HHsearch alignment for GI: 254780610 and conserved domain: PRK12565

>PRK12565 30S ribosomal protein S4; Provisional.
Probab=98.00  E-value=9.3e-06  Score=54.10  Aligned_cols=53  Identities=23%  Similarity=0.283  Sum_probs=46.4

Q ss_pred             CCCCHHHHHHHHCCCCCCHHHHHHHHHCCCEEECCEEECCCCCEECCCCEEEEE
Q ss_conf             687578999987176889899999998599049989932867580489889997
Q gi|254780610|r   21 AEGRIDRWLATSLKEQFSRSYVKILILNGFISINGMVSKNPNRKVVPGDSFLIT   74 (340)
Q Consensus        21 ~g~RLD~~L~~~l~~~~sR~~i~kli~~G~V~vnG~~~~~~~~~l~~gd~I~i~   74 (340)
T Consensus        86 LE~RLDnvv~R-~gfa~t~~~ARQlV~Hghi~vng~kVdIPSy~vk~GDvI~vk  138 (197)
T PRK12565         86 LECRLDNVVYR-IGFASSIRQARQMVNHGHILVNGKKVNIPSYEVKVGDEITLR  138 (197)
T ss_pred             HHHHHHHHHHH-CCCCCCHHHHHHHHHCCCEEECCEEECCCCEEECCCCEEEEC
T ss_conf             99866677113-441057999866740788897998955887670699999973