RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780608|ref|YP_003065021.1| ribosomal large subunit pseudouridine synthase C [Candidatus Liberibacter asiaticus str. psy62] (346 letters) >gnl|CDD|30910 COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]. Length = 289 Score = 226 bits (576), Expect = 1e-59 Identities = 100/308 (32%), Positives = 154/308 (50%), Gaps = 22/308 (7%) Query: 7 VQYVVVENDEENMRLDRWFKNHYPHINFVNLQKILRSGQVRVDKKRVKFNNRIQSGQVVR 66 + V +E RLD++ P I+ +QK++R G+VRV+ K+VK + +++ G VVR Sbjct: 1 MLEFEVPEEEAGQRLDKFLAKLLP-ISRSRIQKLIRKGRVRVNGKKVKPSYKLKPGDVVR 59 Query: 67 IPPVINALNHIIKEQKILDSSVNLTKHSDFLKSILLYEDSKIYVFNKPAGISVQGGSGIA 126 IP + + I +LYED + V NKPAG+ V G G Sbjct: 60 IPLPEEPEEEKLVPEDIPLD--------------ILYEDEDLLVVNKPAGLVVHPGGGHH 105 Query: 127 YHID-GFLKSWVDSKGQKPRLTHRLDQETSGILVVARTRAAAQHLTESFRMRRIQKIYWS 185 L ++P + HRLD++TSG+L+VA+ R AA+ L+E F+ R+++K Y + Sbjct: 106 EGTLVNALLRHCQDGVERPGIVHRLDKDTSGLLLVAKNREAARELSEQFKQRKVKKTYLA 165 Query: 186 LVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNEKGANYAISHFKVIDCFAQKFCWLEM 245 LV G + I + + V + + K AI+H++V++ F + +E+ Sbjct: 166 LVRGHLPEDEGTIDAPIGRDPKNRKKMAVVKEGSGK---PAITHYEVLERFGDNYTLVEL 222 Query: 246 QPHTGRTHQLRVHALHMGCPIVGDHKYCANFKGNFTSPIQNKLYLHARYMDLPHPEGGR- 304 +P TGRTHQ+RVH H+G PIVGD Y K + LHA + HP G Sbjct: 223 KPETGRTHQIRVHLAHLGHPIVGDPLYGGKDK--SAGAGLKRQALHAYKLSFTHPLTGEE 280 Query: 305 LQITAPLP 312 L+ APLP Sbjct: 281 LEFEAPLP 288 >gnl|CDD|30029 cd02869, PseudoU_synth_RluCD_like, PseudoU_synth_RsuA/RluD: Pseudouridine synthase, RsuA/RluD family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and TruA. Pseudouridine synthases catalyze the isomerization of specific uridines in a n RNA molecule to pseudouridines (5-ribosyluracil, psi) requiring no cofactors. E. coli RluC for example makes psi955, 2504 and 2580 in 23S RNA. Some psi sites such as psi1917 in 23S RNA made by RluD are universally conserved. Other psi sites occur in a more restricted fashion, for example psi2819 in 21S mitochondrial ribosomal RNA made by S. cerevisiae Pus5p is only found in mitochondrial large subunit rRNAs from some other species and in gram negative bacteria. The E. coli counterpart of this psi residue is psi2580 in 23S rRNA. psi2604in 23S RNA made by RluF has only been detected in E.coli. . Length = 185 Score = 166 bits (421), Expect = 9e-42 Identities = 68/193 (35%), Positives = 99/193 (51%), Gaps = 11/193 (5%) Query: 108 IYVFNKPAGISVQGGSGIAYHID---GFLKSWVDSKGQKPRLTHRLDQETSGILVVARTR 164 + V NKPAG+ V G G + + +P L HRLD++TSG+L+VA+ + Sbjct: 1 LLVVNKPAGLPVHPGPGHLTGTLVNALLKLLLLLGEEFRPGLVHRLDKDTSGLLLVAKNK 60 Query: 165 AAAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNEKGAN 224 AA L++ F+ R+++K Y +LV G P + I L +K V V + Sbjct: 61 KAAAKLSKQFKERKVKKTYLALVDGKPPEDEGTIDAPLGRKKRKKRARVVV----SEDGK 116 Query: 225 YAISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIVGDHKYCANFKGNFTSPI 284 AI+H+KV++ F +E+Q TGRTHQ+RVH +G PIVGD KY SP Sbjct: 117 PAITHYKVLERFG-NVTLVELQLETGRTHQIRVHLASIGHPIVGDPKYGGKAS---DSPG 172 Query: 285 QNKLYLHARYMDL 297 +L LHA + Sbjct: 173 LKRLALHAYRLSF 185 >gnl|CDD|144443 pfam00849, PseudoU_synth_2, RNA pseudouridylate synthase. Members of this family are involved in modifying bases in RNA molecules. They carry out the conversion of uracil bases to pseudouridine. This family includes RluD, a pseudouridylate synthase that converts specific uracils to pseudouridine in 23S rRNA. RluA from E. coli converts bases in both rRNA and tRNA. Length = 151 Score = 115 bits (291), Expect = 1e-26 Identities = 42/158 (26%), Positives = 71/158 (44%), Gaps = 11/158 (6%) Query: 108 IYVFNKPAGISVQGGSGIAYHIDGFLKSWVDSKGQKPRLTHRLDQETSGILVVARTRAAA 167 V NKPAG+ V L + + HRLD++TSG+L++A+ AA Sbjct: 1 YIVVNKPAGVPVHPTDLSDLLSLTELLLVAELGKFRLYPVHRLDRDTSGLLLLAKDGEAA 60 Query: 168 QHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNE--KGANY 225 L + F R+++K Y +LV G + + K+ I D V ++ + Sbjct: 61 NKLNKLFPERKVEKEYLALVDGPEEEEGTI-------KAPIKKDKNKVPRRKKEELDGKK 113 Query: 226 AISHFKVIDCF--AQKFCWLEMQPHTGRTHQLRVHALH 261 A++H +V+ + +E++ TGR HQ+R H Sbjct: 114 AVTHLRVLRSGSKIEDVSLVELELVTGRKHQIRAHLAA 151 >gnl|CDD|37130 KOG1919, KOG1919, KOG1919, RNA pseudouridylate synthases [RNA processing and modification]. Length = 371 Score = 115 bits (290), Expect = 1e-26 Identities = 66/237 (27%), Positives = 105/237 (44%), Gaps = 25/237 (10%) Query: 41 LRSGQVRVDKKRVKFNNRIQSGQVVRIPPVINALNHIIKEQKILDSSVNLTKHSDFLKSI 100 ++ G+V V+ ++V+ + +++G V + ++ + I Sbjct: 66 IKLGRVTVNGEQVRVSLIVKNGDV--LCHTVHRHEPPVAYLPIR---------------- 107 Query: 101 LLYEDSKIYVFNKPAGISVQ-GGSGIAYHIDGFLKSWVDSKGQKPRLTHRLDQETSGILV 159 +++ED V NKP GI V G I L + +G R HRLD+ TSG+LV Sbjct: 108 IVFEDKDYVVVNKPHGIPVHPTGRYRENTITKILAALHKVEG--LRPCHRLDRLTSGLLV 165 Query: 160 VARTRAAAQHLTESFRMRRIQKIYWSLVWGIPKNKK---ECIANWLLKKSHIGGDYVHVV 216 +A+T+ AA E R R ++K Y P E ++ + V Sbjct: 166 LAKTKEAADKFHEVLRKRTVKKEYVVARVEGPFPVVGEVEIKEPIGEEERPLRMGLNAVG 225 Query: 217 KQNEKGANYAISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIVGDHKYC 273 ++E A A + FKV+ +E +P TGRTHQ+RVH ++G PI GD KY Sbjct: 226 VRDEVAAKDAKTLFKVLSYDGGSS-LVECRPLTGRTHQIRVHLQYLGHPIAGDPKYG 281 >gnl|CDD|30016 cd02563, PseudoU_synth_TruC, tRNA pseudouridine isomerase C: Pseudouridine synthases catalyze the isomerization of specific uridines in an tRNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. TruC makes psi65 in tRNAs. This psi residue is not universally conserved.. Length = 223 Score = 107 bits (269), Expect = 5e-24 Identities = 67/229 (29%), Positives = 105/229 (45%), Gaps = 25/229 (10%) Query: 101 LLYEDSKIYVFNKPAGISVQGGSGIAYHIDGF-LKSWVDSKGQKPRLTHRLDQETSGILV 159 +LY+D + NKP+G+ V S + H F L++ D GQ HRLD+ TSG+L+ Sbjct: 3 ILYQDEHLVAINKPSGLLVHR-SELDRHETRFALQTLRDQLGQHVYPVHRLDRPTSGVLL 61 Query: 160 VARTRAAAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQN 219 A + A+ L E F R+ K Y ++V G + + + + Sbjct: 62 FALSSEVARKLGEQFTEHRVHKTYLAVVRGYVPESGTIDYPLSEELDKLADKFA----SD 117 Query: 220 EKGANYAISHFK---------VIDCFAQ-KFCWLEMQPHTGRTHQLRVHALHMGCPIVGD 269 +K A +H++ V+ + ++ +E+ PHTGR HQLR H H+ PI+GD Sbjct: 118 DKAPQAATTHYRLLAVEELPVVVGKYPTSRYSLVELTPHTGRKHQLRRHLAHIRHPIIGD 177 Query: 270 HKYCAN-----FKGNFTSPIQNKLYLHARYMDLPHPEGG-RLQITAPLP 312 + F+ +F +L L A ++ HP G RL I APL Sbjct: 178 TTHGDGRHNRFFREHFGCH---RLLLAATRLEFTHPVTGERLLIEAPLD 223 >gnl|CDD|73313 cd02557, PseudoU_synth_ScRIB2, PseudoU_synth_ScRIB2_like: Pseudouridine synthase, Saccharomyces cerevisiae RIB2_like. This group is comprised of eukaryotic and bacterial proteins similar to Saccharomyces cerevisiae RIB2, S. cerevisiae Pus6p and human hRPUDSD2. S. cerevisiae RIB2 displays two distinct catalytic activities. The N-terminal domain of RIB2 is RNA:psi-synthase which makes psi32 on cytoplasmic tRNAs. Psi32 is highly phylogenetically conserved. The C-terminal domain of RIB2 has a DRAP deaminase activity which catalyses the formation of 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione 5'-phosphate from 2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate during riboflavin biosynthesis. S. cerevisiae Pus6p makes the psi31 of cytoplasmic and mitochondrial tRNAs.. Length = 213 Score = 89.5 bits (222), Expect = 1e-18 Identities = 60/202 (29%), Positives = 88/202 (43%), Gaps = 30/202 (14%) Query: 101 LLYEDSKIYVFNKPAGISVQGGSGIAYH-IDGFLKSWVDSKGQKPRLTHRLDQETSGILV 159 +++ED + V +KP+GI V Y+ + LKS +P HRLD+ TSG+L+ Sbjct: 18 IVHEDDDLLVVDKPSGIPVHPTGRYRYNTVTEILKSEYGLTELRP--CHRLDRLTSGLLL 75 Query: 160 VARTRAAAQHLTESFRMRRIQKIYWSLVWG-IPKNKKECIANWLLKKSHIGGDYVHVVKQ 218 A+T A L + R R ++K Y + V G P + L G + Sbjct: 76 FAKTSQTASRLQQQIRSREVKKEYLARVKGEFPDGEVVVDQPIGLVSPKGG-----LRND 130 Query: 219 NEKGANYAISHFKVIDCFAQK-----FCWLEMQPHTGRTHQLRVHALHMGCPIVGDHKYC 273 ++ A + FK + C +P TGRTHQ+RVH ++G PIV D Y Sbjct: 131 VDEKGKDARTIFKRLSYNGDLNTSVVLC----KPITGRTHQIRVHLQYLGHPIVNDPIYN 186 Query: 274 ANFKGNFTSPIQNKLYLHA-RY 294 +YLHA RY Sbjct: 187 -----------NLGIYLHALRY 197 >gnl|CDD|30015 cd02558, PSRA_1, PSRA_1: Pseudouridine synthase, a subgroup of the RluA family. This group is comprised of bacterial proteins assigned to the RluA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. The RluA family is comprised of proteins related to Escherichia coli RluA. . Length = 246 Score = 74.9 bits (184), Expect = 3e-14 Identities = 56/219 (25%), Positives = 94/219 (42%), Gaps = 38/219 (17%) Query: 101 LLYEDSKIYVFNKPAGISVQGGSGIAYHIDGFLKSWVDSKGQKPRLT--HRLDQETSGIL 158 +L++D + V +KP + V ++ L + + P LT HRLD+ T+G++ Sbjct: 41 ILHQDEHLLVADKPHFLPVTPRGR---YVTETLLVRLRRQTGNPDLTPAHRLDRLTAGLV 97 Query: 159 VVAR---TRAAAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANW-------LLKKSHI 208 + ++ TR A Q L F R + K Y E +A + L +S I Sbjct: 98 LFSKRPETRGAYQTL---FARREVSKTY------------EAVAPYVPALTFPLTVRSRI 142 Query: 209 GGDYVHVVKQNEKGANYAISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIVG 268 + +G A + +++ + + PHTG+THQLRVH +G PI+ Sbjct: 143 VKGRGFFQAREVEGEPNAETRIELLARR-GGWGLYRLSPHTGKTHQLRVHMAALGVPILN 201 Query: 269 DHKY---CANFKGNFTSPIQNKLYLHARYMDLPHPEGGR 304 D Y +F+ P+Q L A+ ++ P GR Sbjct: 202 DPFYPVLLDKDPDDFSRPLQ----LLAKELEFTDPLTGR 236 >gnl|CDD|30008 cd02550, PseudoU_synth_Rsu_Rlu_like, PseudoU_synth_Rsu_Rlu: Pseudouridine synthase, Rsu/Rlu family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and TruA. Pseudouridine synthases catalyze the isomerization of specific uridines in a n RNA molecule to pseudouridines (5-ribosyluracil, psi) requiring no cofactors. E. coli RluC for example makes psi955, 2504 and 2580 in 23S RNA. Some psi sites such as psi1917 in 23S RNA made by RluD are universally conserved. Other psi sites occur in a more restricted fashion, for example psi2819 in 21S mitochondrial ribosomal RNA made by S. cerevisiae Pus5p is only found in mitochondrial large subunit rRNAs from some other species and in gram negative bacteria. The E. coli counterpart of this psi residue is psi2580 in 23S rRNA. psi2604in 23S RNA made by RluF has only been detected in E.coli.. Length = 154 Score = 72.2 bits (177), Expect = 2e-13 Identities = 42/162 (25%), Positives = 63/162 (38%), Gaps = 17/162 (10%) Query: 108 IYVFNKPAGISVQGGSGIAYHIDGFLKSWVDSKGQKPRLT--HRLDQETSGILVVARTRA 165 I V NKP+G+ + PR+ RLD++TSG+L++ Sbjct: 1 ILVLNKPSGLVCHPTDRDRDPTVVVRLDKLHG----PRVHAAGRLDKDTSGLLLLTNDGR 56 Query: 166 AAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNEKGANY 225 + LTE R I+K Y V G + L G V + G Sbjct: 57 LQRRLTEP--RREIEKEYLVTVRGELDEEGIED----LATVRRGRLSGLVDE----GVPL 106 Query: 226 AISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIV 267 A++ +VI L + TGRTHQ+R H +G P++ Sbjct: 107 AVTKVRVIGEHGGTG-RLRLTLKTGRTHQIRRHCAAVGFPVL 147 >gnl|CDD|30030 cd02870, PseudoU_synth_RsuA_like, Pseudouridine synthases are responsible for the synthesis of pseudouridine from uracil in ribosomal RNA. The RsuA subfamily includes Pseudouridine Synthase similar to Ribosomal small subunit pseudouridine 516 synthase. Most of the proteins in this family are bacterial proteins.. Length = 146 Score = 38.2 bits (89), Expect = 0.004 Identities = 36/161 (22%), Positives = 58/161 (36%), Gaps = 25/161 (15%) Query: 109 YVFNKPAGISVQGGSGIAYHIDGFLKSWVDSKGQKPRLTH--RLDQETSGILVVARTRAA 166 + NKP G+ +G K RL RLD +T G+L++ Sbjct: 2 LLLNKPRGVVST-----VRDPEGRPTVLDLLKDVGERLFPVGRLDYDTEGLLLLTNDGEL 56 Query: 167 AQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNEKGANYA 226 A LT ++K Y V G+P +E + + + G A Sbjct: 57 ANRLTHP--RYGVEKTYLVKVRGVPS--EEELRRLR------------AGVELDDGKT-A 99 Query: 227 ISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIV 267 + KV+ + LE+ H GR Q+R +G P++ Sbjct: 100 PAKVKVLSRDPKN-TLLEVTLHEGRNRQVRRMFEAVGHPVL 139 >gnl|CDD|31380 COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis]. Length = 248 Score = 35.6 bits (82), Expect = 0.019 Identities = 40/233 (17%), Positives = 76/233 (32%), Gaps = 48/233 (20%) Query: 38 QKILRSGQVRVDKKRVKFNNRIQSGQVVRIPPVINALNHIIKEQKILDSSVNLTKHSDFL 97 +K++ G+V V+ G+V + V+ + + E Sbjct: 21 EKLIEEGRVTVN------------GKVATLGGVVVDPDDDVVE---------------VD 53 Query: 98 KSILLYEDSKIYV-FNKPAGI--SVQGGSGIAYHIDGFLKSWVDSKGQKPRLTHRLDQET 154 + ++ ++Y+ NKP G S + G D L + K ++ RLD++T Sbjct: 54 GKRIELKEERVYLLLNKPRGYVSSTEDDEGRPTVFD-LLPERLPRK-KRLFPVGRLDKDT 111 Query: 155 SGILVVARTRAAAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVH 214 G+L++ A L ++K Y V G + L K + Sbjct: 112 EGLLLLTNDGELAHRLMHP--SSEVEKEYLVRVEGPVTEED---LEKLRKGVTLDD---- 162 Query: 215 VVKQNEKGANYAISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIV 267 G + + WL + GR Q+R +G ++ Sbjct: 163 -------GETKPAKPASLEKEPGKNNSWLRITLTEGRNRQVRRMFEAVGLEVL 208 >gnl|CDD|31381 COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis]. Length = 100 Score = 34.9 bits (80), Expect = 0.035 Identities = 19/102 (18%), Positives = 42/102 (41%), Gaps = 22/102 (21%) Query: 13 ENDEENMRLDRWFKNHYPHINFVNL-------QKILRSGQVRVDKKRVKFNNRIQSGQVV 65 + D + MRLD+W ++++ G+V+V+ +R K + ++ G ++ Sbjct: 3 DKDADRMRLDKWLW-------AARFIKRRSLAKEMIEGGRVKVNGQRAKPSKEVKVGDIL 55 Query: 66 RIPPVINALNHIIKEQKILDSSVNLTKHSDFLKSILLYEDSK 107 I + K+L ++ LLYE+++ Sbjct: 56 TI-----RFGNKEFTVKVLALGEQRRPAE---EARLLYEETE 89 >gnl|CDD|147225 pfam04947, Pox_VLTF3, Poxvirus Late Transcription Factor VLTF3 like. Members of this family are approximately 26 KDa, and are involved in trans-activator of late transcription. Length = 171 Score = 33.0 bits (76), Expect = 0.11 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 50 KKRVKFNN---RIQSGQVVRIPP-VINALNHIIKEQKILDSSVNLTKHSDFLKSI 100 + + F N R+Q Q IP V L +K+ I V TK DFLK + Sbjct: 12 NRLIHFRNCLRRLQGKQTTTIPDKVYEELRKKLKKYNIDTDDVTTTKVLDFLKKL 66 >gnl|CDD|29105 cd00165, S4, S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes.. Length = 70 Score = 32.2 bits (73), Expect = 0.21 Identities = 13/68 (19%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Query: 19 MRLDRWFKNHYPHINFVNLQKILRSGQVRVDKKRVKFNN-RIQSGQVVRIPPVINALNHI 77 MRLD+ + +++++ G V V+ K V + +++ G V+ + + + Sbjct: 1 MRLDKILARLGLAPSRSEARQLIKHGHVLVNGKVVTKPSYKVKPGDVIEVDGKSIEEDIV 60 Query: 78 IKEQKILD 85 +++K+L Sbjct: 61 YEDKKLLV 68 >gnl|CDD|144902 pfam01479, S4, S4 domain. The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterized, small proteins that may be involved in translation regulation. The S4 domain probably mediates binding to RNA. Length = 48 Score = 29.8 bits (68), Expect = 1.2 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 19 MRLDRWFKNHYPHINFVNLQKILRSGQVRVDKKRVKFNN-RIQSGQVV 65 MRLD+ + ++++R G VRV+ K VK + R++ G V+ Sbjct: 1 MRLDKVLARLGLASSRSEARQLIRHGHVRVNGKVVKDPSYRVKPGDVI 48 >gnl|CDD|145350 pfam02145, Rap_GAP, Rap/ran-GAP. Length = 187 Score = 29.5 bits (67), Expect = 1.2 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 202 LLKKSHIGGDYVHVVKQ-NEKGANYAI--SHF 230 L KK HIG D V+++ + K N S F Sbjct: 73 LEKKRHIGNDIVNIIFNESGKPFNPDTIKSQF 104 >gnl|CDD|38891 KOG3687, KOG3687, KOG3687, Tuberin - Rap/ran-GTPase-activating protein [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms]. Length = 1697 Score = 28.2 bits (62), Expect = 3.5 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 203 LKKSHIGGDYVHVVKQNEKGANY 225 KK HIG D+V ++ NE G Y Sbjct: 1539 KKKRHIGNDFVSII-YNESGEEY 1560 >gnl|CDD|35589 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipid transport and metabolism]. Length = 2196 Score = 27.6 bits (61), Expect = 4.6 Identities = 11/79 (13%), Positives = 30/79 (37%) Query: 130 DGFLKSWVDSKGQKPRLTHRLDQETSGILVVARTRAAAQHLTESFRMRRIQKIYWSLVWG 189 G + ++ + RL + + ++ +A+ LT + +QK + Sbjct: 2067 KGVISKVLEWTESRRFFYWRLRRRLAEDQLLKEILSASPDLTYKEKQAMLQKWFEESEGA 2126 Query: 190 IPKNKKECIANWLLKKSHI 208 + + + W+ ++S I Sbjct: 2127 VKWEDDQQVVTWIEEQSTI 2145 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.430 Gapped Lambda K H 0.267 0.0742 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,352,088 Number of extensions: 227304 Number of successful extensions: 471 Number of sequences better than 10.0: 1 Number of HSP's gapped: 447 Number of HSP's successfully gapped: 19 Length of query: 346 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 251 Effective length of database: 4,210,882 Effective search space: 1056931382 Effective search space used: 1056931382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 58 (26.1 bits)