HHsearch alignment for GI: 254780611 and conserved domain: PRK12469

>PRK12469 RNA polymerase factor sigma-54; Provisional.
Probab=96.82  E-value=0.047  Score=33.27  Aligned_cols=43  Identities=14%  Similarity=0.223  Sum_probs=30.0

Q ss_pred             HHCCCHHHHHHHHH---------HHC-CC----CCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             62199999999999---------827-88----888989999997789999999999
Q gi|254780611|r  232 MSVLNPRERRIFEA---------RRL-QE----NPVTLENLSSEFEVSRERVRQIEA  274 (302)
Q Consensus       232 l~~L~~rEr~II~~---------ry~-~~----~~~Tl~EIa~~lgiS~eRVrQI~~  274 (302)
T Consensus       329 i~~i~~R~~Tl~~v~~~Iv~~Q~~Ff~~G~~~lkPL~lkdiA~~lglheSTVSRav~  385 (475)
T PRK12469        329 IRNAQQRFDTIQRVAECIVARQRDFFRYGEIALKPLVLRDVAEELGLHESTVSRATG  385 (475)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCCHHHHHHC
T ss_conf             999999999999999999999999984785003673499999981998203768862