HHsearch alignment for GI: 254780611 and conserved domain: PRK09958

>PRK09958 DNA-binding transcriptional activator EvgA; Provisional.
Probab=97.18  E-value=0.0013  Score=43.57  Aligned_cols=47  Identities=13%  Similarity=0.241  Sum_probs=41.0

Q ss_pred             HHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             62199999999999827888889899999977899999999999999999
Q gi|254780611|r  232 MSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQ  281 (302)
Q Consensus       232 l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~~~AL~kLR  281 (302)
T Consensus       141 ~~~Lt~RE~eVL~ll~---~G~snkeIA~~L~iS~~TV~~h~~~i~~KL~  187 (204)
T PRK09958        141 LDSLSKQEISVMRYIL---DGKDNNDIAEKMFISNKTVSTYKSRLMEKLE  187 (204)
T ss_pred             CCCCCHHHHHHHHHHH---CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
T ss_conf             2568999999999998---6999999998978899999999999999848