RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >gnl|CDD|33550 COG3755, COG3755, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 127 Score = 66.2 bits (161), Expect = 3e-12 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 3/122 (2%) Query: 1 MCRKIIFALTIIAIAFQSM-ALNCNETLMQADMNQ-CTGNSFALVKEKLEATYKKVLEKV 58 + + T+ A A +C Q D N C G + +L YK +L+++ Sbjct: 5 VAPLALLLATLALSATSQSAADDCCRASPQFDSNYDCAGQEYQAADAELNKAYKALLKRL 64 Query: 59 EKHQRE-LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117 + R +K+Q AW +R ++CA S + G+ M +CL +R +LE L Sbjct: 65 QDSPRTKALQKAQRAWIAFRDADCALIKSQLDGGSIAPMEVLSCLLDLTNQRTAELEELL 124 Query: 118 TC 119 Sbjct: 125 QP 126 >gnl|CDD|31106 COG0763, LpxB, Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]. Length = 381 Score = 28.3 bits (63), Expect = 0.69 Identities = 12/48 (25%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Query: 40 FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87 LV K ++ L K E L + + ++ A AASG Sbjct: 227 LPLVNAKYRRIIEEAL-KWEVAGLSLILIDGEKRKAFAAADAALAASG 273 >gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]. Length = 782 Score = 27.8 bits (62), Expect = 0.81 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 52 KKVLEKVEKHQRELFEKSQM 71 KKV E++EK QRE + + Q+ Sbjct: 216 KKVKEQMEKSQREYYLREQL 235 >gnl|CDD|111570 pfam02684, LpxB, Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyse the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2, 3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyse the fist disaccharide step in the synthesis of lipid-A-disaccharide. Length = 373 Score = 27.7 bits (62), Expect = 1.0 Identities = 18/80 (22%), Positives = 25/80 (31%), Gaps = 12/80 (15%) Query: 8 ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67 I A Q + N L+ LV +K E + L L E Sbjct: 202 LPPIQVAAQQLSSQFPNLKLL-----------VPLVNKKYEEQIEDTLALENC-DVSLLE 249 Query: 68 KSQMAWEIYRGSECAFAASG 87 S +E ++ A A SG Sbjct: 250 ISGERYEAMFAADAALAKSG 269 >gnl|CDD|146739 pfam04257, Exonuc_V_gamma, Exodeoxyribonuclease V, gamma subunit. The Exodeoxyribonuclease V enzyme is a multi-subunit enzyme comprised of the proteins RecB, RecC (this family) and RecD. This enzyme plays an important role in homologous genetic recombination, repair of double strand DNA breaks resistance to UV irradiation and chemical DNA-damage. The enzyme (EC:3.1.11.5) catalyses ssDNA or dsDNA-dependent ATP hydrolysis, hydrolysis of ssDNA or dsDNA and unwinding of dsDNA. This family consists of two AAA domains. Length = 1008 Score = 26.8 bits (60), Expect = 1.9 Identities = 7/31 (22%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Query: 47 LEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77 + ++ VL V + F K + W + R Sbjct: 69 IWQLFRAVLGDVPE--ESPFSKESLTWRLMR 97 >gnl|CDD|145098 pfam01763, Herpes_UL6, Herpesvirus UL6 like. This family consists of various proteins from the herpesviridae that are similar to herpes simplex virus type I UL6 virion protein. UL6 is essential for cleavage and packaging of the viral genome. Length = 551 Score = 26.4 bits (59), Expect = 2.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Query: 21 LNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQR 63 L C+ A + Q N+ LV + E YK+++EK+EK + Sbjct: 241 LACHRLREHAKLCQLL-NTAPVKVLVGSRHEDGYKRIVEKLEKESK 285 >gnl|CDD|35723 KOG0502, KOG0502, KOG0502, Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only]. Length = 296 Score = 26.2 bits (57), Expect = 2.8 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Query: 9 LTIIAIAFQSMALNCNETLMQ--ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66 T + A + + C E+L+ AD+ Q + + ++ + Y+ V + +EKH +L Sbjct: 227 GTPLLYAVRGNHVKCVESLLNSGADVTQEDDSGYWIMDLAVALGYRIVQQVIEKHALKLC 286 Query: 67 EKSQ 70 + S+ Sbjct: 287 QDSE 290 >gnl|CDD|132827 cd07294, PX_SNX12, The phosphoinositide binding Phox Homology domain of Sorting Nexin 12. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. The specific function of SNX12 has yet to be elucidated. Length = 132 Score = 25.0 bits (54), Expect = 6.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 76 YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112 +RG E F S EE + N + GH + +NE+ Sbjct: 78 FRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNER 114 >gnl|CDD|38960 KOG3756, KOG3756, KOG3756, Pinin (desmosome-associated protein) [Cytoskeleton]. Length = 340 Score = 25.0 bits (54), Expect = 6.7 Identities = 10/26 (38%), Positives = 19/26 (73%) Query: 43 VKEKLEATYKKVLEKVEKHQRELFEK 68 +++KLE ++ E++EK +REL E+ Sbjct: 172 IEQKLEEQAEEEREQLEKQERELLEE 197 >gnl|CDD|146643 pfam04113, Gpi16, Gpi16 subunit, GPI transamidase component. GPI (glycosyl phosphatidyl inositol) transamidase is a multi-protein complex. Gpi16, Gpi8 and Gaa1 for a sub-complex of the GPI transamidase. GPI transamidase that adds glycosylphosphatidylinositols (GPIs) to newly synthesized proteins. Gpi16 is an essential N-glycosylated transmembrane glycoprotein. Gpi16 is largely found on the lumenal side of the ER. It has a single C-terminal transmembrane domain and a small C-terminal, cytosolic extension with an ER retrieval motif. Length = 563 Score = 25.1 bits (55), Expect = 6.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 5 IIFALTIIAIAFQSM 19 II T+IA+AF S+ Sbjct: 514 IILTSTVIALAFGSI 528 >gnl|CDD|147038 pfam04682, Herpes_BTRF1, Herpesvirus BTRF1 protein conserved region. Herpesvirus protein. Length = 256 Score = 25.0 bits (55), Expect = 7.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Query: 48 EATYKKVLEKVEKHQRELFEK 68 E Y VL V + Q E FEK Sbjct: 132 EQLYGPVLPPVSEDQVEFFEK 152 >gnl|CDD|35668 KOG0447, KOG0447, KOG0447, Dynamin-like GTP binding protein [General function prediction only]. Length = 980 Score = 24.7 bits (53), Expect = 8.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Query: 46 KLEATYKKVLEKVEKHQREL 65 + Y+++LE++EK +EL Sbjct: 244 HTQLKYQRILERLEKENKEL 263 >gnl|CDD|38040 KOG2829, KOG2829, KOG2829, E2F-like protein [Transcription]. Length = 326 Score = 24.6 bits (53), Expect = 8.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 107 IERNEKLESYLTCPEGDLLCPFI 129 ++RN ES P ++ PFI Sbjct: 169 VQRNRHAESQGQPPSENIHLPFI 191 >gnl|CDD|32653 COG2825, HlpA, Outer membrane protein [Cell envelope biogenesis, outer membrane]. Length = 170 Score = 24.5 bits (53), Expect = 8.9 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Query: 1 MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFA--LVKEKLEATYKKVLEKV 58 M ++++ AL +A+A + A + ++ + S V LE+ +KK +++ Sbjct: 1 MKKRLLAALLGLALATSASAAQAAPKIAIVNLGRIFQESPQAKKVSADLESEFKKRQKEL 60 Query: 59 EKHQRELFEKSQM 71 +K Q+EL K Sbjct: 61 QKMQKELKAKEAK 73 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.131 0.386 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,450,799 Number of extensions: 61527 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's gapped: 216 Number of HSP's successfully gapped: 20 Length of query: 131 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 48 Effective length of database: 4,470,190 Effective search space: 214569120 Effective search space used: 214569120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (23.8 bits)