HHsearch alignment for GI: 254780611 and conserved domain: PRK10188

>PRK10188 DNA-binding transcriptional activator SdiA; Provisional.
Probab=96.68  E-value=0.0067  Score=38.92  Aligned_cols=47  Identities=17%  Similarity=0.189  Sum_probs=40.1

Q ss_pred             CCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             19999999999982788888989999997789999999999999999999
Q gi|254780611|r  234 VLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQES  283 (302)
Q Consensus       234 ~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~~~AL~kLR~~  283 (302)
T Consensus       179 ~LT~RE~E~L~W~A---~GKTs~EIa~IL~ISe~TV~fHl~na~~KL~a~  225 (240)
T PRK10188        179 NFSKREKEILKWTA---EGKTSAEIAMILSISENTVNFHQKNMQKKFNAP  225 (240)
T ss_pred             CCCHHHHHHHHHHH---CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89989999999997---799999999883999999999999999995899