL 113
               C Q    ER  +L
Sbjct: 240 KIYTCQQQMTRERLVQL 256


>gi|262368394|ref|ZP_06061723.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316072|gb|EEY97110.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 214

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/118 (13%), Positives = 37/118 (31%), Gaps = 20/118 (16%)

Query: 1   MCRK-IIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M +  I+  L+ +  +F  +  ++C++    +    C+     + ++    +    L  +
Sbjct: 8   MKKFSILVCLSCLCTSFSYAQVIDCDDPTSSSFKKICSDQFKDIRQKLDTQSMTAFL--I 65

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               + L   +   W   R  +C                   C Q     R + L  Y
Sbjct: 66  SDAPQRLLVDTHQLWLN-RLQQCK---------------SLACYQQQIDFRIDDLNFY 107


>gi|156936185|ref|YP_001440101.1| hypothetical protein ESA_04084 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534439|gb|ABU79265.1| hypothetical protein ESA_04084 [Cronobacter sakazakii ATCC BAA-894]
          Length = 240

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 32/90 (35%), Gaps = 19/90 (21%)

Query: 33  NQCTGNSFALVKEKLEATYKKVL-EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
             C+ +  + + + L   YK  +   + +  +    KSQ+ W   R + C          
Sbjct: 1   MICSDHKLSRLDDYLSQNYKIAMGPDMPEEAKSKIRKSQIDWLNKRNA-CTD-------- 51

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLTCPE 121
                  A C++    ++ + L  +  C +
Sbjct: 52  -------AQCIERMYSKQMDYL--WNECFD 72


>gi|332533636|ref|ZP_08409496.1| hypothetical protein PH505_as00280 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036917|gb|EGI73377.1| hypothetical protein PH505_as00280 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 150

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 44/125 (35%), Gaps = 9/125 (7%)

Query: 1   MCRKII-FALTIIAIAFQSMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + II FA  I +    + + +       +   ++           K K+     ++  
Sbjct: 1   MKKIIIVFAFAISSFGAFAQSADGWPEGGAMHTGNI---YNLEGNRYKTKISKMMDEIYP 57

Query: 57  KVEKHQRELFEKSQ-MAWEIYRGSECAFAA-SGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           ++    +    K+Q  AWE Y  + C     +    G+  S     C +  + +R    +
Sbjct: 58  QLTDDYQVDAVKAQIKAWEQYIDATCNVVGIATGAGGSWPSTYSVKCERSLSYDRYFATK 117

Query: 115 SYLTC 119
           + L C
Sbjct: 118 NALKC 122


>gi|254249940|ref|ZP_04943260.1| Urocanate hydratase [Burkholderia cenocepacia PC184]
 gi|124876441|gb|EAY66431.1| Urocanate hydratase [Burkholderia cenocepacia PC184]
          Length = 138

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 35/106 (33%), Gaps = 3/106 (2%)

Query: 13  AIAFQSMALNCNETLMQAD-MNQC-TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
                   ++C +     + + +C        V     +  +K+ ++          KSQ
Sbjct: 26  GPVSAFAVVDCEQAGPTMEAVRRCVLDQQLQQVDSAYRSLARKLRQR-NPDAAAQLAKSQ 84

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +W  + G  C +  +   +    S  + NC    +  R   L+ +
Sbjct: 85  TSWAGFAGDTCDYVKTTNPQQMIPSDAWLNCWVDFSRARGRILKKW 130


>gi|160896341|ref|YP_001561923.1| hypothetical protein Daci_0892 [Delftia acidovorans SPH-1]
 gi|160361925|gb|ABX33538.1| conserved hypothetical protein [Delftia acidovorans SPH-1]
          Length = 147

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 38/109 (34%), Gaps = 12/109 (11%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA----- 72
           ++   C+    QA M  C     A   + L+   ++    + +   +    +Q       
Sbjct: 32  ALREECS-AHSQAGMRDCLARRLADSHKALKQAEEQAASALGQWDEDAKYAAQAKARLSA 90

Query: 73  ----WEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKLES 115
               +  YR ++C++ AS A    G A  +   +C       R  +L  
Sbjct: 91  SGKEFTQYRDAQCSWLASLAGGAAGNATEIRRLSCAAALNFGRAAQLRD 139


>gi|296102635|ref|YP_003612781.1| hypothetical protein ECL_02284 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057094|gb|ADF61832.1| hypothetical protein ECL_02284 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 189

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 23/76 (30%), Gaps = 19/76 (25%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           +    EKL + +K     +    R+    SQ  W  +  S C                  
Sbjct: 129 YKASDEKLNSVWKS----LSPETRKRLLPSQREWIKH-KSGCNNEQK------------- 170

Query: 100 NCLQGHAIERNEKLES 115
            CL      R  +LES
Sbjct: 171 -CLTDMTNNRIRELES 185


>gi|27376418|ref|NP_767947.1| hypothetical protein blr1307 [Bradyrhizobium japonicum USDA 110]
 gi|27349558|dbj|BAC46572.1| blr1307 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 28/80 (35%), Gaps = 2/80 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEK-LEATYKKVLEKVE 59
           M R++      +A+A +  + NC       +   C     A +  +   +  + + E   
Sbjct: 166 MARELERIGAQMAVAGK-PSFNCARAARAVEKAICGNRELADLDREIYGSHLRVIREAQS 224

Query: 60  KHQRELFEKSQMAWEIYRGS 79
             +    ++ Q  +   R S
Sbjct: 225 PAEARKIQREQDDFIARRNS 244


>gi|238799020|ref|ZP_04642480.1| hypothetical protein ymoll0001_32750 [Yersinia mollaretii ATCC
          43969]
 gi|238717117|gb|EEQ08973.1| hypothetical protein ymoll0001_32750 [Yersinia mollaretii ATCC
          43969]
          Length = 331

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 19/60 (31%), Gaps = 3/60 (5%)

Query: 20 ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
          A+NC   +   +   C+      + +     Y+ +L K +             WE    S
Sbjct: 23 AINCQRAVTPVEYTVCSNEDLHWLDQTFSDIYQAMLVKNDTETVYQQR---RVWESALNS 79


>gi|170691982|ref|ZP_02883146.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170143266|gb|EDT11430.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 237

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 38/91 (41%), Gaps = 2/91 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC   +    K  L+  ++++  +  + +R+ ++KSQ +W+  R ++    A+
Sbjct: 47  SSTAGQVQCMETARIGWKSALDNAWQQLQGESPQTRRKQWQKSQASWQASRDADTQLLAA 106

Query: 87  GAE--EGTAQSMIYANCLQGHAIERNEKLES 115
                 GT   +  A+       +R   L S
Sbjct: 107 VFATTRGTMYVLAAADMQLQPVRDRALVLRS 137


>gi|238028817|ref|YP_002913048.1| hypothetical protein bglu_1g32820 [Burkholderia glumae BGR1]
 gi|237878011|gb|ACR30344.1| Hypothetical protein bglu_1g32820 [Burkholderia glumae BGR1]
          Length = 126

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 24/81 (29%), Gaps = 15/81 (18%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
            C   +      ++   ++ +   V    R   + +Q AW   R + C  +         
Sbjct: 24  ICASRALREQDVEMAVRFEMLTGLVAMGTRGDMQDAQQAWRQ-RRAACGASR-------- 74

Query: 94  QSMIYANCLQGHAIERNEKLE 114
                  CL     +R   LE
Sbjct: 75  ------TCLAAAYRDRIAALE 89


>gi|167838647|ref|ZP_02465506.1| hypothetical protein Bpse38_19212 [Burkholderia thailandensis
          MSMB43]
          Length = 275

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 8/78 (10%), Positives = 19/78 (24%), Gaps = 7/78 (8%)

Query: 14 IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELF 66
             ++ + +C      A+   C   +      ++   Y+ +       +       R   
Sbjct: 22 PFARAASFDCARAASAAERAICRTPALGEQDVRMATYYELLQNARPADEGMAYREFRNAL 81

Query: 67 EKSQMAWEIYRGSECAFA 84
             Q  W       C   
Sbjct: 82 RDEQQNWRQRVRDACGAR 99


>gi|163750329|ref|ZP_02157570.1| ribose-5-phosphate isomerase A [Shewanella benthica KT99]
 gi|161330001|gb|EDQ00986.1| ribose-5-phosphate isomerase A [Shewanella benthica KT99]
          Length = 130

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 48/126 (38%), Gaps = 12/126 (9%)

Query: 1   MCRKIIFALTIIAIAFQ-SMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVL--- 55
           M   +I  + + AI    S +  C+ +   + D+  C  N     + +L+    +V    
Sbjct: 1   MKYSLILLIFVSAITVAKSQSEVCDSKYKSKYDVETCINNVVNEKRRELKVVLSEVNAIV 60

Query: 56  -----EKVEKHQRELFEKSQMAWEIYRGSECAFA--ASGAEEGTAQSMIYANCLQGHAIE 108
                  +     + F+  Q +++ Y  S C+    A GA  GT  ++    C +    +
Sbjct: 61  VAQEEYHISPGLSKEFKIEQESFQNYMNSHCSLYLGAIGANMGTGSAIFSLKCEEIILSQ 120

Query: 109 RNEKLE 114
           R E L 
Sbjct: 121 RIEALR 126


>gi|109290011|ref|YP_656260.1| hypothetical protein PHG25ORF027c [Aeromonas phage 25]
 gi|104345684|gb|ABF72584.1| hypothetical protein PHG25ORF027c [Aeromonas phage 25]
          Length = 227

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/120 (13%), Positives = 38/120 (31%), Gaps = 23/120 (19%)

Query: 2   CRKIIFALTIIAIAFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            + +  AL   A    + +L+C  + L   +   C     +L+ +++   +K V      
Sbjct: 1   MKALTIALLFAASTASAASLDCQVKNLNAIEKAICAVPEISLLDDQMAEAFKAVSH---- 56

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
                 +  Q A+   R +                    + L+ +  +R  +L+      
Sbjct: 57  --IPGVKVDQRAYIKTRNAS----------------TSLSELKDNMTDRIIELQIIAELE 98


>gi|89054514|ref|YP_509965.1| hypothetical protein Jann_2023 [Jannaschia sp. CCS1]
 gi|88864063|gb|ABD54940.1| hypothetical protein Jann_2023 [Jannaschia sp. CCS1]
          Length = 716

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 26/92 (28%), Gaps = 5/92 (5%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR- 77
            +  C       D   C     + +   +  TY      +  ++R L       W   R 
Sbjct: 170 PSFVCTNAATATDGAVCRDPEASTLDRTVADTYFAASSALSGNERILAHGQNENWHAGRL 229

Query: 78  ----GSECAFAASGAEEGTAQSMIYANCLQGH 105
                  C  A + A   + +++  ++     
Sbjct: 230 TCEQDLACIAAQAEAFLASLEAIAPSSAPTSM 261


>gi|16127216|ref|NP_421780.1| hypothetical protein CC_2986 [Caulobacter crescentus CB15]
 gi|221236017|ref|YP_002518454.1| hypothetical protein CCNA_03081 [Caulobacter crescentus NA1000]
 gi|13424618|gb|AAK24948.1| hypothetical protein CC_2986 [Caulobacter crescentus CB15]
 gi|220965190|gb|ACL96546.1| hypothetical protein CCNA_03081 [Caulobacter crescentus NA1000]
          Length = 171

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 27/98 (27%), Gaps = 3/98 (3%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS--QMAWEIYRGSE 80
           C       +   C          +L   YK  L  + K           Q AW ++R ++
Sbjct: 74  CLAEPGDQEPVDCALVECDFQDRRLNRAYKAALADLAKKPAAKAALIKAQRAWLVFRNAD 133

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                +        S         H   R ++LE  L 
Sbjct: 134 VDAVKAL-SGSPGPSFDALIRELEHTTRRAQELEDMLK 170


>gi|261820735|ref|YP_003258841.1| hypothetical protein Pecwa_1435 [Pectobacterium wasabiae WPP163]
 gi|261604748|gb|ACX87234.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 265

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 10/85 (11%), Positives = 23/85 (27%), Gaps = 7/85 (8%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF-AASGAEEGTAQSMI 97
            F     +L   +      +  + +   +     W   +  +C        +  + +   
Sbjct: 184 EFREADSELNTYWSS----LPDYIKGQLKGDARQWIKNKNKKCGAIETIANKPRSMEEHA 239

Query: 98  -YANCLQGHAIERNEKLESYLTCPE 121
               C Q    ER  +L   +   E
Sbjct: 240 KIYTCQQQMTKERLTQL-GLIKNKE 263


>gi|34495837|ref|NP_900052.1| hypothetical protein CV_0382 [Chromobacterium violaceum ATCC 12472]
 gi|34101692|gb|AAQ58060.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 224

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 29/98 (29%), Gaps = 15/98 (15%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE---KHQRELFEKSQMAWEIYR 77
            +C++     +   C  +    +  +LE  Y + L + E      +      Q  W    
Sbjct: 51  FHCDQPANMVESMVCQDDGLTRLDNRLEKVYSQALSQAEQSRSGAQAKLIAEQKRWVKSL 110

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +C                   CL    I R  +L++
Sbjct: 111 K-DCLKDEDP-----------HMCLGDTYILRVTQLQA 136


>gi|172061386|ref|YP_001809038.1| hypothetical protein BamMC406_2344 [Burkholderia ambifaria MC40-6]
 gi|171993903|gb|ACB64822.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 276

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 31/80 (38%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +
Sbjct: 57  SSTAGQIQCMGEAQQQWQTVMDRAYQRLSDDAPDDVKRGWQDSQRHWVTWRKDEIQLLKA 116

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GTA +M  A+    
Sbjct: 117 VYDTTRGTAYAMSSADMQLQ 136



 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 211 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDA 245


>gi|114569292|ref|YP_755972.1| hypothetical protein Mmar10_0741 [Maricaulis maris MCS10]
 gi|114339754|gb|ABI65034.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 132

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 23/57 (40%), Gaps = 1/57 (1%)

Query: 61  HQRELFEKSQMAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             R  F+ +Q AW  YR +EC+  A+       ++  I  +C       R  +L   
Sbjct: 76  GARAAFDTAQSAWLTYRDAECSRRAATMFLSADSREEITLDCQISLTRSRAHELAEL 132


>gi|238784594|ref|ZP_04628600.1| hypothetical protein yberc0001_33570 [Yersinia bercovieri ATCC
          43970]
 gi|238714463|gb|EEQ06469.1| hypothetical protein yberc0001_33570 [Yersinia bercovieri ATCC
          43970]
          Length = 329

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 19/60 (31%), Gaps = 3/60 (5%)

Query: 20 ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
          A+NC   +   +   C+      + +     Y+ +L K +             WE    S
Sbjct: 21 AINCQRAVTPVEYTVCSNEDLHWLDQTFSEIYQVMLIKYDTEIVYQQR---RVWEKALNS 77


>gi|115352529|ref|YP_774368.1| hypothetical protein Bamb_2478 [Burkholderia ambifaria AMMD]
 gi|115282517|gb|ABI88034.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 267

 Score = 43.2 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 31/80 (38%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +
Sbjct: 48  SSTAGQIQCMGEAQQQWQTVMDRAYQRLSDDAPADVKRGWQDSQRHWVTWRKDEIQLLKA 107

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GTA +M  A+    
Sbjct: 108 VYDTTRGTAYAMSSADMQLQ 127



 Score = 34.4 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             L   Y+K+  K+  H      ++Q AW  +R +
Sbjct: 202 FDLNRYYQKLRRKMPAHSAATLVRAQRAWVTFRDA 236


>gi|227326754|ref|ZP_03830778.1| hypothetical protein PcarcW_05304 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 141

 Score = 42.8 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 34  QCTGNSFALVKEKLEATYKK----VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           +C         +KL     +    +++  +    + F+K Q +WE Y+   C +  SG E
Sbjct: 50  ECAYLMVKESDKKLNKRLSERTLELVKINDNDIIKAFKKHQRSWERYKKDRCTYVTSGTE 109

Query: 90  EGTAQSMIYAN-CLQGHAIERNEKLES 115
           + +A    + N C       R E LE 
Sbjct: 110 KDSAAYQFHLNLCNATENYRRIETLED 136


>gi|227328690|ref|ZP_03832714.1| probable secreted protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 265

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 25/78 (32%), Gaps = 8/78 (10%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF---AASGAEEGTAQS 95
            F      L A +      +  + +   ++    W   +  +C      AS       Q+
Sbjct: 184 EFREADSALNAYWSS----LPDYIKGQMKEDARQWIKNKNKQCGAIETVASKNRSLEDQA 239

Query: 96  MIYANCLQGHAIERNEKL 113
            IY  C Q    ER  +L
Sbjct: 240 KIY-TCQQQMTKERLIQL 256


>gi|330879866|gb|EGH14015.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 46

 Score = 42.8 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           A    + G+   ++ + CL      R ++L++Y+ C E    CP
Sbjct: 4   AGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE--EGCP 45


>gi|295095862|emb|CBK84952.1| Protein of unknown function (DUF1311) [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 280

 Score = 42.8 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 38/107 (35%), Gaps = 8/107 (7%)

Query: 10  TIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
           +I A+A  +M  +   +  +   +N     +++    +L   +    + +    +   +K
Sbjct: 171 SIAAMATLAMNKDELQKAELNNKLNI-AARNYSDSDRQLNELW----KYLPDSVKASMKK 225

Query: 69  SQMAWEIYRGSECAFAASGAEEGT--AQSMIYANCLQGHAIERNEKL 113
            Q  W   +  +C   +  +   T  A  +   +C      ER   L
Sbjct: 226 EQNMWINEKAKKCGKISDASSATTPLATRIGIYDCQTKMTDERFRYL 272


>gi|225024048|ref|ZP_03713240.1| hypothetical protein EIKCOROL_00915 [Eikenella corrodens ATCC
           23834]
 gi|224943073|gb|EEG24282.1| hypothetical protein EIKCOROL_00915 [Eikenella corrodens ATCC
           23834]
          Length = 396

 Score = 42.4 bits (98), Expect = 0.018,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 26/85 (30%), Gaps = 1/85 (1%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIY 98
                ++      K  + +    R   + +Q  W   R S+CA+ +         Q  + 
Sbjct: 228 LRTQNKQAHDELNKAWQALPAAARTQLKDAQNQWNRLRESQCAYQSKADSTEPLEQEALR 287

Query: 99  ANCLQGHAIERNEKLESYLTCPEGD 123
             C      +R   L+       G+
Sbjct: 288 IECDTREVQQRIPALKQEAEAFTGN 312


>gi|331087154|ref|ZP_08336225.1| hypothetical protein HMPREF0987_02528 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330409123|gb|EGG88580.1| hypothetical protein HMPREF0987_02528 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 292

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 10/81 (12%), Positives = 22/81 (27%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA-Q 94
               + L    L   + ++   +   +       Q++W   + +     A+  +  T   
Sbjct: 211 AQGRYELWDNLLNELWAELEAVLPGAELGNLTDEQVSWIQQKEA---MIANYWQGTTIDH 267

Query: 95  SMIYANCLQGHAIERNEKLES 115
           S            ER   L  
Sbjct: 268 SSFPNGPAADMTKERVYYLRG 288


>gi|148239209|ref|YP_001224596.1| hypothetical protein SynWH7803_0873 [Synechococcus sp. WH 7803]
 gi|147847748|emb|CAK23299.1| Hypothetical protein SynWH7803_0873 [Synechococcus sp. WH 7803]
          Length = 139

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 43/131 (32%), Gaps = 20/131 (15%)

Query: 4   KIIFALTI--IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ A ++  +       +  C+ T    +   C   +   + ++LE   + V  +    
Sbjct: 8   PLVLAASLWSLQPLPTRASEVCSSTKSTVEETGCVIAALKAMDQRLEQALEAVALEARAV 67

Query: 62  QRELFE------------------KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
             E+F+                      A+   R   CA+A S A +GT   +    C  
Sbjct: 68  PSEVFQTLWRDNLTGFYKTSADPVDQAAAFRNERRKVCAYAKSVAFQGTGYGIFTTRCEL 127

Query: 104 GHAIERNEKLE 114
                  ++L+
Sbjct: 128 ALTQTLLDQLK 138


>gi|303327569|ref|ZP_07358010.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862509|gb|EFL85442.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
          Length = 181

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 11/95 (11%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
               +   M  C       +++ +     +++  + + + +    +  AWE  R +  + 
Sbjct: 83  AAAGITVPMQDCMNAEVERLEKHMAEQRARLVPILSEERAKALNDALEAWENLRKNGSSA 142

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                + GT  ++I +          +  L+  L 
Sbjct: 143 MYD-PDGGTLATVISSLWYLEQTARMSRWLDDMLN 176


>gi|187933848|ref|YP_001886075.1| lipoprotein [Clostridium botulinum B str. Eklund 17B]
 gi|187722001|gb|ACD23222.1| putative lipoprotein [Clostridium botulinum B str. Eklund 17B]
          Length = 327

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 36/96 (37%), Gaps = 8/96 (8%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C  +    ++     +++    + +   +  + +++ + +     K +M W   + + C 
Sbjct: 240 CIISSNNLEL---ANSTYMKFNDLINRLWTDLKKQLPEDEYNKLLKDEMNWIETKLNNC- 295

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              S  + GT +  I A        ER   L +YL 
Sbjct: 296 -PTSDDDNGTFEDKIGA---IKMTDERIGILLNYLN 327


>gi|156933833|ref|YP_001437749.1| hypothetical protein ESA_01659 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532087|gb|ABU76913.1| hypothetical protein ESA_01659 [Cronobacter sakazakii ATCC BAA-894]
          Length = 146

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 35/111 (31%), Gaps = 5/111 (4%)

Query: 8   ALTIIAIAFQS--MALNCNETL---MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +    A   Q+   +  C E       + + Q        ++      + +  E      
Sbjct: 27  SAAAEACTQQAGENSGECLEAAGLASDSALKQAFNAKVTELQNFDYTRWPQGDEARRTQM 86

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            E  + SQ  W   R + C  A++ A      +    +C+      R E+L
Sbjct: 87  VEALKISQQQWTDARDAFCTAASASAAGTPWLAAHALSCVINMNQRRVEEL 137


>gi|300023901|ref|YP_003756512.1| hypothetical protein Hden_2394 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525722|gb|ADJ24191.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 127

 Score = 42.1 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 10/94 (10%), Positives = 29/94 (30%), Gaps = 2/94 (2%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQRELFEKSQMAWE 74
             +   +C    M ++   C  +    + EK+   Y ++ +    + +R+  ++ Q  + 
Sbjct: 31  ANAQEFDCRRAGMASERTICRSDVLGALDEKMSGLYAELKQSYGRRSERDQLKRYQRQFL 90

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             R  +C       +      +            
Sbjct: 91  AARN-DCGRDTECIKGAYLDQIGVLQAQIERNNR 123


>gi|325663637|ref|ZP_08152044.1| hypothetical protein HMPREF0490_02785 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470323|gb|EGC73555.1| hypothetical protein HMPREF0490_02785 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 292

 Score = 42.1 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 11/95 (11%), Positives = 25/95 (26%), Gaps = 7/95 (7%)

Query: 24  NETLMQAD--MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
                  +  M+      + L    L   + ++   +   +       Q++W   + +  
Sbjct: 198 ASAGDSVERQMSI-AQGRYELWDNLLNELWAELEAVLPGAELGNLTDEQVSWIQQKEA-- 254

Query: 82  AFAASGAEEGTA-QSMIYANCLQGHAIERNEKLES 115
              A+  +  T   S            ER   L  
Sbjct: 255 -MIANYWQGTTIDHSSFPNGPAADMTKERVYYLRG 288


>gi|318041923|ref|ZP_07973879.1| hypothetical protein SCB01_09439 [Synechococcus sp. CB0101]
          Length = 143

 Score = 42.1 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 15/105 (14%), Positives = 37/105 (35%), Gaps = 20/105 (19%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--------------- 65
           ++C++     +++ CT  +      +L+   + V +   +                    
Sbjct: 31  IDCSQAFSTVELSVCTRANLERKDAELKQAMQAVAKDAAEMPGGTFLPIWTDSLTGFFNT 90

Query: 66  ----FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
                ++ + A++  R + C +  S A +GT   +  ANC     
Sbjct: 91  TTDPLKQFE-AFKAARATACVYMNSLALQGTGFGIFVANCEIKLT 134


>gi|319762420|ref|YP_004126357.1| hypothetical protein Alide_1717 [Alicycliphilus denitrificans BC]
 gi|317116981|gb|ADU99469.1| hypothetical protein Alide_1717 [Alicycliphilus denitrificans BC]
          Length = 314

 Score = 42.1 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 28/83 (33%), Gaps = 9/83 (10%)

Query: 33  NQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT 92
             C     +L+ ++L   Y K+    +        + Q  W  YR S C          +
Sbjct: 217 AVCAHIDISLLDQELNTLYSKIQ---KGGAPSDLAEEQERWRRYRNS-CINDRQPNGYAS 272

Query: 93  AQSMIYANCLQGHAIERNEKLES 115
                  NC++     R ++L S
Sbjct: 273 I-----VNCVRESYTVRRDQLMS 290


>gi|88859913|ref|ZP_01134552.1| putative orphan protein [Pseudoalteromonas tunicata D2]
 gi|88817907|gb|EAR27723.1| putative orphan protein [Pseudoalteromonas tunicata D2]
          Length = 135

 Score = 42.1 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 37/120 (30%), Gaps = 11/120 (9%)

Query: 6   IFALTIIAIAFQSMALN-CNETLMQADMNQ-CTGNSFALVKEKLEATYKKVLEKVEKHQR 63
              L  I+   Q+   + C+           C  N     +   +    K+   +EK Q 
Sbjct: 14  FLVLANISTVAQAAFNDGCDNDKSTNPRYIRCLENKITEQQNIAQTWRNKIEFDLEKKQN 73

Query: 64  EL--------FEKSQMAWEIYRGSECAFAASGAEEGTAQS-MIYANCLQGHAIERNEKLE 114
           E         F +++  +  Y    C +        T  + + Y  C      +R E L+
Sbjct: 74  ETGNVQLLKVFTRAEQEFVKYVEDSCRWRYLDLLPDTIAATITYKRCELQLNQQRVEGLK 133


>gi|295680436|ref|YP_003609010.1| hypothetical protein BC1002_5576 [Burkholderia sp. CCGE1002]
 gi|295440331|gb|ADG19499.1| hypothetical protein BC1002_5576 [Burkholderia sp. CCGE1002]
          Length = 162

 Score = 42.1 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 34/136 (25%), Gaps = 21/136 (15%)

Query: 1   MCRKIIFALTIIAIAF--QSMALN--------CNETLMQADMNQCTGNSFALVKEKLEAT 50
           M R      T +       +MA          C      A    C        + +L A 
Sbjct: 17  MSRSAALVGTWLFCPTIQSAMATEKAETMYQQCRSQQSTARQRDCYPAVLRQAEIELAAA 76

Query: 51  YKKVLEKVEK-----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
             +    + +           H    F+++   +  +R +E     +    G    +   
Sbjct: 77  GNEARADLVELESISEGSRAVHPVLAFDEAARDFGAFRDAESRRVRASYGSGNGGDLAAY 136

Query: 100 NCLQGHAIERNEKLES 115
                  I R  +L  
Sbjct: 137 ATSIEMTIARARQLAG 152


>gi|15891993|ref|NP_359707.1| hypothetical protein RC0070 [Rickettsia conorii str. Malish 7]
 gi|34222966|sp|Q92JJ7|Y070_RICCN RecName: Full=Uncharacterized protein RC0070
 gi|15619107|gb|AAL02608.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 51

 Score = 41.3 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 96  MIYANCLQGHAIERN---EKLESYLTCPEGDLLCPFI 129
           MI   CL  +   R    ++ E+ L C EGDL CPFI
Sbjct: 1   MILLMCLTSYRKNRRAYKKEFEAMLKCEEGDLSCPFI 37


>gi|167741192|ref|ZP_02413966.1| hypothetical protein Bpse14_24206 [Burkholderia pseudomallei 14]
          Length = 112

 Score = 41.3 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 27/104 (25%), Gaps = 21/104 (20%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-------RELFE 67
           + ++ + +C      A+   C   +   +  ++ A Y+ +       +       R+   
Sbjct: 23  SARAASFDCAHAANAAERAICGTPALGELDVRMAAYYEMLQNARPADEGMAYREFRDALR 82

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
             Q  W       C                  +CL      R  
Sbjct: 83  DEQQRWRQRTRDACGA--------------RIDCLTNAYTARIA 112


>gi|156936291|ref|YP_001440207.1| hypothetical protein ESA_04191 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534545|gb|ABU79371.1| hypothetical protein ESA_04191 [Cronobacter sakazakii ATCC BAA-894]
          Length = 152

 Score = 41.3 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 42/130 (32%), Gaps = 20/130 (15%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ----- 62
            +   +I +   A  C ++   A   +C        ++ L+ T    L++V+        
Sbjct: 18  CVAASSIIYGEAAKMCAKSADYAAGTRCLERQRKQTEQALQQTLAAALKQVQSEDWLEAN 77

Query: 63  --------------RELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAI 107
                                Q AWE ++   C  A+S     T    ++   C      
Sbjct: 78  ADYEDEDSQIVVDTANALRGDQAAWEKHKALFCQVASSQISAKTPNYWVLSTQCEINMNK 137

Query: 108 ERNEKLESYL 117
            R ++L++ +
Sbjct: 138 ARIDELKALM 147


>gi|172064075|ref|YP_001811726.1| hypothetical protein BamMC406_5064 [Burkholderia ambifaria MC40-6]
 gi|171996592|gb|ACB67510.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 100

 Score = 41.3 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 32/98 (32%), Gaps = 4/98 (4%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           +  C  +      +    + ++ L++          KSQ +W  + G  C +  +   + 
Sbjct: 4   VRACVVDRNQQEVDSAYRSLERTLKRRNPDAAGELAKSQASWTRFAGDTCNYVKAANPQQ 63

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
              S  + NC    +  R   L+ +    E     P  
Sbjct: 64  MIPSDAWMNCWVDFSQARVRILKKW----EALENAPQP 97


>gi|196232497|ref|ZP_03131350.1| hypothetical protein CfE428DRAFT_4517 [Chthoniobacter flavus
           Ellin428]
 gi|196223569|gb|EDY18086.1| hypothetical protein CfE428DRAFT_4517 [Chthoniobacter flavus
           Ellin428]
          Length = 307

 Score = 41.3 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 20/81 (24%), Gaps = 16/81 (19%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
                   ++L A YK V   +   +    +  Q  W     ++ + A            
Sbjct: 242 EEKLKWFDDRLNAVYKAVRAVLPAKRFAALKNEQRDWVKQLEAQKSPADK---------- 291

Query: 97  IYANCLQGHAIERNEKLESYL 117
                       R  +L   L
Sbjct: 292 ------IKLMRPRIAQLRDLL 306


>gi|259909753|ref|YP_002650109.1| hypothetical protein EpC_31280 [Erwinia pyrifoliae Ep1/96]
 gi|224965375|emb|CAX56907.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
 gi|283479844|emb|CAY75760.1| hypothetical protein EPYR_03380 [Erwinia pyrifoliae DSM 12163]
          Length = 330

 Score = 41.3 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 26/85 (30%), Gaps = 3/85 (3%)

Query: 12 IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ- 70
          IA    ++AL+C   L  A+   C       +       + + +    +H        Q 
Sbjct: 16 IAAVNPALALDCGRNLSVAEYTVCNNPQLLWLDRLYNEAFHQRVTDDPQHAARFIAPRQG 75

Query: 71 MAWEIYRGSECAFAASGAEEGTAQS 95
           +W     + C   A   + G    
Sbjct: 76 SSWCT--NTRCLRGAYLKQIGQLYG 98


>gi|209518218|ref|ZP_03267045.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209501333|gb|EEA01362.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 80

 Score = 41.3 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 2/57 (3%)

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKLES 115
             +         +  YR ++C FAAS +    G A  M    C+      R E+L  
Sbjct: 17  QAKAKLVALDRKFAEYRETQCEFAASLSGGGAGNAHEMGRLACVSELNNWRAEQLRD 73


>gi|237750278|ref|ZP_04580758.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229374172|gb|EEO24563.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 231

 Score = 40.9 bits (94), Expect = 0.052,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 31/116 (26%), Gaps = 25/116 (21%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-----------------RELFEKS 69
                +       +    + L   YK    +V+K                   ++   + 
Sbjct: 94  GSTQGILASLNYGYDEYDKLLNKYYKLYRAEVKKQNKTTPTGAFSHEPSIQKGQDTLLEE 153

Query: 70  QMAWEIYRG-------SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYL 117
           Q AW   R        +  A        GT  S+  +N   G    R  +L   YL
Sbjct: 154 QRAWLKLRDSYEAYTKAHHAHIYDINGGGTIYSIEASNARLGLLKMRVNELFSRYL 209


>gi|119386343|ref|YP_917398.1| hypothetical protein Pden_3635 [Paracoccus denitrificans PD1222]
 gi|119376938|gb|ABL71702.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 154

 Score = 40.9 bits (94), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 30/87 (34%), Gaps = 7/87 (8%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C   S    + KL A Y+  LE      +E   + + +W  +R   C  A       
Sbjct: 73  MANCLDASHQAWEVKLTAVYQAALEG--GEAQETLRRVERSWIDFREILCERARE----- 125

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   + +  C++     +   L S   
Sbjct: 126 TGGDLAHGRCIRDETARQAALLTSLAE 152


>gi|260598090|ref|YP_003210661.1| hypothetical protein CTU_22980 [Cronobacter turicensis z3032]
 gi|260217267|emb|CBA31202.1| unknown protein [Cronobacter turicensis z3032]
          Length = 146

 Score = 40.9 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 38/115 (33%), Gaps = 20/115 (17%)

Query: 17  QSMALNCNETLMQADMN--QCTGNSFALVKEKLEATYKKVLEKVEKHQR----------- 63
            + A  C +   QA  N  +C   +      +L+  +   + +++               
Sbjct: 27  SAAADACGQ---QAGENGSECLEAAGLESDNQLKQAFNAKVTELQNFDYTRWPQGDEARR 83

Query: 64  ----ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
               E  + SQ  W   R + C  A++ A      +    +C+      R ++L 
Sbjct: 84  TQMVEALKLSQQQWTDARDAFCTAASASAAGTPWLAAHALSCVINMNQRRVQELA 138


>gi|325124279|gb|ADY83802.1| hypothetical protein BDGL_003216 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 347

 Score = 40.9 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 29/108 (26%), Gaps = 22/108 (20%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG--- 87
           +            K K      +  +K+   ++  F++ Q  W   R  EC   A     
Sbjct: 239 EAMDVRKKELDSDKAKQVERLNQTWDKLSAEKKIQFKQDQSDWFKKRDVECKVLAQKTVD 298

Query: 88  ---------AEEGTAQ----------SMIYANCLQGHAIERNEKLESY 116
                     ++ +             M Y  C     IER   L + 
Sbjct: 299 EIPEKDLETYQKQSDYWTADMRKQNQDMQYTQCFTQKTIERTVYLNNL 346


>gi|167648447|ref|YP_001686110.1| hypothetical protein Caul_4492 [Caulobacter sp. K31]
 gi|167350877|gb|ABZ73612.1| uncharacterized membrane-bound protein [Caulobacter sp. K31]
          Length = 236

 Score = 40.9 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 30/117 (25%), Gaps = 20/117 (17%)

Query: 9   LTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +    +A  S AL+    C +    A    C   +      ++                 
Sbjct: 123 VVAAPLADASPALDDTAGCRDAATLAAQMTCIDPALREADLRM--AAAYDAVLAAGVSPA 180

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
              +SQ  W   R      A +  E+           L      R  +L S+    E
Sbjct: 181 DLGRSQARWLTTRD---EAAKASPED-----------LLAAYQLRESQLRSFAVAVE 223


>gi|33862552|ref|NP_894112.1| hypothetical protein PMT0279 [Prochlorococcus marinus str. MIT
           9313]
 gi|33640665|emb|CAE20454.1| hypothetical [Prochlorococcus marinus str. MIT 9313]
          Length = 108

 Score = 40.5 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 37/111 (33%), Gaps = 16/111 (14%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +   T++  + ++    C       +++ C   +      +LE+  K    +V       
Sbjct: 10  LLIWTVLVPS-KANEFKC-PGDNNYELSYCASQALKRSNSRLESQLKASTFEV------- 60

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                  W+   G  CA A +   +GT   ++   C         E+++  
Sbjct: 61  -------WKSAIGEVCAEAYAAYSQGTIYPLMIMRCDDNLNQTLLEEMKEL 104


>gi|329120141|ref|ZP_08248811.1| hypothetical protein HMPREF9123_2242 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327463672|gb|EGF09990.1| hypothetical protein HMPREF9123_2242 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 147

 Score = 40.5 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 47/133 (35%), Gaps = 22/133 (16%)

Query: 8   ALTIIAIAFQSMALN----------C-NETLMQADMNQC----TGNSFALVKEKLEATYK 52
            L  +  +  + A            C +    Q D+  C       S  + +     T  
Sbjct: 11  VLLFLFASANAFADAMPLEHTIRDACSDRHFAQVDVQACIKQNADRSETVWQNAQAQTIA 70

Query: 53  KVLEKVEKHQR-----ELFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGH 105
           K+ +  E+ +      + +  ++ ++  YR   C +AAS      GTA++M    C+   
Sbjct: 71  KIKQWDEEQRYKDAALQKYAAAEQSFAAYRNRYCDWAASLGGGAIGTARTMRKNACIAEQ 130

Query: 106 AIERNEKLESYLT 118
                ++++  + 
Sbjct: 131 NRTHAKQVQEIMK 143


>gi|167823197|ref|ZP_02454668.1| hypothetical protein Bpseu9_05938 [Burkholderia pseudomallei 9]
          Length = 103

 Score = 40.5 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 13/72 (18%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
             +   Y+K+  ++          +Q  W  +R +                ++  +    
Sbjct: 38  FDMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVD 84

Query: 105 HAIERNEKLESY 116
               R   L+ +
Sbjct: 85  LIGARVATLKRF 96


>gi|15829467|ref|NP_308240.1| hypothetical protein ECs0213 [Escherichia coli O157:H7 str. Sakai]
 gi|189403368|ref|ZP_03007060.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|13359669|dbj|BAB33636.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|189361062|gb|EDU79481.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|320654633|gb|EFX22634.1| hypothetical protein ECO7815_10252 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|326338806|gb|EGD62625.1| hypothetical protein ECoA_04867 [Escherichia coli O157:H7 str.
           1044]
 gi|326342402|gb|EGD66182.1| hypothetical protein ECF_02911 [Escherichia coli O157:H7 str. 1125]
          Length = 149

 Score = 40.5 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 46/135 (34%), Gaps = 22/135 (16%)

Query: 2   CRKIIFALTIIAIAFQSMALN------CNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
            RKI   L +     + +A +      C+  + + +   C  NSF +    L+     + 
Sbjct: 1   MRKITIILLLTFSCTKGLAFDISMSKECS-GVDELEFIDCVKNSFIMSTITLKKAEANIK 59

Query: 56  EKVEKHQREL--------------FEKSQMAWEIYRGSECAF-AASGAEEGTAQSMIYAN 100
           EK++K   +                E S   +  YR ++C+F    GA  G         
Sbjct: 60  EKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLTWGARVGRLAFSRLYP 119

Query: 101 CLQGHAIERNEKLES 115
           C       R  +L +
Sbjct: 120 CYTELNKIRAMQLNN 134


>gi|310766379|gb|ADP11329.1| conserved uncharacterized protein [Erwinia sp. Ejp617]
          Length = 330

 Score = 40.5 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 26/85 (30%), Gaps = 3/85 (3%)

Query: 12 IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ- 70
          IA    ++AL+C   L  A+   C       +       + + +    +H        Q 
Sbjct: 16 IAAVNPALALDCGRNLSVAEYTVCNNPQLLWLDRLYNEAFHQRVTDDPQHAARFVAPRQG 75

Query: 71 MAWEIYRGSECAFAASGAEEGTAQS 95
           +W     + C   A   + G    
Sbjct: 76 SSWCT--NTRCLRGAYLKQIGQLYG 98


>gi|170750664|ref|YP_001756924.1| hypothetical protein Mrad2831_4274 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657186|gb|ACB26241.1| hypothetical protein Mrad2831_4274 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 283

 Score = 40.5 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 10/99 (10%), Positives = 24/99 (24%), Gaps = 21/99 (21%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EKHQRELFEKSQMA 72
            A +C     + +   C   +   + ++L   + +++ +            + F +    
Sbjct: 43  AAPDCAGCRGRVETLICADPALTRLDDELRRLFDRIVGETRGVDGETGQAIDTFGEDHAR 102

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           W       C                   CL      R  
Sbjct: 103 WRARVRDACPD---------------TACLTRAYTARIA 126


>gi|320660201|gb|EFX27711.1| hypothetical protein ECO5905_08768 [Escherichia coli O55:H7 str.
           USDA 5905]
          Length = 151

 Score = 40.5 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 46/135 (34%), Gaps = 22/135 (16%)

Query: 2   CRKIIFALTIIAIAFQSMALN------CNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
            RKI   L +     + +A +      C+  + + +   C  NSF +    L+     + 
Sbjct: 3   MRKITIILLLTFSCTKGLAFDISMSKECS-GVDELEFIDCVKNSFVMSTITLKKAEANIK 61

Query: 56  EKVEKHQREL--------------FEKSQMAWEIYRGSECAF-AASGAEEGTAQSMIYAN 100
           EK++K   +                E S   +  YR ++C+F    GA  G         
Sbjct: 62  EKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLTWGARVGRLAFSRLYP 121

Query: 101 CLQGHAIERNEKLES 115
           C       R  +L +
Sbjct: 122 CYTELNKIRAMQLNN 136


>gi|282896046|ref|ZP_06304074.1| hypothetical protein CRD_00426 [Raphidiopsis brookii D9]
 gi|281199061|gb|EFA73934.1| hypothetical protein CRD_00426 [Raphidiopsis brookii D9]
          Length = 75

 Score = 40.5 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 9  LTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
            +I     ++A   +C + + QA +NQC   +     +KL   Y KVL
Sbjct: 20 ALLIGTGTSAIAQFSDCQKAVTQAQLNQCAAINAKTADQKLNDAYNKVL 68


>gi|257126328|ref|YP_003164442.1| hypothetical protein Lebu_1579 [Leptotrichia buccalis C-1013-b]
 gi|257050267|gb|ACV39451.1| hypothetical protein Lebu_1579 [Leptotrichia buccalis C-1013-b]
          Length = 200

 Score = 40.1 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 29/80 (36%), Gaps = 5/80 (6%)

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-----EGTAQS 95
             + ++L   Y  ++ ++ + ++  F   Q  W   R  +   + +G +      G A +
Sbjct: 115 EKLDDELTKVYNLIMARLSESEKIEFRNKQRQWLKIRTKKVENSNNGEDGNPGMGGRAGA 174

Query: 96  MIYANCLQGHAIERNEKLES 115
            +     Q    +R  +   
Sbjct: 175 NVEIITYQEFTKDRLIEFAK 194


>gi|144898196|emb|CAM75060.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 340

 Score = 40.1 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 24/77 (31%), Gaps = 10/77 (12%)

Query: 46  KLEATYKKVLEKV-----EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
           +L   YK+V+                   Q AW  YR +  AF  +       Q++I   
Sbjct: 265 ELNRVYKRVMAHDFGEYGGAPSPAAIRGVQRAWLKYRDAWVAFVKAAGPGLPPQAVINLQ 324

Query: 101 CLQGHAIERNEKLESYL 117
                   R  +L   L
Sbjct: 325 -----TRHRIAQLLELL 336


>gi|15799894|ref|NP_285906.1| hypothetical protein Z0245 [Escherichia coli O157:H7 EDL933]
 gi|195938590|ref|ZP_03083972.1| hypothetical protein EscherichcoliO157_19537 [Escherichia coli
           O157:H7 str. EC4024]
 gi|254791345|ref|YP_003076182.1| hypothetical protein ECSP_0218 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223751|ref|ZP_05938032.1| hypothetical protein EscherichiacoliO157_03976 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255839|ref|ZP_05948372.1| hypothetical protein EscherichiacoliO157EcO_08408 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281035|ref|YP_003497853.1| hypothetical protein G2583_0223 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293413473|ref|ZP_06656122.1| hypothetical protein ECDG_00012 [Escherichia coli B185]
 gi|12512948|gb|AAG54514.1|AE005197_3 hypothetical protein Z0245 [Escherichia coli O157:H7 str. EDL933]
 gi|254590745|gb|ACT70106.1| predicted protein [Escherichia coli O157:H7 str. TW14359]
 gi|290760908|gb|ADD54869.1| hypothetical protein G2583_0223 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291433531|gb|EFF06504.1| hypothetical protein ECDG_00012 [Escherichia coli B185]
 gi|320638238|gb|EFX07966.1| hypothetical protein ECO5101_15280 [Escherichia coli O157:H7 str.
           G5101]
 gi|320643622|gb|EFX12766.1| hypothetical protein ECO9389_15454 [Escherichia coli O157:H- str.
           493-89]
 gi|320650358|gb|EFX18835.1| hypothetical protein ECO2687_15001 [Escherichia coli O157:H- str. H
           2687]
 gi|320665452|gb|EFX32514.1| hypothetical protein ECOSU61_12480 [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 151

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 46/135 (34%), Gaps = 22/135 (16%)

Query: 2   CRKIIFALTIIAIAFQSMALN------CNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
            RKI   L +     + +A +      C+  + + +   C  NSF +    L+     + 
Sbjct: 3   MRKITIILLLTFSCTKGLAFDISMSKECS-GVDELEFIDCVKNSFIMSTITLKKAEANIK 61

Query: 56  EKVEKHQREL--------------FEKSQMAWEIYRGSECAF-AASGAEEGTAQSMIYAN 100
           EK++K   +                E S   +  YR ++C+F    GA  G         
Sbjct: 62  EKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLTWGARVGRLAFSRLYP 121

Query: 101 CLQGHAIERNEKLES 115
           C       R  +L +
Sbjct: 122 CYTELNKIRAMQLNN 136


>gi|156935156|ref|YP_001439072.1| hypothetical protein ESA_03007 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533410|gb|ABU78236.1| hypothetical protein ESA_03007 [Cronobacter sakazakii ATCC BAA-894]
          Length = 153

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 48/147 (32%), Gaps = 40/147 (27%)

Query: 5   IIFALTIIAIAFQSMAL-------NC-------NETLMQADMNQCTGNSFALVKEKLEAT 50
           ++ A+  I  A  +++         C        +   Q++   C   +     E L  T
Sbjct: 7   LLIAVPFIPAAALAVSFQFGKELAPCFSLPEYAEDGKSQSE---CKAQARERSDEALSKT 63

Query: 51  YKKVLEKVEKHQRELFE------------------KSQMAWEIYRGSECAFAASGAEEGT 92
            +++ + ++K+    F+                  +SQ  W   R + CA  AS    G 
Sbjct: 64  IERLYKAIDKNYDVPFKLNDFGGVTMSAVFRERFARSQALWLQSREAFCAARASLV--GE 121

Query: 93  AQSMIY---ANCLQGHAIERNEKLESY 116
                Y     C+      R  ++ES 
Sbjct: 122 WAPTQYDIETQCVIDMNHARQHEIESL 148


>gi|239500957|ref|ZP_04660267.1| hypothetical protein AbauAB_01450 [Acinetobacter baumannii AB900]
          Length = 347

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 26/101 (25%), Gaps = 22/101 (21%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG---------- 87
                 K K         +K+   ++  F++ Q  W   R  EC   A            
Sbjct: 246 KELDADKAKQVERLNLTWDKLSADKKTQFKQDQSDWFKKRDVECKVLAQKTIDEIPEKDL 305

Query: 88  --AEEGTAQ----------SMIYANCLQGHAIERNEKLESY 116
              ++ +             M Y  C      ER   L + 
Sbjct: 306 ETYQKQSDYWTADMRKQNQEMQYTQCFIQKTAERTVYLNNL 346


>gi|299532371|ref|ZP_07045763.1| hypothetical protein CTS44_16288 [Comamonas testosteroni S44]
 gi|298719609|gb|EFI60574.1| hypothetical protein CTS44_16288 [Comamonas testosteroni S44]
          Length = 159

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 35/116 (30%), Gaps = 10/116 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNE-----TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           +     +IA    + A +           Q     C      +++  ++  Y  +  ++ 
Sbjct: 34  LAAGSLLIAHLPVASAQDNEPTPLHCPSDQPLSLACLEQQAQVLERGMQVLYLYLQRQLP 93

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   +  +  Q  W   R   C       E         A C  G A+ R +  ++
Sbjct: 94  QASAQALQTEQDDWTQRRDRRCQPNGYVHEAEDM-----AACRIGMALSRVKDFKN 144


>gi|262280733|ref|ZP_06058516.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257633|gb|EEY76368.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 343

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 29/101 (28%), Gaps = 22/101 (21%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA---- 93
                 K K      +  +K+   ++  F++ Q  W   R  EC   A  + +  A    
Sbjct: 242 KELDADKAKQVERLNQTWDKLSAEKKTQFKQDQSDWFEKRDVECKVLAQKSVDDIAEKDL 301

Query: 94  ------------------QSMIYANCLQGHAIERNEKLESY 116
                             Q M Y  C     IER   L + 
Sbjct: 302 ETYQKQSDYWTAEMRQQNQEMQYTQCFTQKTIERTVYLNNL 342


>gi|313668243|ref|YP_004048527.1| hypothetical protein NLA_9310 [Neisseria lactamica ST-640]
 gi|313005705|emb|CBN87159.1| hypothetical protein NLA_9310 [Neisseria lactamica 020-06]
          Length = 463

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 24/80 (30%), Gaps = 7/80 (8%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
                 +   +A     ++ +     E        W+    ++CA       +G    + 
Sbjct: 389 RESDKKERAAKAALDGAVQALPADIAETVMPEYRNWQNSLNAKCA-------DGDEYGLA 441

Query: 98  YANCLQGHAIERNEKLESYL 117
            + C       + +++  YL
Sbjct: 442 QSYCRIRETDAKTKEIRGYL 461



 Score = 36.3 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 26/79 (32%), Gaps = 7/79 (8%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
              + L + + E  +    + +    +   + SQ  W+      C  + + AE  T   +
Sbjct: 303 EERYQLARSEFEQFW----KGLPPAVQNKLQASQKTWKSGTDKIC-ASKAKAEGETPNGI 357

Query: 97  IYAN--CLQGHAIERNEKL 113
             +   C       R E L
Sbjct: 358 KISELVCRTAETEARLEGL 376


>gi|309380013|emb|CBX21424.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 400

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 25/80 (31%), Gaps = 7/80 (8%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
                 +   +A     ++ +     E        W+    ++CA       +G    + 
Sbjct: 326 RESDKKERAAKAALDGAVQALPADIAETVTPEYRNWQNGLNAKCA-------DGDEYGLA 378

Query: 98  YANCLQGHAIERNEKLESYL 117
            ++C       + +++  YL
Sbjct: 379 QSDCRIRETDAKTKEIRGYL 398



 Score = 34.7 bits (78), Expect = 3.8,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 26/79 (32%), Gaps = 7/79 (8%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
              + L + + E  +    + +    +   + SQ  W+      C  + + AE  T   +
Sbjct: 240 EERYQLARSEFEQFW----KGLPPAVQNKLQASQKTWKSGMDKIC-ASKAKAEGETPNGI 294

Query: 97  IYAN--CLQGHAIERNEKL 113
             +   C       R E L
Sbjct: 295 KISELVCRTAETEARLEGL 313


>gi|256419752|ref|YP_003120405.1| hypothetical protein Cpin_0706 [Chitinophaga pinensis DSM 2588]
 gi|256034660|gb|ACU58204.1| hypothetical protein Cpin_0706 [Chitinophaga pinensis DSM 2588]
          Length = 135

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 37/132 (28%), Gaps = 21/132 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQ------------CTGNSFALVKEKLE 48
           M R I+     I +   +        +   +               C    +  +   L 
Sbjct: 1   MKRLILCLPLCICLNVFAQTS--KTAVDSLEKRYQQCLSEGKSNFNCALQYYTQMDSLLH 58

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYR-------GSECAFAASGAEEGTAQSMIYANC 101
           + Y ++ + ++ ++R+  + SQ  WE  R                    G    MI  + 
Sbjct: 59  SVYTELYDNLDNNRRQTLQISQQQWEEKRETYFKDIDVRVEKKRPLTLSGLDDDMIVTDN 118

Query: 102 LQGHAIERNEKL 113
                  R  +L
Sbjct: 119 KAAFLKTRIVEL 130


>gi|237750707|ref|ZP_04581187.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373797|gb|EEO24188.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 208

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 29/114 (25%), Gaps = 27/114 (23%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--------------------RELF 66
                +       +    + L   YK    +V+K                      ++  
Sbjct: 91  GSTQGILASLNYGYDEYDKLLNKYYKLYRAEVKKQNKTTPTGAFSHEPNIQSIKNGQDTL 150

Query: 67  EKSQMAWEIYRG-------SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            + Q AW   R        +  A        GT  S+  +N   G    R  +L
Sbjct: 151 LEEQRAWLKLRDSYEAYTKAHHAHIYDINGGGTIYSIEASNARLGLLKMRVNEL 204


>gi|32266916|ref|NP_860948.1| hypothetical protein HH1417 [Helicobacter hepaticus ATCC 51449]
 gi|32262968|gb|AAP78014.1| hypothetical protein HH_1417 [Helicobacter hepaticus ATCC 51449]
          Length = 330

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 7/48 (14%), Positives = 14/48 (29%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
              +C      ++ + C+  S A         Y    E ++    E  
Sbjct: 187 AGFDCTNARSASEKSICSDPSLANDDRINNVLYLGAREYIKNLALEEL 234


>gi|261400284|ref|ZP_05986409.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269210094|gb|EEZ76549.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 400

 Score = 39.4 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 25/80 (31%), Gaps = 7/80 (8%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
                 +   +A     ++ +     E        W+    ++CA       +G    + 
Sbjct: 326 RESDKKERAAKAALDGAVQALPADIAETVMPEYRNWQNGLNAKCA-------DGDEYGLA 378

Query: 98  YANCLQGHAIERNEKLESYL 117
            ++C       + +++  YL
Sbjct: 379 QSDCRIRETDAKTKEIRGYL 398



 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 26/79 (32%), Gaps = 7/79 (8%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
              + L + + E  +    + +    +   + SQ  W+      C  + + AE  T   +
Sbjct: 240 EERYQLARSEFEQFW----KGLPPAVQNKLQASQKTWKSGMDKIC-ASKAKAEGETPNGI 294

Query: 97  IYAN--CLQGHAIERNEKL 113
             +   C       R E L
Sbjct: 295 KISELVCRTAETEARLEGL 313


>gi|254499014|ref|ZP_05111713.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254351764|gb|EET10600.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 310

 Score = 39.4 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 9/87 (10%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQ----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
            +  +  KL   Y K+ +K+            +K++ AW  YR +   F      E +A 
Sbjct: 229 QYQKIDNKLNVIYNKIQKKLFAKSLTVTINGIQKTERAWIKYRNAWVDFGYMKCPEISAI 288

Query: 95  SMIYANCLQGHAIERNEKLESYLTCPE 121
           S            ER  +LE+     +
Sbjct: 289 SWNAL-----ITKERVIQLEALANLED 310


>gi|170744314|ref|YP_001772969.1| hypothetical protein M446_6269 [Methylobacterium sp. 4-46]
 gi|168198588|gb|ACA20535.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 318

 Score = 39.0 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 26/108 (24%), Gaps = 17/108 (15%)

Query: 19  MALNCN---------ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS 69
            A +C                   Q    +       +   Y+ + ++ ++ +       
Sbjct: 183 QAQDCATTPKGLWGPGAASLVTRAQEFDGARGAADRAVRENYRVMTQRAKREEVRPIVAE 242

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           Q A+   R   C   A     G         C       R   L + L
Sbjct: 243 QAAFSADREQMCRAYAREGVHGF--------CHLRITEARVLSLATRL 282


>gi|134296613|ref|YP_001120348.1| hypothetical protein Bcep1808_2515 [Burkholderia vietnamiensis G4]
 gi|134139770|gb|ABO55513.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 263

 Score = 39.0 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 30/80 (37%), Gaps = 2/80 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A   QC G +    +  ++  Y+++        +  ++ SQ  W  +R  E     +
Sbjct: 45  SSTAGQIQCMGEAQRQWQTVMDGAYQRLSNDAPADVKRGWQDSQRRWVTWRKDEIQLLKA 104

Query: 87  GAE--EGTAQSMIYANCLQG 104
             +   GT+ +M  A+    
Sbjct: 105 VYDTTRGTSYAMSSADMQLQ 124



 Score = 34.4 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 1/54 (1%)

Query: 35  CTGNSF-ALVKEKLEATYKKVLEKVEKHQRELFEKS