HHsearch alignment for GI: 254780611 and conserved domain: PRK06288

>PRK06288 RNA polymerase sigma factor WhiG; Reviewed.
Probab=100.00  E-value=0  Score=435.77  Aligned_cols=250  Identities=23%  Similarity=0.313  Sum_probs=213.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             799999899999999999828599999999943077875655557---99998889999998889989862185345689
Q gi|254780611|r   25 KIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYR---GYGLPISEVVSEGNIGLMQAVKKFDPERGFRL  101 (302)
Q Consensus        25 ~~~~Lt~eee~~l~~~~~~~gd~~Ar~~Li~~nlrlV~~iA~~y~---~~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~F  101 (302)
T Consensus         4 ~~~~~s~eee~eL~~~~~~~gd~~ar~~LI~~nlrLV~~iA~~~~~~~~~~~~~~DLiQeG~iGLi~AvekFDp~rG~rF   83 (261)
T PRK06288          4 KNRKYAQQDETELWKSYKETGDAKIREYLILKYSPLVKYVAGRVAVGMPQNVEFDDLVSYGVFGLLDAIEKFDPEREIKF   83 (261)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             62223869999999999881999999999998599999999998457999999999999999999999996599878883


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             99757789999998532024600110230035899999999788786624478882467788861898321100000012
Q gi|254780611|r  102 ATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLA  181 (302)
Q Consensus       102 sTYA~~wIr~~I~~~i~~~~~~IRiP~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~  181 (302)
T Consensus        84 sTYA~~wIr~aI~~~lR~~~---~~pr~-----~~~~~~ki~~~~~~l~~~~gr~pt~~eia~~lg~~~~~v~~~~~~~~  155 (261)
T PRK06288         84 ETYAITRIRGAIFDELRSID---WIPRS-----VRQKARQVERAIAMLEAKLGRTPTDDEIAKELGISLEEYHSLLSKVS  155 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHH---HCCHH-----HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             98799999999999999860---03199-----99999999999999999868999878888781999999999999972


Q ss_pred             --CCCCHHHHCCCC-CCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             --234335520232-34532000001235687056556666666777999999621999999999998278888898999
Q gi|254780611|r  182 --GDESLNALINSS-DKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENL  258 (302)
Q Consensus       182 --~~~SLd~~i~~~-d~~~~~~~d~l~~~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EI  258 (302)
T Consensus       156 ~~~~~SLd~~~~~~~~~~~~~~~d~l~d~~~~~p~~~~---e~~~~~~~l~~~l~~L~erEr~Il~lry~e~--~Tl~eI  230 (261)
T PRK06288        156 GTSVVSLNDLLFLGDENDEVSLMDTLEDPAAMNPDEII---EKEEIKRVIVEAINTLPEREKKVITLYYYED--LTLKEI  230 (261)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCHHHHH---HHHHHHHHHHHHHHCCCHHHHHHHHHHCCCC--CCHHHH
T ss_conf             69974767776579998643087870588989999999---9999999999998708999999999980799--889999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99977899999999999999999999974
Q gi|254780611|r  259 SSEFEVSRERVRQIEARAFKKVQESIQKQ  287 (302)
Q Consensus       259 a~~lgiS~eRVrQI~~~AL~kLR~~l~~~  287 (302)
T Consensus       231 a~~lgiS~eRVrQie~~AL~kLR~~L~~~  259 (261)
T PRK06288        231 GEVLGVTESRISQIHTKAVLQLRAKLAKV  259 (261)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99979789999999999999999999861