HHsearch alignment for GI: 254780611 and conserved domain: PRK12522

>PRK12522 RNA polymerase sigma factor; Provisional.
Probab=99.57  E-value=6.9e-13  Score=105.67  Aligned_cols=170  Identities=11%  Similarity=0.117  Sum_probs=117.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             99999999943077875655557999988899999988899898621853456899975778999999853202460011
Q gi|254780611|r   47 LSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKI  126 (302)
Q Consensus        47 ~~Ar~~Li~~nlrlV~~iA~~y~~~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~wIr~~I~~~i~~~~~~IRi  126 (302)
T Consensus         2 Eeafe~L~~~y~~~l~~~~~~~~~~~~~AeDl~Qe~flk~~~~~~~~~~~~--~~~~WL~~Ia~N~~~d~~Rk~~r----   75 (173)
T PRK12522          2 EEKVEELIDIYKDQIYSLCYKLAKTKEDAEDIFQETWIKVFSSRHQLSYVE--NYKKWITTICVRTFYDFYRKKKR----   75 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHHHHHHHHCC----
T ss_conf             799999999999999999999919999999999999999999777668854--48999999999999999998634----


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCHHCCCCC
Q ss_conf             02300358999999997887866244788824677888618983211000000122343355202323453200000123
Q gi|254780611|r  127 GTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVY  206 (302)
Q Consensus       127 P~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~~~~SLd~~i~~~d~~~~~~~d~l~~  206 (302)
T Consensus        76 ------------------~~~~~~~---------------------------------~~~----~~~~~-----~~~~~   95 (173)
T PRK12522         76 ------------------WKDRILD---------------------------------LFH----KEDGG-----EIEFA   95 (173)
T ss_pred             ------------------CCCCCCC---------------------------------CCC----HHHHH-----CCCCC
T ss_conf             ------------------1211101---------------------------------000----10000-----12356


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             56870565566666667779999996219999999999982788888989999997789999999999999999999997
Q gi|254780611|r  207 DHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQK  286 (302)
Q Consensus       207 ~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~~~AL~kLR~~l~~  286 (302)
T Consensus        96 ~~~~~~~~~~~----~~~~~~l~~~l~~L~~~~R~vi~L~~~~~--~s~~EIA~~l~is~~tVksrl~rAr~~Lr~~Le~  169 (173)
T PRK12522         96 DDVNISEEFIQ----KVEAEMIREVIQLLNEKYKTVLVLYYYEQ--YSYKEMSEILNIPIGTVKYRLNYAKKQMREHLEG  169 (173)
T ss_pred             CCCCCHHHHHH----HHHHHHHHHHHHCCCHHHHHHHHHHHHCC--CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             77885299999----99999999999819999999999999839--9999999998939999999999999999998756


Q ss_pred             HH
Q ss_conf             40
Q gi|254780611|r  287 QV  288 (302)
Q Consensus       287 ~~  288 (302)
T Consensus       170 ~~  171 (173)
T PRK12522        170 FV  171 (173)
T ss_pred             CC
T ss_conf             51