RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >g1jmu.1 e.35.1.1 (A:,B:) Membrane penetration protein mu1 {Reovirus [TaxId: 10891]} Length = 666 Score = 28.4 bits (63), Expect = 0.21 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Query: 36 TGNS--FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77 T NS + L + L V +H F K++MA E R Sbjct: 70 TDNSSGAVPSESALVPYNDEPLVVVTEHAIANFTKAEMALEFNR 113 >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 Score = 26.6 bits (58), Expect = 0.78 Identities = 8/27 (29%), Positives = 14/27 (51%) Query: 46 KLEATYKKVLEKVEKHQRELFEKSQMA 72 + A Y+K +EK +K R + + A Sbjct: 7 TVSADYQKAVEKAKKKLRGFIAEKRCA 33 >d1v0da_ d.4.1.7 (A:) Caspase-activated DNase, CAD (DffB, DFF40) {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Score = 24.8 bits (54), Expect = 2.8 Identities = 8/23 (34%), Positives = 10/23 (43%) Query: 104 GHAIERNEKLESYLTCPEGDLLC 126 G +R + S L PEG C Sbjct: 123 GSYFDRGAEASSRLCTPEGWFSC 145 >d1dnla_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]} Length = 199 Score = 24.4 bits (52), Expect = 3.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 61 HQRELFEKSQMAWEIYR 77 H R L+++ AW+I R Sbjct: 180 HDRFLYQRENDAWKIDR 196 >d1t9ma_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]} Length = 204 Score = 23.3 bits (49), Expect = 6.8 Identities = 3/17 (17%), Positives = 9/17 (52%) Query: 61 HQRELFEKSQMAWEIYR 77 H+R +++ + W+ Sbjct: 185 HERLRYDRDEGGWKHRY 201 >d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Length = 477 Score = 23.5 bits (50), Expect = 7.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 41 ALVKEKLEATYKKVLEKVEKH 61 +L++E LE +K + KH Sbjct: 8 SLIQEVLEVYPEKARKDRNKH 28 >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Score = 23.1 bits (49), Expect = 8.9 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 39 SFALVKEKLEATYKKVLEKVEKH 61 F V++++ A Y + KVE H Sbjct: 258 DFLTVEQRMRACYYSLASKVEGH 280 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.131 0.386 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 454,039 Number of extensions: 17443 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 14 Length of query: 131 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 55 Effective length of database: 1,364,116 Effective search space: 75026380 Effective search space used: 75026380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (22.6 bits)