HHsearch alignment for GI: 254780611 and conserved domain: pfam07638

>pfam07638 Sigma70_ECF ECF sigma factor. These proteins are probably RNA polymerase sigma factors belonging to the extra-cytoplasmic function (ECF) subfamily and show sequence similarity to pfam04542 and pfam04545.
Probab=99.54  E-value=1.1e-12  Score=104.29  Aligned_cols=175  Identities=14%  Similarity=0.142  Sum_probs=115.0

Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-----CHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             999999998285999999999430778756555579999-----888999999888998986218534568999757789
Q gi|254780611|r   35 YVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGL-----PISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWI  109 (302)
Q Consensus        35 ~~l~~~~~~~gd~~Ar~~Li~~nlrlV~~iA~~y~~~g~-----~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~wI  109 (302)
T Consensus         5 teLi~~~k-~GD~~Af~~L~~~y~~~l~r~a~~~l~~~~~~ed~~~~~lvqe~Flrl~~~~~~~~~~~~~~f~~~l~~i~   83 (185)
T pfam07638         5 TQLLQQVK-DGDAAATEQLLPLVYDELRRLAGSKLQNERRGHTLQPTALVHEAFVRLVDTEDFPDWSGRGHFFAAAAEAM   83 (185)
T ss_pred             HHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999998-67799999999999999999999996353210167789999999999984020236775689999999999


Q ss_pred             HHHHHHHHHCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             99999853202460011023003589999999978878662447888246778886189832110000001223433552
Q gi|254780611|r  110 KAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNAL  189 (302)
Q Consensus       110 r~~I~~~i~~~~~~IRiP~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~~~~SLd~~  189 (302)
T Consensus        84 ~~~~id~~R~~~~----------------------~-~----~~~~~~-------------------------~~~~~~~  111 (185)
T pfam07638        84 RRILIDHARRRQR----------------------Q-K----RGGDVQ-------------------------RRELDEV  111 (185)
T ss_pred             HHHHHHHHHHHHH----------------------H-H----CCCCCH-------------------------HCCHHHH
T ss_conf             9999999998886----------------------6-1----266410-------------------------1010110


Q ss_pred             CCCCCCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHH
Q ss_conf             02323453200000123568705655666666677799999962199999999999827888889899999977899999
Q gi|254780611|r  190 INSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERV  269 (302)
Q Consensus       190 i~~~d~~~~~~~d~l~~~~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRV  269 (302)
T Consensus       112 ~~~-------------~~~~~~-~~~~------~l~-~~~~~l~~Lpp~~r~v~~L~~~eg--lS~~EIAe~Lgis~~TV  168 (185)
T pfam07638       112 VDN-------------GDSPNP-DLLL------DLD-EALEQLFSLSPRQARLVELRFFAG--LSNDEIAERLGVSERTV  168 (185)
T ss_pred             CCC-------------CCCCCH-HHHH------HHH-HHHHHHHCCCHHHHHHHHHHHHCC--CCHHHHHHHHCCCHHHH
T ss_conf             014-------------568987-8899------999-999998648998888988899759--99999999979699899


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999
Q gi|254780611|r  270 RQIEARAFKKVQESIQ  285 (302)
Q Consensus       270 rQI~~~AL~kLR~~l~  285 (302)
T Consensus       169 k~rl~~Ar~~Lr~~l~  184 (185)
T pfam07638       169 ERNWALARAWLHRELR  184 (185)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             9999999999998824