RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >gnl|CDD|148561 pfam07007, DUF1311, Protein of unknown function (DUF1311). This family consists of several bacterial proteins of around 120 residues in length. Members of this family contain four highly conserved cysteine residues. The function of this family is unknown. Length = 92 Score = 68.3 bits (167), Expect = 6e-13 Identities = 28/92 (30%), Positives = 40/92 (43%) Query: 22 NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81 +C + A+M C A +L A Y+ +L + R +Q AW YR +EC Sbjct: 1 DCAKASTTAEMAICADAELAAADAELNAAYQALLAALPADARAALRAAQRAWLKYRDAEC 60 Query: 82 AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113 F AS G+ + YA CL ER +L Sbjct: 61 DFEASLYGGGSIAPLAYAACLARLTRERIAEL 92 >gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock. Length = 775 Score = 28.8 bits (65), Expect = 0.44 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 40 FALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71 ++ K+ KKV EK+EK QRE + + Q+ Sbjct: 204 LLKLQNKIT---KKVEEKMEKTQREYYLREQL 232 >gnl|CDD|178050 PLN02431, PLN02431, ferredoxin--nitrite reductase. Length = 587 Score = 27.4 bits (61), Expect = 1.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 6/53 (11%) Query: 24 NETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73 N L+ + CTGN F A+++ K A KV E++E+ E+ +M W Sbjct: 460 NPGLLLKGLVACTGNQFCGQAIIETKARAL--KVTEELER-LVEVPRPVRMHW 509 >gnl|CDD|181540 PRK08724, fliD, flagellar capping protein; Validated. Length = 673 Score = 27.1 bits (60), Expect = 1.5 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Query: 41 ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE---EGTAQSMI 97 + + KLE ++ LEK++K Q +++Q A+++Y G +A + +G AQ Sbjct: 395 QIARAKLEPEERERLEKIDKAQ-AALKQAQSAFDLYSGMTEVQSAQDSMVVLDGVAQLSS 453 Query: 98 YANCLQGHAIE 108 N ++ AIE Sbjct: 454 NNNVIE-DAIE 463 >gnl|CDD|148927 pfam07580, Peptidase_M26_C, M26 IgA1-specific Metallo-endopeptidase C-terminal region. These peptidases, which cleave mammalian IgA, are found in Gram-positive bacteria. Often found associated with pfam00746, they may be attached to the cell wall. Length = 731 Score = 25.4 bits (56), Expect = 4.2 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 39 SFALVKEKLEATYKKVLEKVEKHQ 62 SF VK L+ KK+LE E H Sbjct: 65 SFDEVKANLDKLVKKLLEN-EDHI 87 >gnl|CDD|177691 PLN00060, PLN00060, meiotic recombination protein SPO11-2; Provisional. Length = 384 Score = 24.8 bits (54), Expect = 6.0 Identities = 11/37 (29%), Positives = 17/37 (45%) Query: 32 MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68 + +F V + +E Y+ + E QRELF K Sbjct: 90 TKAGSAKAFVRVWKVMEMCYQILGEGKLVTQRELFYK 126 >gnl|CDD|177544 PHA03148, PHA03148, hypothetical protein; Provisional. Length = 289 Score = 24.6 bits (54), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Query: 48 EATYKKVLEKVEKHQRELFEK 68 EA Y VL V Q E FEK Sbjct: 165 EALYGSVLPPVSPEQIESFEK 185 >gnl|CDD|178802 PRK00025, lpxB, lipid-A-disaccharide synthase; Reviewed. Length = 380 Score = 24.3 bits (54), Expect = 8.9 Identities = 11/46 (23%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 42 LVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87 LV K ++ L + + L E ++ A AASG Sbjct: 227 LVNPKRREQIEEALAEYAGLEVTLL--DGQKREAMAAADAALAASG 270 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.131 0.386 Gapped Lambda K H 0.267 0.0735 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,965,394 Number of extensions: 103880 Number of successful extensions: 244 Number of sequences better than 10.0: 1 Number of HSP's gapped: 244 Number of HSP's successfully gapped: 20 Length of query: 131 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 48 Effective length of database: 4,201,009 Effective search space: 201648432 Effective search space used: 201648432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (23.8 bits)