RPSBLAST alignment for GI: 254780611 and conserved domain: TIGR02937

>gnl|CDD|163078 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family. Several PFAM models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs. Length = 158
 Score = 47.0 bits (112), Expect = 7e-06
 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 48  SAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMW 107
            A   L   +L L+ + A  Y G      ++V E  + L++A+ +FDPE  F+   +   
Sbjct: 1   EAFEELYERYLPLLYRYARRYLGDDADAEDLVQEAFLKLLEALDRFDPEGSFK--AWLFR 58

Query: 108 WIKAAMQEYI 117
             +  + +Y+
Sbjct: 59  IARNLILDYL 68