HHsearch alignment for GI: 254780611 and conserved domain: PRK07670

>PRK07670 RNA polymerase sigma factor SigD; Validated.
Probab=100.00  E-value=0  Score=416.72  Aligned_cols=241  Identities=21%  Similarity=0.303  Sum_probs=203.2

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             999999999998285999999999430778756555579---99988899999988899898621853456899975778
Q gi|254780611|r   32 QEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRG---YGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWW  108 (302)
Q Consensus        32 eee~~l~~~~~~~gd~~Ar~~Li~~nlrlV~~iA~~y~~---~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~w  108 (302)
T Consensus         2 ~ee~~l~~~~~~~gD~~Ar~~LV~~nl~LV~~ia~r~~~~~~~~v~~eDLiQeG~iGLi~AiekFDp~~G~rFsTYA~~w   81 (250)
T PRK07670          2 YEDQKLWDRWKEERDPEAADDLIRRYMPLVTYHVQRISAGLPKSVSKDDLKSLGMLGLYDALEKFDPSRDLKFDTYASFR   81 (250)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             78999999998859999999999981999999999997048999988899999999999999960986699907721999


Q ss_pred             HHHHHHHHHHCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCC--CCCCCCH
Q ss_conf             99999985320246001102300358999999997887866244788824677888618983211000000--1223433
Q gi|254780611|r  109 IKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCR--LAGDESL  186 (302)
Q Consensus       109 Ir~~I~~~i~~~~~~IRiP~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~--~~~~~SL  186 (302)
T Consensus        82 Ir~aI~~~lr~~~~---lpr~-----~~~~~~ki~~~~~~l~~~~gr~ps~~eia~~lg~s~~~v~~~~~~~~~~~~~Sl  153 (250)
T PRK07670         82 IRGAIIDGLRKEDW---LPRS-----SREKTKKVEAAIEKLEQRYMRNVTPSEVAAELGMSEEEVVTTMNEGFFANLLSI  153 (250)
T ss_pred             HHHHHHHHHHHCCC---CHHH-----HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999874254---0099-----999999999999999998389998889987719999999999998754798036


Q ss_pred             HHHCCCCCCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCH
Q ss_conf             55202323453200000123568705655666666677799999962199999999999827888889899999977899
Q gi|254780611|r  187 NALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSR  266 (302)
Q Consensus       187 d~~i~~~d~~~~~~~d~l~~~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~  266 (302)
T Consensus       154 d~~~~~~~~~~-~~~~~~~d~~~~~pe---~~~~~~~~~~~L~~~l~~L~~rEr~Vl~l~y~--e~~Tl~eIa~~lgvS~  227 (250)
T PRK07670        154 DEKLHDQDDGE-NVQVMIRDDKAVTPE---EKLVKEELIEQLAEKIKELNEKEQLVISLFYK--EELTLTEIGQVLNLST  227 (250)
T ss_pred             CCCCCCCCCCC-HHHHHHHCCCCCCHH---HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCC--CCCCHHHHHHHHCCCH
T ss_conf             77777888850-477888524679999---99999999999999985589999999999748--9868999999989799


Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999997
Q gi|254780611|r  267 ERVRQIEARAFKKVQESIQK  286 (302)
Q Consensus       267 eRVrQI~~~AL~kLR~~l~~  286 (302)
T Consensus       228 erVrQi~~~AL~kLr~~l~k  247 (250)
T PRK07670        228 SRISQIHSKALFKLKKLLEK  247 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999998