HHsearch alignment for GI: 254780611 and conserved domain: PRK12515

>PRK12515 RNA polymerase sigma factor; Provisional.
Probab=99.72  E-value=2.5e-15  Score=121.98  Aligned_cols=175  Identities=19%  Similarity=0.247  Sum_probs=125.9

Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999999982859999999994307787565555799998889999998889989862185345689997577899999
Q gi|254780611|r   34 EYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAM  113 (302)
Q Consensus        34 e~~l~~~~~~~gd~~Ar~~Li~~nlrlV~~iA~~y~~~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~wIr~~I  113 (302)
T Consensus         9 D~~Lv~~~~-~gd~~Af~~L~~ry~~~l~~~~~~~~~~~~~AeDivQe~Fl~~~~~~~~~~~~--~~~~~WL~~Iarn~~   85 (189)
T PRK12515          9 DEMLLARIA-QGDRTAMHTLYGRHHVRVYRFGLRLVRDEQTAEDLVSEVFLDVWRQAGQFEGR--SQVSTWLLSIARFKA   85 (189)
T ss_pred             HHHHHHHHH-HCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHH
T ss_conf             999999999-37799999999999999999999992999999999999999999865102530--229999999999999


Q ss_pred             HHHHHCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCC
Q ss_conf             98532024600110230035899999999788786624478882467788861898321100000012234335520232
Q gi|254780611|r  114 QEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSS  193 (302)
Q Consensus       114 ~~~i~~~~~~IRiP~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~~~~SLd~~i~~~  193 (302)
T Consensus        86 ~~~----------------------~r~~~~-------~~~~--------------~~~-----------------~---  102 (189)
T PRK12515         86 LSA----------------------LRQRKD-------EEID--------------DEA-----------------A---  102 (189)
T ss_pred             HHH----------------------HHHCCC-------CCCC--------------HHH-----------------H---
T ss_conf             999----------------------985133-------6665--------------456-----------------7---


Q ss_pred             CCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             34532000001235687056556666666777999999621999999999998278888898999999778999999999
Q gi|254780611|r  194 DKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIE  273 (302)
Q Consensus       194 d~~~~~~~d~l~~~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~  273 (302)
T Consensus       103 ----~----~~~~~~~~~e~~~----~~~~~~~~l~~~l~~L~~~~R~vi~l~~~e~--~s~~EIA~~lgis~~tV~~~l  168 (189)
T PRK12515        103 ----A----AIEDGSDTPEVAL----QKKDTSAILRACIAKLSPAHREIIDLVYYHE--KSVEEVGEIVGIPESTVKTRM  168 (189)
T ss_pred             ----H----HCCCCCCCHHHHH----HHHHHHHHHHHHHHCCCHHHHHHHHHHHHCC--CCHHHHHHHHCCCHHHHHHHH
T ss_conf             ----6----3367789988999----8999999999998759999999999999849--999999999892999999999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999740
Q gi|254780611|r  274 ARAFKKVQESIQKQV  288 (302)
Q Consensus       274 ~~AL~kLR~~l~~~~  288 (302)
T Consensus       169 ~RAr~~Lr~~L~~~g  183 (189)
T PRK12515        169 FYARKKLAELLKAAG  183 (189)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999728