RPSBLAST alignment for GI: 254780611 and conserved domain: PRK07598

>gnl|CDD|181056 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated. Length = 415
 Score = 88.0 bits (218), Expect = 3e-18
 Identities = 67/238 (28%), Positives = 127/238 (53%), Gaps = 13/238 (5%)

Query: 47  LSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSM 106
           L A   ++ ++LRLVV +A  Y+  GL + ++V EG +GL +AV+KFDP +G+R +TY+ 
Sbjct: 174 LRAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAY 233

Query: 107 WWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKL 166
           WWI+  +   I      +++     +K     L ++K   + I+    +   +  IA++L
Sbjct: 234 WWIRQGITRAIATQSRTIRLPVHITEK-----LNKIKKAQRKISQEKGRTPTIEDIAQEL 288

Query: 167 NVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRN 226
            ++ ++V  +  R+    SL   +   DK+ ++  D L  D    E++L+    R++ + 
Sbjct: 289 EMTPTQVREVLLRVPRSVSLETKV-GKDKD-TELGDLLETDDISPEEMLM----RESLQR 342

Query: 227 MLTRSMSVLNPRERRIFEAR--RLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQE 282
            L   ++ L  RER +   R      +  +L  +    ++SRERVRQIE++A +K+++
Sbjct: 343 DLQHLLADLTSRERDVIRMRFGLADGHTYSLAEIGRALDLSRERVRQIESKALQKLRQ 400