HHsearch alignment for GI: 254780611 and conserved domain: PRK09639

>PRK09639 RNA polymerase sigma factor SigX; Provisional.
Probab=99.39  E-value=7.3e-11  Score=92.14  Aligned_cols=161  Identities=12%  Similarity=0.103  Sum_probs=108.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             99999999943077875655557999988899999988899898621853456899975778999999853202460011
Q gi|254780611|r   47 LSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKI  126 (302)
Q Consensus        47 ~~Ar~~Li~~nlrlV~~iA~~y~~~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~wIr~~I~~~i~~~~~~IRi  126 (302)
T Consensus         2 eeAF~~ly~~y~~~l~~~~~~~~~d~~~AeDl~Qe~flk~~~~--~~~~--~~~~~~wL~~ia~n~~~d~~R~~~-----   72 (166)
T PRK09639          2 EETFEDLFKQYYQDVVQQIIYIVKDRTQAEDLAQEVFLRLLRS--DWKG--IENEKGWLIKSARNVAYNYFRSEK-----   72 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHC--CCCC--CCCHHHHHHHHHHHHHHHHHHHHH-----
T ss_conf             8999999999999999999999299999999999999999872--6354--467899999999999999999884-----


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCHHCCCCC
Q ss_conf             02300358999999997887866244788824677888618983211000000122343355202323453200000123
Q gi|254780611|r  127 GTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVY  206 (302)
Q Consensus       127 P~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~~~~SLd~~i~~~d~~~~~~~d~l~~  206 (302)
T Consensus        73 -----------------~~~~~~~---------------------------------~~~~-------~~~-------~~   88 (166)
T PRK09639         73 -----------------RHRARIL---------------------------------GEFQ-------WQE-------EQ   88 (166)
T ss_pred             -----------------HHHHHHC---------------------------------CCHH-------CCC-------CC
T ss_conf             -----------------0201000---------------------------------0100-------013-------45


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             56870565566666667779999996219999999999982788888989999997789999999999999999999997
Q gi|254780611|r  207 DHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQK  286 (302)
Q Consensus       207 ~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~~~AL~kLR~~l~~  286 (302)
T Consensus        89 ~~~~~e~~~~~----~~~~~~l~~~l~~Lp~~~r~v~~l~~-~g--~s~~EIA~~l~is~~tVk~~l~RA~~~Lr~~le~  161 (166)
T PRK09639         89 IDSSPEEIWIR----KEEITKVQEVLAKMTERDRTVLLLRF-SG--YSYKEIAQALGIDESSVGTTLHRAKKKFRKIYEQ  161 (166)
T ss_pred             CCCCHHHHHHH----HHHHHHHHHHHHHCCHHHHHHHHHHH-HC--CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             57997899998----99999999998839999999999999-38--9999999998919999999999999999999998


Q ss_pred             H
Q ss_conf             4
Q gi|254780611|r  287 Q  287 (302)
Q Consensus       287 ~  287 (302)
T Consensus       162 ~  162 (166)
T PRK09639        162 M  162 (166)
T ss_pred             H
T ss_conf             7