RPSBLAST alignment for GI: 254780611 and conserved domain: PRK05658

>gnl|CDD|180186 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated. Length = 619
 Score = 42.5 bits (101), Expect = 1e-04
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 223 NRRNMLTRSMSVLNPRERRIFEAR-RLQEN-PVTLENLSSEFEVSRERVRQIEARAFKK 279
           + R   T  ++ L PRE ++   R  +  N   TLE +  +F+V+RER+RQIEA+A +K
Sbjct: 545 SLREATTDVLASLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRK 603