Query         gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 503
No_of_seqs    421 out of 678
Neff          10.1
Searched_HMMs 33803
Date          Wed Jun  1 19:17:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780612.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2hev_F Tumor necrosis factor   57.3     4.1 0.00012   19.9   1.1   38  435-484    50-87  (137)
  2 >3e59_A Pyoverdine biosynthesi  56.6      12 0.00034   16.8   3.3   42  426-481     4-45  (55)
  3 >2uv4_A 5'-AMP-activated prote  53.3      13 0.00039   16.4   3.1   31  450-480    20-51  (61)
  4 >3kzt_A Uncharacterized protei  52.2      14 0.00041   16.2   4.5   46  424-480    88-139 (143)
  5 >2pc6_A Probable acetolactate   51.4      14 0.00043   16.1   3.5   52  429-486    31-82  (85)
  6 >2hew_F Tumor necrosis factor   49.5       9 0.00027   17.5   1.8   37  435-483    51-89  (152)
  7 >1nsx_A Galactose mutarotase;   49.4     8.5 0.00025   17.7   1.6  112  361-473   136-252 (347)
  8 >1xs5_A 29 kDa protein, membra  47.0      15 0.00044   16.0   2.6   26  441-466    21-46  (111)
  9 >3gxa_A Outer membrane lipopro  43.7      18 0.00053   15.5   2.6   26  441-466    20-45  (110)
 10 >3ir1_A Outer membrane lipopro  43.7      18 0.00053   15.5   2.6   26  441-466    20-45  (110)
 11 >1p99_A Hypothetical protein P  42.8      19 0.00056   15.3   2.6   26  441-466    20-45  (112)
 12 >1mox_A Epidermal growth facto  39.7       4 0.00012   20.0  -1.3   41  432-472    57-100 (192)
 13 >2p9m_A Hypothetical protein M  39.5      22 0.00064   14.9   2.8   43  435-480    14-57  (75)
 14 >2deb_A CPT II, carnitine O-pa  39.0      22 0.00065   14.8   2.8   98  390-487    84-223 (285)
 15 >2dew_X Protein-arginine deimi  38.7      12 0.00036   16.7   1.0   31  447-477    73-111 (116)
 16 >1yy9_A Epidermal growth facto  38.6       4 0.00012   20.0  -1.4   32  433-464    58-89  (192)
 17 >1n8y_C Protooncoprotein; tyro  37.9     4.4 0.00013   19.7  -1.3   42  433-474    55-99  (200)
 18 >3kxr_A Magnesium transporter,  37.4      23 0.00069   14.7   2.6   43  435-480    11-54  (94)
 19 >2o16_A Acetoin utilization pr  37.4      23 0.00069   14.7   2.7   42  437-481    13-55  (80)
 20 >1t1u_A Choline O-acetyltransf  37.3      23 0.00069   14.7   3.1  119  366-487    70-240 (300)
 21 >2fgc_A Acetolactate synthase,  37.1      23 0.00069   14.6   4.1   53  428-486    30-82  (87)
 22 >1f5m_A GAF; CGMP binding, sig  36.1      15 0.00045   16.0   1.2   59  441-499   110-174 (180)
 23 >2phd_A Gentisate 1,2-dioxygen  34.9      24  0.0007   14.6   2.1   78  379-461    66-145 (150)
 24 >1m6b_A C-, receptor protein-t  34.7     3.8 0.00011   20.1  -2.0   28  437-464    65-92  (195)
 25 >2d1h_A ST1889, 109AA long hyp  33.4      27 0.00079   14.2   4.4   54  447-500    49-103 (109)
 26 >1tp9_A Peroxiredoxin, PRX D (  33.4      27 0.00079   14.2   3.4   36  437-472    69-104 (162)
 27 >1nm8_A Carnitine O-acetyltran  33.2      27  0.0008   14.2   2.3   97  389-486    86-236 (294)
 28 >1ykd_A Adenylate cyclase; GAF  31.9      28 0.00084   14.1   2.1   59  424-482    58-122 (153)
 29 >3lq0_A Proastacin; metallopep  31.3      11 0.00032   17.0  -0.2   60  435-502    13-76  (235)
 30 >1xl7_A COT, peroxisomal carni  31.2      18 0.00054   15.4   1.0  122  366-487    69-238 (297)
 31 >1zor_A Isocitrate dehydrogena  31.0      20 0.00059   15.2   1.1   29  382-410     2-38  (43)
 32 >1rlm_A Phosphatase; HAD famil  30.8      29 0.00087   14.0   3.4   34  434-467    57-102 (105)
 33 >3bbo_V Ribosomal protein L23;  30.2      25 0.00074   14.5   1.5   59  434-492   127-190 (198)
 34 >3hw5_A Polymerase acidic prot  30.0      11 0.00033   16.9  -0.3   29  363-392   199-227 (261)
 35 >1vq8_S 50S ribosomal protein   29.2      31 0.00092   13.8   6.4   53  439-491    26-80  (85)
 36 >1xrs_B D-lysine 5,6-aminomuta  29.1      31 0.00093   13.8   4.0   68  435-502    83-167 (168)
 37 >2yzq_A Putative uncharacteriz  28.5      32 0.00095   13.7   3.6   31  451-481    19-50  (77)
 38 >3ddj_A CBS domain-containing   28.2      32 0.00096   13.7   2.0   29  451-479    21-50  (51)
 39 >3krn_A Protein C14A4.5, confi  27.9      33 0.00097   13.6   3.2   61  426-496     5-69  (102)
 40 >2nn6_D Exosome complex exonuc  27.2      34   0.001   13.5   3.2   61  426-496     3-65  (88)
 41 >2rgx_A Adenylate kinase; tran  26.9      30 0.00089   13.9   1.5   64  434-497    73-144 (148)
 42 >2nn6_B Exosome complex exonuc  26.9      34   0.001   13.5   3.2   61  426-496     2-63  (92)
 43 >2yzy_A Putative uncharacteriz  25.7      36  0.0011   13.4   3.2   42  362-408     5-46  (108)
 44 >1tp6_A Hypothetical protein P  25.7      35  0.0011   13.4   1.7   58  427-484    28-94  (128)
 45 >3b4t_A Ribonuclease PH; RNAse  25.3      36  0.0011   13.3   6.1   61  426-496     5-68  (104)
 46 >2b6b_D CD209 antigen; cryo EM  24.7      27  0.0008   14.2   0.9   22  430-451    13-34  (78)
 47 >2jtn_A LIM domain-binding pro  23.9      37  0.0011   13.3   1.5   17  429-445    45-61  (73)
 48 >1g62_A Ribosome anti-associat  23.9      37  0.0011   13.3   1.5   28  425-452   144-171 (224)
 49 >2yzq_A Putative uncharacteriz  23.6      39  0.0012   13.1   2.3   31  450-480    36-67  (79)
 50 >3k2n_A Sigma-54-dependent tra  23.6      39  0.0012   13.1   6.8   87  413-499    69-161 (177)
 51 >3i2t_A Epidermal growth facto  23.4     7.1 0.00021   18.3  -2.3   86  377-467    43-146 (193)
 52 >3da0_A Cleaved chimeric recep  23.1      40  0.0012   13.0   3.2   48  345-400     1-60  (136)
 53 >2al3_A TUG long isoform; TUG   23.0      40  0.0012   13.0   3.9   34  465-498    11-44  (90)
 54 >2hng_A Hypothetical protein;   22.6      41  0.0012   13.0   2.9   46  370-415    31-79  (127)
 55 >2qyg_A Ribulose bisphosphate   22.5      41  0.0012   13.0   2.1   19  484-502   249-267 (288)
 56 >1yew_A Particulate methane mo  22.4      41  0.0012   12.9   3.4  109  363-481    25-145 (153)
 57 >3fcg_A F1 capsule-anchoring p  22.4      37  0.0011   13.3   1.2   28  453-480    51-78  (90)
 58 >2oux_A Magnesium transporter;  22.2      42  0.0012   12.9   2.0   30  451-480    18-48  (84)
 59 >3bu7_A Gentisate 1,2-dioxygen  22.1      42  0.0012   12.9   2.4   90  375-477    56-153 (156)
 60 >2nn6_C Exosome complex exonuc  21.6      43  0.0013   12.8   6.4   60  426-495     7-69  (92)
 61 >2r7k_A 5-formaminoimidazole-4  21.6      43  0.0013   12.8   1.9   29  434-465    18-46  (58)
 62 >3dnx_A Uncharacterized protei  21.2      43  0.0013   12.8   3.8   21  378-403    45-65  (153)
 63 >2f1f_A Acetolactate synthase   20.9      44  0.0013   12.7   4.8   51  429-485    31-82  (85)
 64 >1wzn_A SAM-dependent methyltr  20.8      44  0.0013   12.7   2.4   40  435-475   136-175 (193)
 65 >1f8n_A Lipoxygenase-1; dioxyg  20.0      42  0.0012   12.9   1.1   17  393-409    79-97  (152)

No 1  
>>2hev_F Tumor necrosis factor ligand superfamily member 4; cytokine, receptor-ligand complex, TNFSF, TNFRSF; HET: NAG; 2.41A {Homo sapiens} (F:)
Probab=57.32  E-value=4.1  Score=19.88  Aligned_cols=38  Identities=34%  Similarity=0.532  Sum_probs=29.1

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCC
Q ss_conf             46982899817882568877999730781168788379967899961587
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGK  484 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~  484 (503)
                      =.||||||-|...-.            +=+.|=|-|+|||--|..+-|+-
T Consensus        50 ~CDG~YlisLKG~fs------------qelsi~L~yRkg~~Pl~~Ln~~~   87 (137)
T 2hev_F           50 NCDGFYLISLKGYFS------------QEVDISLHYQKDEEPLFQLKKVR   87 (137)
T ss_dssp             CBCEEEEEEEEEEEE------------EEEEEEEESSTTSCCSEEEEEEE
T ss_pred             ECCCEEEEEEEEEEC------------CEEEEEEEEECCCCCHHHHCCCC
T ss_conf             579669999966623------------31579999846888523222452


No 2  
>>3e59_A Pyoverdine biosynthesis protein PVCA; isonitrIle, paerucumarin, 2-isocyano-6,7- dihydroxycoumarin, transferase; HET: PGE; 2.10A {Pseudomonas aeruginosa} (A:276-330)
Probab=56.61  E-value=12  Score=16.80  Aligned_cols=42  Identities=10%  Similarity=-0.016  Sum_probs=31.6

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEEC
Q ss_conf             63110016746982899817882568877999730781168788379967899961
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTID  481 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~e  481 (503)
                      +|--|+++++.++|.|.-        .++.+.|-.+      |||+|||=--..|+
T Consensus         4 TPWHgVAv~~~g~~vLmk--------Rseae~lga~------LV~~~GrPSHY~~~   45 (55)
T 3e59_A            4 TPWHGVAVNTEDRFVLMK--------RSEVLELGGE------LVQINGQPSHYRLP   45 (55)
T ss_dssp             CGGGSEEEECSSSEEEEC--------HHHHHHTTCE------EEEETTEEEEEEC-
T ss_pred             CCCCCCEEECCCCEEEEE--------HHHHHHCCCC------EEEECCEEEEEEEC
T ss_conf             998730588179669965--------5545424673------89889987578872


No 3  
>>2uv4_A 5'-AMP-activated protein kinase subunit gamma-1; transferase, CBS domain, lipid synthesis, fatty acid biosynthesis; HET: AMP; 1.33A {Homo sapiens} PDB: 2uv5_A* 2uv6_A* 2uv7_A* (A:92-152)
Probab=53.33  E-value=13  Score=16.38  Aligned_cols=31  Identities=10%  Similarity=-0.040  Sum_probs=26.1

Q ss_pred             HHHHHHHHHHCCCCEEEEEEECCCC-EEEEEE
Q ss_conf             6887799973078116878837996-789996
Q gi|254780612|r  450 DPFRNSKILEEYRFIDIPITYRSGQ-KILFTI  480 (503)
Q Consensus       450 ~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~  480 (503)
                      ....=++||+++++--+|++..||| .+|||.
T Consensus        20 ~i~~~~~~m~~~~~~~lpVvd~~g~lvGiit~   51 (61)
T 2uv4_A           20 TLETIINRLVEAEVHRLVVVDENDVVKGIVSL   51 (61)
T ss_dssp             BHHHHHHHHHHHTCSEEEEECTTSBEEEEEEH
T ss_pred             CHHHHHHHHHHCCCEEEEEECCCCEEEEEEEH
T ss_conf             69999998987593499999489979999889


No 4  
>>3kzt_A Uncharacterized protein; protein of unknown function, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} (A:)
Probab=52.19  E-value=14  Score=16.21  Aligned_cols=46  Identities=15%  Similarity=0.215  Sum_probs=34.6

Q ss_pred             CCCCCCCEEEE-ECCCEEEEECCCCCHHHHHHHHHHHCCCCEE---EE--EEECCCCEEEEEE
Q ss_conf             46631100167-4698289981788256887799973078116---87--8837996789996
Q gi|254780612|r  424 PSVLIDSNIFV-ISKNSYLISLKGSEEDPFRNSKILEEYRFID---IP--ITYRSGQKILFTI  480 (503)
Q Consensus       424 ~g~~l~~~~~k-v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~d---ip--~~y~ngrra~~~~  480 (503)
                      .-+-|-.|-|| +.||.|||-+-+..           +.+|..   ||  ||..+|||-|--|
T Consensus        88 p~~~~KTL~Vr~l~g~WYmV~y~~~~-----------~~~~~r~v~IpvRmvd~DgkrkIgyi  139 (143)
T 3kzt_A           88 GENDXKTLSVKHLNDNWYEVNYTSAK-----------GSQYERAVSIPVRVVNVDGQYLIDDI  139 (143)
T ss_dssp             CTTSGGGCEEEEEETTEEEEEEEETT-----------TSTTCEEEEEEEEEEEETTEEEEEEE
T ss_pred             CCCHHHHCCHHHHCCCEEEEEEEECC-----------CCCHHHHEECCEEEEEECCEEEEEEE
T ss_conf             83233323444414674787752035-----------75023314311689861780789873


No 5  
>>2pc6_A Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} (A:81-165)
Probab=51.38  E-value=14  Score=16.12  Aligned_cols=52  Identities=19%  Similarity=0.310  Sum_probs=38.5

Q ss_pred             CCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCCH
Q ss_conf             1001674698289981788256887799973078116878837996789996158768
Q gi|254780612|r  429 DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKG  486 (503)
Q Consensus       429 ~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~~g  486 (503)
                      -|..+-|+.+++.|=|++.....+.=+++|+..+-++|   -+.|+.|   |++|.-+
T Consensus        31 ~akivdv~~~s~iiE~tG~~~kid~fi~~l~~~gI~Ei---~RTG~iA---i~Rg~~~   82 (85)
T 2pc6_A           31 RGNIIDVTNELYTIELTGTRSKLDGFLQAVDCNLILEI---ARTGVSG---LSRGERV   82 (85)
T ss_dssp             TCEEEEEETTEEEEEEEECHHHHHHHHHHSCGGGEEEE---EECCCEE---EESTTCC
T ss_pred             CCEEEEECCCEEEEEEECCHHHHHHHHHHHCCCCCEEE---ECCCHHE---EECCCCC
T ss_conf             81999845998999994799999999997362387899---8068500---5427634


No 6  
>>2hew_F Tumor necrosis factor ligand superfamily member 4; trimer, TNFSF, cytokine; HET: NAG; 1.45A {Mus musculus} (F:)
Probab=49.45  E-value=9  Score=17.53  Aligned_cols=37  Identities=24%  Similarity=0.413  Sum_probs=25.5

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEE--EECCC
Q ss_conf             46982899817882568877999730781168788379967899--96158
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILF--TIDKG  483 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~--~~ekg  483 (503)
                      =.||||||-|...-.            +-+.|=|-|+|||.-+.  .+-|+
T Consensus        51 ~CDGfYLIsLKG~fS------------qelsi~L~yrkg~~pl~~p~ln~~   89 (152)
T 2hew_F           51 KCDGLYIIYLKGSFF------------QEVKIDLHFREDHNPISIPMLNDG   89 (152)
T ss_dssp             CBCEEEEEEEEEEES------------SCCCEEEECCTTSCCEEECCCTTS
T ss_pred             ECCCEEEEEEEEEEC------------CEEEEEEEEECCCCCCCHHHHCCC
T ss_conf             568669999955513------------314699987358885310121465


No 7  
>>1nsx_A Galactose mutarotase; epimerase, galactose metabolism, isomerase; HET: GAL; 1.75A {Lactococcus lactis} (A:)
Probab=49.44  E-value=8.5  Score=17.71  Aligned_cols=112  Identities=8%  Similarity=0.024  Sum_probs=65.6

Q ss_pred             CCEEEEEEECCCCCEEEEEEECCCCCCCCCEEEEEEEEEECCCCCCCCHHHCC--CCEECCCCCCCC-CCCCCEEEEECC
Q ss_conf             74236763078777179999517898777812889999716888873211032--310213321246-631100167469
Q gi|254780612|r  361 GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLR--RISMRKTDNSPS-VLIDSNIFVISK  437 (503)
Q Consensus       361 ~~aira~i~iP~~~~~~~~~~rrn~d~slpash~~e~~f~~~~~~~~~v~~v~--~~~~k~~e~~~g-~~l~~~~~kv~~  437 (503)
                      .-.++-.+++ +.+++++++++-..|..+|-+...---|.+++..++.|.+..  .-..+.-|.... .+..|....+.+
T Consensus       136 ~~~~~~ty~L-~~~l~~~~~~~n~~~~~~p~~~g~HpYF~l~~~~~~~i~~~~l~~~~~~~~~~~~~~~~~~g~~~~~~~  214 (347)
T 1nsx_A          136 KIEMSVTHSF-DDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKN  214 (347)
T ss_dssp             CEEEEEEEEE-ETTSEEEEEEEEEESSCEECBCEECCEECTTSSTTSCGGGSEEEECEEEECCBCSTTCCBCSCCEECTT
T ss_pred             EEEEEEEEEE-CCCCEEEEEEEEECCCCEEEECCCCCCEECCCCCCCCCEEEEEEEECCEEEEECCCCCCCCCCEECCCC
T ss_conf             8999999996-459848999997437754764065250644775567520079998037589962788776782554779


Q ss_pred             C--EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             8--28998178825688779997307811687883799
Q gi|254780612|r  438 N--SYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSG  473 (503)
Q Consensus       438 ~--~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ng  473 (503)
                      .  -|--++.-.+....++..+.......++-+.+..+
T Consensus       215 ~~~d~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  252 (347)
T 1nsx_A          215 TDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLG  252 (347)
T ss_dssp             STTCCSSCEEHHHHHHCCCHHHHHHTSCEEEEEESSCB
T ss_pred             CCCCCCCCCCCCHHHHCCHHHHCCCCCCCCCEEECCCC
T ss_conf             98656677284542412024411357888634745677


No 8  
>>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} (A:83-193)
Probab=47.01  E-value=15  Score=15.99  Aligned_cols=26  Identities=23%  Similarity=0.452  Sum_probs=22.5

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEE
Q ss_conf             99817882568877999730781168
Q gi|254780612|r  441 LISLKGSEEDPFRNSKILEEYRFIDI  466 (503)
Q Consensus       441 ~v~l~~~~~~~~~n~~ll~~~~w~di  466 (503)
                      -|++.|-...+.|.|.||.+-+||-+
T Consensus        21 ~IaIpnD~sN~~RAL~lL~~~GLItL   46 (111)
T 1xs5_A           21 VIAIPNDSSNEARALRLLEAAGFIRM   46 (111)
T ss_dssp             EEEEECSHHHHHHHHHHHHHTTSCEE
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             35546787289999999998477532


No 9  
>>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} (A:105-214)
Probab=43.72  E-value=18  Score=15.49  Aligned_cols=26  Identities=19%  Similarity=0.262  Sum_probs=23.2

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEE
Q ss_conf             99817882568877999730781168
Q gi|254780612|r  441 LISLKGSEEDPFRNSKILEEYRFIDI  466 (503)
Q Consensus       441 ~v~l~~~~~~~~~n~~ll~~~~w~di  466 (503)
                      -|++.|-.....|-|.||.+-+||-+
T Consensus        20 ~IaIpnD~sN~~RAL~lL~~~GLI~L   45 (110)
T 3gxa_A           20 TVSAPNDPSNFARVLVMLDELGWIKL   45 (110)
T ss_dssp             EEEEECSHHHHHHHHHHHHHTTSSEE
T ss_pred             EEEECCCCCHHHHHHHHHHHCCEEEE
T ss_conf             79941674248999999863680773


No 10 
>>3ir1_A Outer membrane lipoprotein GNA1946; D-methionine cultured, protein binding; 2.15A {Neisseria meningitidis} (A:83-192)
Probab=43.72  E-value=18  Score=15.49  Aligned_cols=26  Identities=19%  Similarity=0.262  Sum_probs=22.8

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEE
Q ss_conf             99817882568877999730781168
Q gi|254780612|r  441 LISLKGSEEDPFRNSKILEEYRFIDI  466 (503)
Q Consensus       441 ~v~l~~~~~~~~~n~~ll~~~~w~di  466 (503)
                      -|++.|-.....|-|.||.+-+||-+
T Consensus        20 ~IaIpnD~sN~~RAL~lL~~~GLI~L   45 (110)
T 3ir1_A           20 TVSAPNDPSNFARVLVMLDELGWIKL   45 (110)
T ss_dssp             EEEEECSHHHHHHHHHHHHHTTSSEE
T ss_pred             EEEEECCCCHHHHHHHHHHHCCEEEE
T ss_conf             89971485178999999987892896


No 11 
>>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} (A:120-231)
Probab=42.85  E-value=19  Score=15.27  Aligned_cols=26  Identities=19%  Similarity=0.298  Sum_probs=22.6

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEE
Q ss_conf             99817882568877999730781168
Q gi|254780612|r  441 LISLKGSEEDPFRNSKILEEYRFIDI  466 (503)
Q Consensus       441 ~v~l~~~~~~~~~n~~ll~~~~w~di  466 (503)
                      -|++.|-..-..|-|.||..-+||-+
T Consensus        20 ~IaIpnDp~N~~RAL~lL~~~GLI~L   45 (112)
T 1p99_A           20 KVVIPNDVSNQARALKLLEAAGLIKL   45 (112)
T ss_dssp             EEEEECSHHHHHHHHHHHHHTTSCEE
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEE
T ss_conf             79961587439999999997596886


No 12 
>>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase/growth factor complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} (A:1-192)
Probab=39.70  E-value=4  Score=20.00  Aligned_cols=41  Identities=17%  Similarity=0.202  Sum_probs=23.6

Q ss_pred             EEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEE---EEEEECC
Q ss_conf             1674698289981788256887799973078116---8788379
Q gi|254780612|r  432 IFVISKNSYLISLKGSEEDPFRNSKILEEYRFID---IPITYRS  472 (503)
Q Consensus       432 ~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~d---ip~~y~n  472 (503)
                      .+|+..||.+|.++++..-..+||.+.|++.-++   --+||.|
T Consensus        57 ~i~eItGyl~i~~~~~~~~~l~NL~iIrG~~l~~~~yaL~V~~N  100 (192)
T 1mox_A           57 TIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSN  100 (192)
T ss_dssp             GCCEESSCEEEESCCCSBCCCTTCCEECCSSCBTTTEEEEEECC
T ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCEECCCCCCCCCEEEEEEEC
T ss_conf             73699879999866646445898277757313257420899976


No 13 
>>2p9m_A Hypothetical protein MJ0922; structural genomics, southeast collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii DSM2661} (A:1-75)
Probab=39.55  E-value=22  Score=14.90  Aligned_cols=43  Identities=12%  Similarity=0.127  Sum_probs=33.3

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-EEEEEE
Q ss_conf             4698289981788256887799973078116878837996-789996
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ-KILFTI  480 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~  480 (503)
                      .+.+++.|.-+..=   ..=+++|++++-.-+|++..||| ..|||+
T Consensus        14 m~~~~vtv~~~~~l---~~a~~~m~~~~i~~lpVvd~~~~lvGiit~   57 (75)
T 2p9m_A           14 XTKNVITAKRHEGV---VEAFEKXLKYKISSLPVIDDENKVIGIVTT   57 (75)
T ss_dssp             SBCSCCCEETTSBH---HHHHHHHHHHTCCEEEEECTTCBEEEEEEH
T ss_pred             CCCCCEEECCCCCH---HHHHHHHHHCCCCEEECCCCCHHHHHHHHH
T ss_conf             88998078895939---999999998698767203554146667777


No 14 
>>2deb_A CPT II, carnitine O-palmitoyltransferase II, mitochondrial; central six-stranded beta-sheet; HET: BOG COA PLM; 1.60A {Rattus norvegicus} PDB: 2fw3_A* 2fyo_A 2rcu_A* 2h4t_A* (A:105-166,A:213-435)
Probab=39.03  E-value=22  Score=14.85  Aligned_cols=98  Identities=9%  Similarity=0.125  Sum_probs=57.2

Q ss_pred             CEEEEEEE----EEECCC-CCCC------CHHHCCCCEECCCCCCCCCCCCCEEE-----------------------EE
Q ss_conf             81288999----971688-8873------21103231021332124663110016-----------------------74
Q gi|254780612|r  390 SITHVMEI----MFSFPK-ESQD------AVVDLRRISMRKTDNSPSVLIDSNIF-----------------------VI  435 (503)
Q Consensus       390 pash~~e~----~f~~~~-~~~~------~v~~v~~~~~k~~e~~~g~~l~~~~~-----------------------kv  435 (503)
                      ++.|++=|    .|.+.= +..|      .|...-...++.+++..|.+|..+..                       .|
T Consensus        84 ~s~HIiVl~~G~~fkl~V~d~~g~~ls~~eL~~qL~~I~~~s~~~~~~~vg~LTs~~R~~WA~~R~~L~~~~N~~sL~~I  163 (285)
T 2deb_A           84 KARHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWAELRQKLIFDGNEETLKKV  163 (285)
T ss_dssp             TCCEEEEEETTEEEEEESBCTTSCBCCHHHHHHHHHHHHHCCCCCCSSCGGGGGGSCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             CCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCHHHHHHHHH
T ss_conf             99749999999999999999998999899999999999857566788886606768778899999998502189999999


Q ss_pred             CCCEEEEECCCCC----HHHHHHHHHHHCC-CCEEE---EEEECCCCEEEEEECCCCCHH
Q ss_conf             6982899817882----5688779997307-81168---788379967899961587689
Q gi|254780612|r  436 SKNSYLISLKGSE----EDPFRNSKILEEY-RFIDI---PITYRSGQKILFTIDKGKKGA  487 (503)
Q Consensus       436 ~~~~f~v~l~~~~----~~~~~n~~ll~~~-~w~di---p~~y~ngrra~~~~ekg~~g~  487 (503)
                      ..-.|.|-|-+..    .+..+++..--.. -|+|-   -||++||+-+++-=-=...|-
T Consensus       164 esalFvvcLDd~~~~~~se~~~~~LhG~g~NRW~DKslq~IV~~nG~~G~~~EHS~~DG~  223 (285)
T 2deb_A          164 DSAVFCLCLDDFPXKDLIHLSHTXLHGDGTNRWFDKSFNLIVAEDGTAAVHFEHSWGDGV  223 (285)
T ss_dssp             HHSSCEEEECSSCCCSHHHHHHHHHTTTSSSCCTTBSEEEEECTTCCEEEEECSTTCCSH
T ss_pred             HHCEEEEECCCCCCCCHHHHHHHHCCCCCCCEEECCCEEEEEECCCCEEEEEECCCCCHH
T ss_conf             757788884789987999999872438861157457607999889868986307887277


No 15 
>>2dew_X Protein-arginine deiminase type IV; histone modification enzyme, hydrolase; 2.10A {Homo sapiens} (X:478-593)
Probab=38.67  E-value=12  Score=16.65  Aligned_cols=31  Identities=29%  Similarity=0.256  Sum_probs=22.5

Q ss_pred             CCHHHHHHHHHHH------CCCCEEEEEEECC--CCEEE
Q ss_conf             8256887799973------0781168788379--96789
Q gi|254780612|r  447 SEEDPFRNSKILE------EYRFIDIPITYRS--GQKIL  477 (503)
Q Consensus       447 ~~~~~~~n~~ll~------~~~w~dip~~y~n--grra~  477 (503)
                      +....+-|..+||      +++-||||.+|..  +++|.
T Consensus        73 ~q~~Id~nr~iLKrElGLte~DIIdvP~LF~~~~~~~a~  111 (116)
T 2dew_X           73 VERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAE  111 (116)
T ss_dssp             HHHHHHHHHHHHHHHHTCCGGGEEEEECCEEECGGGCEE
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHEECCHHEEECCCCCEE
T ss_conf             998655899999987099868824054114775767600


No 16 
>>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} (A:1-192)
Probab=38.57  E-value=4  Score=20.00  Aligned_cols=32  Identities=22%  Similarity=0.269  Sum_probs=17.5

Q ss_pred             EEECCCEEEEECCCCCHHHHHHHHHHHCCCCE
Q ss_conf             67469828998178825688779997307811
Q gi|254780612|r  433 FVISKNSYLISLKGSEEDPFRNSKILEEYRFI  464 (503)
Q Consensus       433 ~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~  464 (503)
                      +|+..||.+|.++++..-..+||.+.|++.-+
T Consensus        58 i~eItGyl~i~~~~~~~~~l~NL~iIrG~~l~   89 (192)
T 1yy9_A           58 IQEVAGYVLIALNTVERIPLENLQIIRGNMYY   89 (192)
T ss_dssp             CCEESSCEEEESCCCSBCCCTTCCEECCSSCS
T ss_pred             CEEEEEEEEEEECCCCEEECCCCCEECCCCCC
T ss_conf             46997689998676562637983677673022


No 17 
>>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} (C:1-200)
Probab=37.86  E-value=4.4  Score=19.71  Aligned_cols=42  Identities=10%  Similarity=0.158  Sum_probs=28.6

Q ss_pred             EEECCCEEEEECCCCCHHHHHHHHHHHCCCCEE---EEEEECCCC
Q ss_conf             674698289981788256887799973078116---878837996
Q gi|254780612|r  433 FVISKNSYLISLKGSEEDPFRNSKILEEYRFID---IPITYRSGQ  474 (503)
Q Consensus       433 ~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~d---ip~~y~ngr  474 (503)
                      +|.=-||.+|..+.+.-....||.+.|+|..++   --++|.|..
T Consensus        55 I~EITGYL~I~~~~~~~~~f~NL~vIrG~~L~~~~yAL~v~~N~~   99 (200)
T 1n8y_C           55 IQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRD   99 (200)
T ss_dssp             CCEESSCEEEESCCCSCCCCTTCCEECCSSCBTTTEEEEEECCCC
T ss_pred             CEEEEEEEEEEECCCCCEECCCCCEECCCCCCCCCCEEEEEECCC
T ss_conf             769845899996354530778810874821105750599984366


No 18 
>>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural genomics, PSI-2; 2.41A {Shewanella oneidensis mr-1} (A:53-61,A:121-205)
Probab=37.43  E-value=23  Score=14.68  Aligned_cols=43  Identities=19%  Similarity=0.317  Sum_probs=31.0

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-EEEEEE
Q ss_conf             4698289981788256887799973078116878837996-789996
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ-KILFTI  480 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~  480 (503)
                      .+.+++.|.-...   ...=+.+|+++++-.+|++..+|| ..|||+
T Consensus        11 M~~~~i~v~~~~~---l~~a~~~m~~~~~~~lPVvD~~g~lvGiiT~   54 (94)
T 3kxr_A           11 LSEDSRALTANTT---LLDAAEAIEHSREIELPVIDDAGELIGRVTL   54 (94)
T ss_dssp             CCSSCCCEETTSC---HHHHHHHHHTSSCSEEEEECTTSBEEEEEEH
T ss_pred             EECCCEEECCCCC---HHHHHHHHHHCCCCEEEEECCCCEEEEEEEH
T ss_conf             6748589868998---9999999997797444178769989999889


No 19 
>>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Vibrio cholerae} (A:1-80)
Probab=37.41  E-value=23  Score=14.68  Aligned_cols=42  Identities=7%  Similarity=0.080  Sum_probs=29.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-EEEEEEC
Q ss_conf             98289981788256887799973078116878837996-7899961
Q gi|254780612|r  437 KNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ-KILFTID  481 (503)
Q Consensus       437 ~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~e  481 (503)
                      -+++.|..+..=   .-=+++|++..---+|++..||| .+|||..
T Consensus        13 ~~~~~v~~~~~l---~~a~~~m~~~~~~~lpVvd~~~~lvGiit~~   55 (80)
T 2o16_A           13 RHPHTLLRTHTL---NDAKHLMEALDIRHVPIVDANKKLLGIVSQR   55 (80)
T ss_dssp             ESCCCBCTTSBH---HHHHHHHHHHTCSEEEEECTTCBEEEEEEHH
T ss_pred             CCCEEECCCCCH---HHHHHHHHHCCCCEEEECCCCCCCCCCCCCC
T ss_conf             998088895959---9999999986997553014542223334200


No 20 
>>1t1u_A Choline O-acetyltransferase; choline acetyltransferase; 1.55A {Rattus norvegicus} (A:100-399)
Probab=37.34  E-value=23  Score=14.67  Aligned_cols=119  Identities=18%  Similarity=0.199  Sum_probs=63.5

Q ss_pred             EEEECCCCCEEEEEEECCCCCCCCCE-EEEEEE----EEECCCCC-C-----CCHHH-CCCCEEC-CCCCCCCCCCCCEE
Q ss_conf             76307877717999951789877781-288999----97168888-7-----32110-3231021-33212466311001
Q gi|254780612|r  366 GDIPMIDNAFSASMTLKCNADISLSI-THVMEI----MFSFPKES-Q-----DAVVD-LRRISMR-KTDNSPSVLIDSNI  432 (503)
Q Consensus       366 a~i~iP~~~~~~~~~~rrn~d~slpa-sh~~e~----~f~~~~~~-~-----~~v~~-v~~~~~k-~~e~~~g~~l~~~~  432 (503)
                      +..=||..+.-   +|+++.+..-|. .|++=|    .|.+.=.- |     .-|.. ++.|.-. ..+...+.+|..+.
T Consensus        70 ~t~RiP~~~~D---~~~~~~~~~~~~~~HiiV~~~g~~y~v~v~d~g~~ls~~el~~ql~~I~~~~~~~~~~~~~vg~LT  146 (300)
T 1t1u_A           70 SSYRLPGHTQD---TLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLT  146 (300)
T ss_dssp             TEEEECCSSSC---EEEECCCSSSSCCCEEEEEETTEEEEEESEETTEECCHHHHHHHHHHHHHHHTCSTTCCCCGGGGG
T ss_pred             CCEECCCCCCC---EEEECCCCCCCCCCEEEEEECCEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCEECC
T ss_conf             76515789887---366457778888867999989998999999899426899999999999962334566789831356


Q ss_pred             E------------------------EECCCEEEEECCCCC----HHHHHHHHHHHC--------CCCEEEE---EEECCC
Q ss_conf             6------------------------746982899817882----568877999730--------7811687---883799
Q gi|254780612|r  433 F------------------------VISKNSYLISLKGSE----EDPFRNSKILEE--------YRFIDIP---ITYRSG  473 (503)
Q Consensus       433 ~------------------------kv~~~~f~v~l~~~~----~~~~~n~~ll~~--------~~w~dip---~~y~ng  473 (503)
                      .                        .|..-.|.|.|-+..    .+..+-+++|-.        --|+|-.   ||++||
T Consensus       147 ~~~R~~Wa~~r~~L~~~~~N~~~L~~Ie~alfvv~LD~~~~~~~~e~~~~~~~~~~~~~~g~~~NRW~DKs~q~iV~~nG  226 (300)
T 1t1u_A          147 SDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDG  226 (300)
T ss_dssp             GSCHHHHHHHHHHHTTSHHHHHHHHHHHTCSCEEEECCCCSSCCCHHHHHHHHHHTTSTTTTTTSCCTTBSEEEEECTTS
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHHHCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCC
T ss_conf             58658999999998539626999999975446898368888870167888887307766888655334665179996798


Q ss_pred             CEEEEEECCCCCHH
Q ss_conf             67899961587689
Q gi|254780612|r  474 QKILFTIDKGKKGA  487 (503)
Q Consensus       474 rra~~~~ekg~~g~  487 (503)
                      +-+++-=-=...|-
T Consensus       227 ~~g~~~EHS~~Dg~  240 (300)
T 1t1u_A          227 TCGVVCEHSPFDGI  240 (300)
T ss_dssp             CEEEEECSTTCCHH
T ss_pred             CEEEEECCCCCCCH
T ss_conf             55775136777505


No 21 
>>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} (A:107-193)
Probab=37.12  E-value=23  Score=14.65  Aligned_cols=53  Identities=15%  Similarity=0.228  Sum_probs=40.0

Q ss_pred             CCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCCH
Q ss_conf             11001674698289981788256887799973078116878837996789996158768
Q gi|254780612|r  428 IDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKG  486 (503)
Q Consensus       428 l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~~g  486 (503)
                      .-|-.|-|+++++.|-|++.....+.=+.+|+..+-++|   -+.|+.||   ++|.-+
T Consensus        30 f~a~ivdv~~~~~~ie~tG~~~kid~fi~~l~~~gI~Ei---~RTG~vAi---~Rg~~~   82 (87)
T 2fgc_A           30 FRGKIIDVSREGAIIEITGARSKVEAFINLLPQKQVEEI---ARTGIVAX---NRWNVK   82 (87)
T ss_dssp             TTCEEEEECSSEEEEEEEECHHHHHHHHHHSCGGGEEEE---EECCCEEE---ECCCC-
T ss_pred             CCCEEEECCCCEEEEEEECCHHHHHHHHHHHCCCCCEEE---EECCEEEE---ECCCCC
T ss_conf             097899735998999996799999999997463386899---81380679---768876


No 22 
>>1f5m_A GAF; CGMP binding, signaling protein; 1.90A {Saccharomyces cerevisiae} (A:)
Probab=36.15  E-value=15  Score=15.96  Aligned_cols=59  Identities=17%  Similarity=0.022  Sum_probs=43.2

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-EEEEEECCCCC-----HHHHHHHHHHHHHH
Q ss_conf             9981788256887799973078116878837996-78999615876-----89999999999852
Q gi|254780612|r  441 LISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ-KILFTIDKGKK-----GADIFKSAIMQWEN  499 (503)
Q Consensus       441 ~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~ekg~~-----g~~~f~~a~~~w~~  499 (503)
                      .+-.+|...+......-+.-++|+-|||...+|+ .++|.|....+     -+..|=+.|+.+.+
T Consensus       110 ~~~~~d~~~~~~~~~~~~~~~s~l~vPl~~~~g~~~Gvl~l~~~~~~~f~~~d~~ll~~ia~~~a  174 (180)
T 1f5m_A          110 TQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLIN  174 (180)
T ss_dssp             CEEESCGGGSTTCCCSSTTCCEEEEEEEECTTSCEEEEEEEEESSTTCCCHHHHHHHHHHHHHHH
T ss_pred             EEEECCHHHHHHHCCCCCCCCCEEEEEEECCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             79988726765423355445718999637489959999997059999759999999999999999


No 23 
>>2phd_A Gentisate 1,2-dioxygenase; beta-sandwich, oxidoreductase; 2.90A {Pseudaminobacter salicylatoxidans} (A:45-61,A:236-368)
Probab=34.93  E-value=24  Score=14.62  Aligned_cols=78  Identities=5%  Similarity=-0.023  Sum_probs=48.7

Q ss_pred             EEECCCCCCCCCEEEEEEEEEECCCCCCCCHHHCCCCEECCCCCC--CCCCCCCEEEEECCCEEEEECCCCCHHHHHHHH
Q ss_conf             995178987778128899997168888732110323102133212--466311001674698289981788256887799
Q gi|254780612|r  379 MTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNS--PSVLIDSNIFVISKNSYLISLKGSEEDPFRNSK  456 (503)
Q Consensus       379 ~~~rrn~d~slpash~~e~~f~~~~~~~~~v~~v~~~~~k~~e~~--~g~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~  456 (503)
                      |-|++|.-..++++-.-.+ |-+=+  |+|-+.|....|+=++-+  .=---.++..+-+.+.||...||.+  ..+-|.
T Consensus        66 ~~L~~G~~~~~~~~s~S~V-FhVie--G~G~v~ig~~~f~w~~gD~FvvP~w~~vsl~a~~~a~Lf~~~DaP--l~e~LG  140 (150)
T 2phd_A           66 HRLRAGTETATRNEVGSTV-FQVFE--GAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAP--IMEALS  140 (150)
T ss_dssp             EEECTTCBCCCEEESSCEE-EEEEE--SCEEEEETTEEEEECTTCEEEECTTCCEEEEESSCEEEEEEESHH--HHHHTT
T ss_pred             EECCCCCCCCCCCCCCCEE-EEEEE--CCEEEEECCEEEEECCCCEEEECCCCCEEEECCCCEEEEEECCHH--HHHHHH
T ss_conf             7537987457720257289-99997--839999999999973899999398980888538975999975889--999875


Q ss_pred             HHHCC
Q ss_conf             97307
Q gi|254780612|r  457 ILEEY  461 (503)
Q Consensus       457 ll~~~  461 (503)
                      |+|++
T Consensus       141 lyrer  145 (150)
T 2phd_A          141 FMRTK  145 (150)
T ss_dssp             CCCEE
T ss_pred             HHHHH
T ss_conf             66545


No 24 
>>1m6b_A C-, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling protein, transferase; HET: NAG NDG; 2.60A {Homo sapiens} (A:1-195)
Probab=34.73  E-value=3.8  Score=20.10  Aligned_cols=28  Identities=11%  Similarity=0.221  Sum_probs=14.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCCE
Q ss_conf             9828998178825688779997307811
Q gi|254780612|r  437 KNSYLISLKGSEEDPFRNSKILEEYRFI  464 (503)
Q Consensus       437 ~~~f~v~l~~~~~~~~~n~~ll~~~~w~  464 (503)
                      -||.+|.++++.-...+||.+.|++.-+
T Consensus        65 tGyl~I~~~~~~l~~f~NL~vIrG~~l~   92 (195)
T 1m6b_A           65 TGYVLVAMNEFSTLPLPNLRVVRGTQVY   92 (195)
T ss_dssp             SSCEEEESCCCSEEECTTCCEECCSSCB
T ss_pred             EEEEEEEECCCCEEECCCCCEECCCHHC
T ss_conf             4579998777573557996687880201


No 25 
>>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bonds; 2.05A {Sulfolobus tokodaii str} (A:)
Probab=33.36  E-value=27  Score=14.25  Aligned_cols=54  Identities=11%  Similarity=-0.038  Sum_probs=44.2

Q ss_pred             CCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEE-CCCCCHHHHHHHHHHHHHHC
Q ss_conf             8256887799973078116878837996789996-15876899999999998522
Q gi|254780612|r  447 SEEDPFRNSKILEEYRFIDIPITYRSGQKILFTI-DKGKKGADIFKSAIMQWENR  500 (503)
Q Consensus       447 ~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~-ekg~~g~~~f~~a~~~w~~~  500 (503)
                      ...-..|.|+-|.+.+||..=-.=.|+|.-.+.+ +||...-+.|+..+..|..+
T Consensus        49 ~~~tvs~~l~~L~~~glI~r~~~~~d~R~~~i~lT~~g~~~~~~~~~~~~~~~~~  103 (109)
T 2d1h_A           49 SKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNCAKR  103 (109)
T ss_dssp             CHHHHHHHHHHHHHTTSEEEEEC-------CCEEEEECTTHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCEEECCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             7234999999999879863626877898734787517899999999999999999


No 26 
>>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} (A:)
Probab=33.36  E-value=27  Score=14.25  Aligned_cols=36  Identities=6%  Similarity=-0.194  Sum_probs=24.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECC
Q ss_conf             982899817882568877999730781168788379
Q gi|254780612|r  437 KNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS  472 (503)
Q Consensus       437 ~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~n  472 (503)
                      .|+.+|++|..+.+...+....++..|+.+++++-.
T Consensus        69 ~gv~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~D~  104 (162)
T 1tp9_A           69 KGVTEILCISVNDPFVMKAWAKSYPENKHVKFLADG  104 (162)
T ss_dssp             TTCCCEEEEESSCHHHHHHHHHTCTTCSSEEEEECT
T ss_pred             HCCCCCEEEECCCHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             178541122026155432444430334543224562


No 27 
>>1nm8_A Carnitine O-acetyltransferase; two equally sized domains, anti-parallel beta-strand; 1.60A {Homo sapiens} (A:92-385)
Probab=33.20  E-value=27  Score=14.23  Aligned_cols=97  Identities=20%  Similarity=0.274  Sum_probs=55.4

Q ss_pred             CCEEEEEEE----EEECCC-CCCC------CHHH-CCCCEECCCCCCCCCCCCCEEE-----------------------
Q ss_conf             781288999----971688-8873------2110-3231021332124663110016-----------------------
Q gi|254780612|r  389 LSITHVMEI----MFSFPK-ESQD------AVVD-LRRISMRKTDNSPSVLIDSNIF-----------------------  433 (503)
Q Consensus       389 lpash~~e~----~f~~~~-~~~~------~v~~-v~~~~~k~~e~~~g~~l~~~~~-----------------------  433 (503)
                      =..+||+=|    .|.+.= +.+|      -|.+ ++.|. ..+++..|.++..+..                       
T Consensus        86 ~~~~HIvVl~~g~~f~v~v~~~~~~~ls~~el~~ql~~I~-~~~~~~~~~~vg~LT~~~R~~Wa~~R~~L~~~~~N~~~L  164 (294)
T 1nm8_A           86 KPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIW-NSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSV  164 (294)
T ss_dssp             SCCCEEEEEETTEEEEEECBCTTSCBCCHHHHHHHHHHHH-HTCCCCCSCCGGGGGGSCHHHHHHHHHHHTTSHHHHHHH
T ss_pred             CCCCEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHH-HCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHH
T ss_conf             8886699998999999999889998998999999999998-524057988867267676389999999986295259999


Q ss_pred             -EECCCEEEEECCCC----CHHHHHHH---HHHHCC--------CCEEEE---EEECCCCEEEEEECCCCCH
Q ss_conf             -74698289981788----25688779---997307--------811687---8837996789996158768
Q gi|254780612|r  434 -VISKNSYLISLKGS----EEDPFRNS---KILEEY--------RFIDIP---ITYRSGQKILFTIDKGKKG  486 (503)
Q Consensus       434 -kv~~~~f~v~l~~~----~~~~~~n~---~ll~~~--------~w~dip---~~y~ngrra~~~~ekg~~g  486 (503)
                       .|-.-.|+|-|-+.    ..++.++.   +||-+.        -|+|-.   ||++||+-+++-=-=...|
T Consensus       165 ~~Ie~alfvv~LD~~~p~~~~e~~~~~~~~~~L~G~g~~~~~~NRW~DKslq~iV~~nG~~g~~~EHS~~DG  236 (294)
T 1nm8_A          165 RSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEG  236 (294)
T ss_dssp             HHHHHSSCEEEEECCCSCCCSTTHHHHHHHHHHHCSCTTTTTTSCCTTBSEEEEEETTSCEEEEECTTSCCH
T ss_pred             HHHHHCEEEEEECCCCCCCCCHHHHHHHHHHEEECCCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCHH
T ss_conf             999754578880478888862076766532224368766899852768886999978995788623662037


No 28 
>>1ykd_A Adenylate cyclase; GAF domain, bound cyclic AMP ligand, lyase; HET: CMP; 1.90A {Anabaena SP} (A:21-173)
Probab=31.88  E-value=28  Score=14.08  Aligned_cols=59  Identities=7%  Similarity=0.125  Sum_probs=32.5

Q ss_pred             CCCCCCCEEEEECCCEEEEECCCCCHHHH--HHHHHH---HCCCCEEEEEEECCCC-EEEEEECC
Q ss_conf             46631100167469828998178825688--779997---3078116878837996-78999615
Q gi|254780612|r  424 PSVLIDSNIFVISKNSYLISLKGSEEDPF--RNSKIL---EEYRFIDIPITYRSGQ-KILFTIDK  482 (503)
Q Consensus       424 ~g~~l~~~~~kv~~~~f~v~l~~~~~~~~--~n~~ll---~~~~w~dip~~y~ngr-ra~~~~ek  482 (503)
                      .+..+.+..++-..-+++.-++..+....  ....++   .-++|+-+||.+++|+ .++|.+..
T Consensus        58 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~vPl~~~~g~~~G~l~~~~  122 (153)
T 1ykd_A           58 ADKGIAGEVATFKQVVNIPFDFYHDPRSIFAQKQEKITGYRTYTMLALPLLSEQGRLVAVVQLLN  122 (153)
T ss_dssp             TTSHHHHHHHHHCCCEEECSCGGGSGGGHHHHHHHHHHCCCCSCEEEEEEECSSCCEEEEEEEEE
T ss_pred             CCCCEEEEEECCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEECCCCCEEEEEEEEC
T ss_conf             89985888971684499723113574112462344432004322267655326784899999951


No 29 
>>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, zinc, disulfide bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A (A:)
Probab=31.31  E-value=11  Score=17.02  Aligned_cols=60  Identities=15%  Similarity=0.206  Sum_probs=35.0

Q ss_pred             ECCCEEE--EECCCCCHHHH-HHHHHHHCCCCEEEEEEECCCCEEEEEECCCCCHHH-HHHHHHHHHHHCCC
Q ss_conf             4698289--98178825688-779997307811687883799678999615876899-99999999852236
Q gi|254780612|r  435 ISKNSYL--ISLKGSEEDPF-RNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGAD-IFKSAIMQWENRSN  502 (503)
Q Consensus       435 v~~~~f~--v~l~~~~~~~~-~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~~g~~-~f~~a~~~w~~~~~  502 (503)
                      +.++||=  |.|+.-+..+. ||..-.+.+-|-.=.|.|        .|.++...++ ++.+||..|...|+
T Consensus        13 ~~~~~~egDi~l~~~~~~r~~r~~~~~~~~~Wp~~~v~Y--------~~~~~~~~~~~~i~~A~~~w~~~t~   76 (235)
T 3lq0_A           13 YNDGMFEGDIKLRAGRQPARVGAAILGDEYLWSGGVIPY--------TFAGVSGADQSAILSGMQELEEKTC   76 (235)
T ss_dssp             CCTTCBTTTEECCSSCCCEEETTEEECGGGSCGGGEEEE--------EEESCCHHHHHHHHHHHHHHHHHSS
T ss_pred             HCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCEEEE--------EECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             178986516037801103443234458653487998979--------9799998999999999999985783


No 30 
>>1xl7_A COT, peroxisomal carnitine O-octanoyltransferase; selenomethionine, hepes; HET: EPE; 2.00A {Mus musculus} (A:96-392)
Probab=31.16  E-value=18  Score=15.43  Aligned_cols=122  Identities=11%  Similarity=0.047  Sum_probs=63.9

Q ss_pred             EEEECCCCCEEEEEEECCCCCCCCCEEEEEEE----EEECCC-CCC-----CCHH-HCCCCEECCCCCCCCCCCCCEEE-
Q ss_conf             76307877717999951789877781288999----971688-887-----3211-03231021332124663110016-
Q gi|254780612|r  366 GDIPMIDNAFSASMTLKCNADISLSITHVMEI----MFSFPK-ESQ-----DAVV-DLRRISMRKTDNSPSVLIDSNIF-  433 (503)
Q Consensus       366 a~i~iP~~~~~~~~~~rrn~d~slpash~~e~----~f~~~~-~~~-----~~v~-~v~~~~~k~~e~~~g~~l~~~~~-  433 (503)
                      +..=||....--..+.-+-...--.+.||+=|    .|.+.= +.|     ..|. .++.|..+++....|.++-.+.. 
T Consensus        69 ~t~RiP~~~~D~~~~~~~~~~~~~~~~HIvV~~~g~~f~v~v~d~~~~ls~~el~~ql~~I~~~~~~~~~~~~ig~LT~~  148 (297)
T 1xl7_A           69 STCKVPGITRDSIXNYFKTESEGHCPTHIAVLCRGRAFVFDVLHEGCLITPPELLRQLTYIHKKCSNEPVGPSIAALTSE  148 (297)
T ss_dssp             SEEEECCSSCCEEEECCCCTTTCCCCCEEEEEETTEEEEEESEETTEECCHHHHHHHHHHHHHHHHTSCCCCCGGGGGGS
T ss_pred             CCEECCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             57517899887522035555678998649999789238999942986889999999999999726457888885615677


Q ss_pred             ------------------------EECCCEEEEECCCCCH--------HHHHHHHHHHCCC-CEEEE---EEECCCCEEE
Q ss_conf             ------------------------7469828998178825--------6887799973078-11687---8837996789
Q gi|254780612|r  434 ------------------------VISKNSYLISLKGSEE--------DPFRNSKILEEYR-FIDIP---ITYRSGQKIL  477 (503)
Q Consensus       434 ------------------------kv~~~~f~v~l~~~~~--------~~~~n~~ll~~~~-w~dip---~~y~ngrra~  477 (503)
                                              .|..-.|+|-|-+...        ...+++..--..+ |+|-+   ||++||+-++
T Consensus       149 ~R~~Wa~~r~~L~~~~~~N~~~L~~Ie~alfvl~LD~~~~~~~~~~~~~~~~~~l~G~g~NRW~DKs~q~iV~~nG~~g~  228 (297)
T 1xl7_A          149 ERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIEDSSPHATPEEYSQVFEXLLGGDPSVRWGDKSYNLISFANGIFGC  228 (297)
T ss_dssp             CHHHHHHHHHHHHHHCHHHHHHHHHHHHSSCEEEECCCCCCCCSSCCHHHHHHHHSSCGGGCCTTBSCEEEECTTSCEEE
T ss_pred             CHHHHHHHHHHHHHCCHHHHHHHHHHHHCEEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEE
T ss_conf             60499999999761790169999999745889996789988985899999998534998751355551599947986688


Q ss_pred             EEECCCCCHH
Q ss_conf             9961587689
Q gi|254780612|r  478 FTIDKGKKGA  487 (503)
Q Consensus       478 ~~~ekg~~g~  487 (503)
                      +-=-=...|-
T Consensus       229 ~~EHS~~DG~  238 (297)
T 1xl7_A          229 CCDHAPYDAX  238 (297)
T ss_dssp             EECSSSCCTH
T ss_pred             ECCCCCCCCH
T ss_conf             4367765304


No 31 
>>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima MSB8} (A:138-180)
Probab=30.96  E-value=20  Score=15.16  Aligned_cols=29  Identities=10%  Similarity=0.076  Sum_probs=21.6

Q ss_pred             CCCCCCCCCEEEEEEEEEECCCC-------C-CCCHH
Q ss_conf             17898777812889999716888-------8-73211
Q gi|254780612|r  382 KCNADISLSITHVMEIMFSFPKE-------S-QDAVV  410 (503)
Q Consensus       382 rrn~d~slpash~~e~~f~~~~~-------~-~~~v~  410 (503)
                      =|+||--+|---.+||+|+-.++       | |+||.
T Consensus         2 Ykatd~~v~gpGk~elvftp~dG~e~~V~~F~g~GV~   38 (43)
T 1zor_A            2 YNAVEAKVEGPAEVELVVRNKENKTLLVHKFEGNGVV   38 (43)
T ss_dssp             GGCEEEEECSSEEEEEEEESSSCEEEEEEEESSCEEE
T ss_pred             ECCCEEEECCCCCCEEEEECCCCCCCCCCCCCCCEEE
T ss_conf             3240258714774125773366641023356887588


No 32 
>>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} (A:85-189)
Probab=30.79  E-value=29  Score=13.96  Aligned_cols=34  Identities=24%  Similarity=0.139  Sum_probs=26.0

Q ss_pred             EECCCEEEEECCCCCHHHHHHHHHHHCC------------CCEEEE
Q ss_conf             7469828998178825688779997307------------811687
Q gi|254780612|r  434 VISKNSYLISLKGSEEDPFRNSKILEEY------------RFIDIP  467 (503)
Q Consensus       434 kv~~~~f~v~l~~~~~~~~~n~~ll~~~------------~w~dip  467 (503)
                      .|.|++|=|.+...+....--.+.|+++            .||||-
T Consensus        57 ~i~d~i~Kisi~~~~~~~~~~~~~l~~~~~~~~~~~~SG~~wIDi~  102 (105)
T 1rlm_A           57 EIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLI  102 (105)
T ss_dssp             GCCSCEEEEEEECCGGGHHHHHHHHHHHTTTSSEEEECSTTEEEEE
T ss_pred             HHHHHHEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEE
T ss_conf             6421125766507588999999999886337258999758256770


No 33 
>>3bbo_V Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (V:)
Probab=30.17  E-value=25  Score=14.46  Aligned_cols=59  Identities=8%  Similarity=0.170  Sum_probs=48.3

Q ss_pred             EECCC---EEEEECCCCCHHHHHHHHHHHCCCCEEE-EEEECCC-CEEEEEECCCCCHHHHHHH
Q ss_conf             74698---2899817882568877999730781168-7883799-6789996158768999999
Q gi|254780612|r  434 VISKN---SYLISLKGSEEDPFRNSKILEEYRFIDI-PITYRSG-QKILFTIDKGKKGADIFKS  492 (503)
Q Consensus       434 kv~~~---~f~v~l~~~~~~~~~n~~ll~~~~w~di-p~~y~ng-rra~~~~ekg~~g~~~f~~  492 (503)
                      +|.|+   .|+|....+..+...-+..|-.-.+..| -|.+.+| ++|+++|..|-.=..+.|.
T Consensus       127 ~iEdnNtlvFiVd~kANK~qIK~AVekLydVkV~kVNTli~p~g~KKA~V~La~d~~aldvAnK  190 (198)
T 3bbo_V          127 NIADENSLLFTVDVRADKKMIREAISNFFGVKVRKVNTLIRPDGTKKAYIMLNKEYNASELAKK  190 (198)
T ss_dssp             HHHTSCEECCEECTTCCHHHHHHTTTTTSCCCEEECCCEEETTTEEECCEEECTTTCTTTHHHH
T ss_pred             HHHHCCEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEECCCCCHHHHHHH
T ss_conf             8987786999989999989999999998298013798657389927899996899847888750


No 34 
>>3hw5_A Polymerase acidic protein; avian influenza virus, PA_N, AMP, phosphoprotein, hydrolase; HET: AMP; 1.81A {Influenza a virus} PDB: 3hw3_A* 3hw6_A 3ebj_A 2w69_A (A:)
Probab=30.00  E-value=11  Score=16.89  Aligned_cols=29  Identities=24%  Similarity=0.261  Sum_probs=24.5

Q ss_pred             EEEEEEECCCCCEEEEEEECCCCCCCCCEE
Q ss_conf             236763078777179999517898777812
Q gi|254780612|r  363 VIKGDIPMIDNAFSASMTLKCNADISLSIT  392 (503)
Q Consensus       363 aira~i~iP~~~~~~~~~~rrn~d~slpas  392 (503)
                      ..+++-+| |.+|+..=||+|=.|.|||+-
T Consensus       199 ~~~gEe~i-E~~fk~~~T~~rL~D~SvP~~  227 (261)
T 3hw5_A          199 SERGEETI-EERFEITGTMCRLADQSLPPN  227 (261)
T ss_dssp             CCCCC-------------------------
T ss_pred             CCCCHHHH-HHHHHHHHHHHHHHHCCCCCC
T ss_conf             32213779-999873056888750568988


No 35 
>>1vq8_S 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} (S:)
Probab=29.25  E-value=31  Score=13.79  Aligned_cols=53  Identities=6%  Similarity=0.127  Sum_probs=44.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEE-EEECCC-CEEEEEECCCCCHHHHHH
Q ss_conf             28998178825688779997307811687-883799-678999615876899999
Q gi|254780612|r  439 SYLISLKGSEEDPFRNSKILEEYRFIDIP-ITYRSG-QKILFTIDKGKKGADIFK  491 (503)
Q Consensus       439 ~f~v~l~~~~~~~~~n~~ll~~~~w~dip-~~y~ng-rra~~~~ekg~~g~~~f~  491 (503)
                      .|+|.......+..+-+..|=.-.|.+|= +.+..| ++|+++|.+|-.=..+++
T Consensus        26 ~F~V~~~atK~~IK~ave~lf~VkV~~Vnt~~~~~k~KKA~V~L~~~~~~~~~a~   80 (85)
T 1vq8_S           26 QFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS   80 (85)
T ss_dssp             EEEECTTCCHHHHHHHHHHHHCCCEEEEEEEECTTSSEEEEEEECTTSCHHHHHT
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCEEEEEEECCCCCHHHHHH
T ss_conf             9997686898999999999839930089876748995789999189996899997


No 36 
>>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'- deoxyadenosine, radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} (B:95-262)
Probab=29.09  E-value=31  Score=13.77  Aligned_cols=68  Identities=10%  Similarity=0.064  Sum_probs=50.5

Q ss_pred             ECCCEEEEECCCCC-------HHHHHHHHHHHCCC-CEEEEEEECCCC---------EEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             46982899817882-------56887799973078-116878837996---------78999615876899999999998
Q gi|254780612|r  435 ISKNSYLISLKGSE-------EDPFRNSKILEEYR-FIDIPITYRSGQ---------KILFTIDKGKKGADIFKSAIMQW  497 (503)
Q Consensus       435 v~~~~f~v~l~~~~-------~~~~~n~~ll~~~~-w~dip~~y~ngr---------ra~~~~ekg~~g~~~f~~a~~~w  497 (503)
                      +..++-+|+||.+-       ....+.+++||+++ +=||+|...+.-         -+-.-+.-+..+.+++++.+..+
T Consensus        83 ~~~~~div~lS~~~~~~~~~~~~~~~~i~~lr~~g~~~~v~ii~GG~~~~~~~~~~~Gad~~~~~~~~~~~~~~~l~~~~  162 (168)
T 1xrs_B           83 VELEADVLLVSQTVTQKNVHIQNMTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTL  162 (168)
T ss_dssp             HHTTCSEEEEECCCCTTSHHHHHHHHHHHHHHHTTCGGGSEEEEECTTCCHHHHHTTTCSEEECTTCCHHHHHHHHHHHH
T ss_pred             HHCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHCCCCEECCCCCCHHHHHHHHHHHH
T ss_conf             86199999998630363026899999999999669988978999899899999997799888599988999999999999


Q ss_pred             HHCCC
Q ss_conf             52236
Q gi|254780612|r  498 ENRSN  502 (503)
Q Consensus       498 ~~~~~  502 (503)
                      ..+-+
T Consensus       163 ~~~~~  167 (168)
T 1xrs_B          163 NDRMN  167 (168)
T ss_dssp             HHHHC
T ss_pred             HHHHC
T ss_conf             98733


No 37 
>>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} (A:127-203)
Probab=28.48  E-value=32  Score=13.70  Aligned_cols=31  Identities=13%  Similarity=0.024  Sum_probs=26.3

Q ss_pred             HHHHHHHHHCCCCEEEEEEECCCC-EEEEEEC
Q ss_conf             887799973078116878837996-7899961
Q gi|254780612|r  451 PFRNSKILEEYRFIDIPITYRSGQ-KILFTID  481 (503)
Q Consensus       451 ~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~e  481 (503)
                      ...=+++|++++-=.+|++.+||| .+|||+.
T Consensus        19 i~~a~~~m~~~~~~~~pVvd~~g~lvGivt~~   50 (77)
T 2yzq_A           19 LKAALKALLLSNSMALPVVDSEGNLVGIVDET   50 (77)
T ss_dssp             HHHHHHHHHTCSSSEEEEECTTSCEEEEEEGG
T ss_pred             CCCCCHHHHCCCCCCCCCCCCCCEEEEEEEHH
T ss_conf             22200112001322211346774389998899


No 38 
>>3ddj_A CBS domain-containing protein; NP_344512.1, structural genomics, joint center for structural genomics, JCSG; HET: AMP; 1.80A {Sulfolobus solfataricus} (A:155-205)
Probab=28.19  E-value=32  Score=13.66  Aligned_cols=29  Identities=14%  Similarity=0.116  Sum_probs=22.9

Q ss_pred             HHHHHHHHHCCCCEEEEEEECCCCE-EEEE
Q ss_conf             8877999730781168788379967-8999
Q gi|254780612|r  451 PFRNSKILEEYRFIDIPITYRSGQK-ILFT  479 (503)
Q Consensus       451 ~~~n~~ll~~~~w~dip~~y~ngrr-a~~~  479 (503)
                      ..-=++||++++--.+|++..+||- .|||
T Consensus        21 i~ea~~lm~~~~i~~lPVVD~~g~lvGiiT   50 (51)
T 3ddj_A           21 LDQAVKLXLRRGFRRLPVIDDDNKVVGIVT   50 (51)
T ss_dssp             HHHHHHHHHHHTCSEEEEECTTSCEEEEEE
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCEEEEEE
T ss_conf             999999998737640578727896799995


No 39 
>>3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAse; 3.92A {Caenorhabditis elegans} (A:121-222)
Probab=27.89  E-value=33  Score=13.63  Aligned_cols=61  Identities=11%  Similarity=0.052  Sum_probs=45.1

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECC--CC-EEEEEEC-CCCCHHHHHHHHHHH
Q ss_conf             63110016746982899817882568877999730781168788379--96-7899961-587689999999999
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS--GQ-KILFTID-KGKKGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~n--gr-ra~~~~e-kg~~g~~~f~~a~~~  496 (503)
                      +++.++.+=+.||.|+|-+|.-+.          +.++.|+.++|.+  |+ -.|+.++ .|.--++.|.+|+..
T Consensus         5 ~~v~av~vg~i~g~~iiDPt~~E~----------~~s~~~l~va~~~~~~~~~~i~~~~~~g~~~~~~l~~al~~   69 (102)
T 3krn_A            5 TVFCGVLIVRVKDELIIDPTAKQE----------AASTGRVLFSVCKGSDGHPEVCAMDAIGHWDFIQLEAAWSL   69 (102)
T ss_dssp             SCCCCCCCEECSSSEESSCCTTTT----------TSCC-CCCCEECCCSSSSCCEEEECCBSSCTTHHHHTHHHH
T ss_pred             CCCCEEEEEEECCEEEECCCHHHH----------HCCCCEEEEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             664237999985858878898999----------52785499999789998319999624687099999999999


No 40 
>>2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} (D:150-237)
Probab=27.16  E-value=34  Score=13.54  Aligned_cols=61  Identities=10%  Similarity=0.118  Sum_probs=43.3

Q ss_pred             CCCCCEEEEE-CCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECC-CCCHHHHHHHHHHH
Q ss_conf             6311001674-69828998178825688779997307811687883799678999615-87689999999999
Q gi|254780612|r  426 VLIDSNIFVI-SKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDK-GKKGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv-~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ek-g~~g~~~f~~a~~~  496 (503)
                      +++.++.+=| -||.|+|=+|..+.          ...|.|+-++|.+-+..|+.++- |.--++.|.+++..
T Consensus         3 ~~v~av~vg~~~d~~~iiDPs~~E~----------~~~~~~ltva~~~~~~~i~~~~~~g~~~~d~~~~~l~~   65 (88)
T 2nn6_D            3 ALFCGVACALDSDGTLVLDPTSKQE----------KEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAA   65 (88)
T ss_dssp             SCEEEEEEEECTTCCEEESCCHHHH----------HHCSEEEEEEEETTTCCCCEEEEEESCCHHHHHHHHHH
T ss_pred             CCCCCEEEEEEECCCCCCCCCHHHH----------HHHCCCEEEEEECCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             6555247998702310135666665----------32105226999479992999992687399999999999


No 41 
>>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, cytoplasm, nucleotide-binding; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A (A:1-112,A:171-206)
Probab=26.94  E-value=30  Score=13.89  Aligned_cols=64  Identities=16%  Similarity=0.251  Sum_probs=41.1

Q ss_pred             EECCCEEEEECCCCCHHHHHHHHHHHCCC-------CEEEEEE-ECCCCEEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             74698289981788256887799973078-------1168788-3799678999615876899999999998
Q gi|254780612|r  434 VISKNSYLISLKGSEEDPFRNSKILEEYR-------FIDIPIT-YRSGQKILFTIDKGKKGADIFKSAIMQW  497 (503)
Q Consensus       434 kv~~~~f~v~l~~~~~~~~~n~~ll~~~~-------w~dip~~-y~ngrra~~~~ekg~~g~~~f~~a~~~w  497 (503)
                      +-.+++-+.++........-.-.+|+++.       |+|+||+ |=.+|--++++.---+-+-+|+|.+..-
T Consensus        73 ~~~~~vI~d~~p~~~~~~~~l~~~l~~~g~~~~~vI~Ld~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (148)
T 2rgx_A           73 PKHGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPLIEYYKKKGILRIIDASKPVEEVYRQVLEVI  144 (148)
T ss_dssp             CSSSCEEEESCCCSHHHHHHHHHHHHHTTCCCCEEEEEECHHHHHHHHHTCEEEEETTSCHHHHHHHHHHHH
T ss_pred             CCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             234667844997858999999999985598841855300399999996598899979999999999999998


No 42 
>>2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} (B:158-249)
Probab=26.92  E-value=34  Score=13.52  Aligned_cols=61  Identities=8%  Similarity=0.041  Sum_probs=45.0

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEEC-CCCCHHHHHHHHHHH
Q ss_conf             63110016746982899817882568877999730781168788379967899961-587689999999999
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTID-KGKKGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~e-kg~~g~~~f~~a~~~  496 (503)
                      +++.++.|-+.||.|+|=+|..+.          +..+.|+-|+|.+.+..|+.|| .|.--++.|++++..
T Consensus         2 ~~V~avsvg~id~~~ilDp~~~E~----------~~~~~~l~ia~~~~~~~i~~ie~~g~~~~~~~~~~l~~   63 (92)
T 2nn6_B            2 DFVCACSAGFVDGTALADLSHVEE----------AAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEA   63 (92)
T ss_dssp             SCCEEEEEEEETTEEEESCCHHHH----------TSSCCCEEEEEETTTTEEEEEEECSCCBTTSHHHHHHH
T ss_pred             CCEEEEEEECCCCCCCCCCCCHHH----------CCCCCEEEEEEECCCCCEEEEEEEEEECHHHHHHHHHH
T ss_conf             504676400125742467772111----------02343799999547997699998702999999999999


No 43 
>>2yzy_A Putative uncharacterized protein TTHA1012; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; 1.60A {Thermus thermophilus HB8} (A:21-101,A:174-200)
Probab=25.74  E-value=36  Score=13.37  Aligned_cols=42  Identities=12%  Similarity=0.138  Sum_probs=36.0

Q ss_pred             CEEEEEEECCCCCEEEEEEECCCCCCCCCEEEEEEEEEECCCCCCCC
Q ss_conf             42367630787771799995178987778128899997168888732
Q gi|254780612|r  362 LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA  408 (503)
Q Consensus       362 ~aira~i~iP~~~~~~~~~~rrn~d~slpash~~e~~f~~~~~~~~~  408 (503)
                      ..|.|.|..|+..-++.|+|+     ++|+-.+.-|.|.-|+---|.
T Consensus         5 atv~G~~q~~~g~Q~id~~i~-----aiP~q~laRveF~kP~sLe~N   46 (108)
T 2yzy_A            5 ATVQGRIQGPGGEEELLARVY-----ALPQARLFRVEFLKPGSLEGN   46 (108)
T ss_dssp             EEEEEEC-----CCEEEEEEE-----EEGGGTEEEEEEEESTTTTTC
T ss_pred             EEEEEEEECCCCCEEEEEEEE-----EECCCCEEEEEEECCHHHCCE
T ss_conf             699999992899678899999-----962798799999077110792


No 44 
>>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} (A:)
Probab=25.70  E-value=35  Score=13.40  Aligned_cols=58  Identities=9%  Similarity=0.044  Sum_probs=46.3

Q ss_pred             CCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHC--------CCCEE-EEEEECCCCEEEEEECCCC
Q ss_conf             3110016746982899817882568877999730--------78116-8788379967899961587
Q gi|254780612|r  427 LIDSNIFVISKNSYLISLKGSEEDPFRNSKILEE--------YRFID-IPITYRSGQKILFTIDKGK  484 (503)
Q Consensus       427 ~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~--------~~w~d-ip~~y~ngrra~~~~ekg~  484 (503)
                      .|..+-.-..++|-||.-++..-+..-=.+||+.        |-||| |-+++..+.-+++.|.|.-
T Consensus        28 ~l~~L~a~f~p~f~mV~p~G~~l~~~~~~~~f~~~~G~kpGl~I~id~i~~~~~~~~~~~v~y~e~q   94 (128)
T 1tp6_A           28 ALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASGVDGATLAYREIQ   94 (128)
T ss_dssp             HHHHHHTTEEEEEEEECTTSCEEEHHHHHHHHHHHTTCSTTCEEEEEEEEEEEEETTEEEEEEEEEE
T ss_pred             HHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEEEEEEEECCCEEEEEEEEEE
T ss_conf             8999998439991899899816699999999997249999609999988999872994999998878


No 45 
>>3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, structural genomics, TBSGC; 2.10A {Mycobacterium tuberculosis H37RV} (A:159-262)
Probab=25.33  E-value=36  Score=13.32  Aligned_cols=61  Identities=8%  Similarity=0.037  Sum_probs=42.8

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEC-CCCEEEEEECCCC--CHHHHHHHHHHH
Q ss_conf             6311001674698289981788256887799973078116878837-9967899961587--689999999999
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYR-SGQKILFTIDKGK--KGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~-ngrra~~~~ekg~--~g~~~f~~a~~~  496 (503)
                      ++.+++.+=+.||.|||=+|..+.          ...+.||.|++. +|+...|-++=+.  -=...|++++..
T Consensus         5 ~~v~avtvg~~~~~~ivDpt~~Ee----------~~~~~~l~ia~~~~g~i~~l~~~g~~~~l~~~~l~~~l~~   68 (104)
T 3b4t_A            5 CAIAAVSVGVVDGRIRVDLPYEED----------SRAEVDMNVVATDTGTLVEIQGTGEGATFARSTLDKLLDM   68 (104)
T ss_dssp             SCEEEEEEEEETTEEEESCCHHHH----------TTCSEEEEEEEETTSCEEEEEECSSCCCBCHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCEEECCCCCCC----------CCCCEEEEEEECCCCCEEEEEEECCCCCCCHHHHHHHHHH
T ss_conf             652323665036515622551000----------1220112566559985899987137688499999999999


No 46 
>>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus/receptor complex; 25.00A {Homo sapiens} (D:63-140)
Probab=24.73  E-value=27  Score=14.22  Aligned_cols=22  Identities=9%  Similarity=-0.062  Sum_probs=16.2

Q ss_pred             CEEEEECCCEEEEECCCCCHHH
Q ss_conf             0016746982899817882568
Q gi|254780612|r  430 SNIFVISKNSYLISLKGSEEDP  451 (503)
Q Consensus       430 ~~~~kv~~~~f~v~l~~~~~~~  451 (503)
                      ---++-.+.+|+|||++...+.
T Consensus        13 ~~~~~~~~~~~WiGl~d~~~~g   34 (78)
T 2b6b_D           13 QLQSSRSNRFTWMGLSDLNQEG   34 (78)
T ss_pred             HHCCCCCCEEEEEEECCCCCCC
T ss_conf             1011111000101422445544


No 47 
>>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} (A:20-92)
Probab=23.94  E-value=37  Score=13.26  Aligned_cols=17  Identities=18%  Similarity=-0.064  Sum_probs=13.8

Q ss_pred             CCEEEEECCCEEEEECC
Q ss_conf             10016746982899817
Q gi|254780612|r  429 DSNIFVISKNSYLISLK  445 (503)
Q Consensus       429 ~~~~~kv~~~~f~v~l~  445 (503)
                      +|-=-+|.|+|||.+|.
T Consensus        45 aGC~~~I~Dr~~L~vld   61 (73)
T 2jtn_A           45 AGCDQHILDRFILKALD   61 (73)
T ss_dssp             BTSSSBCCCSEEEEETT
T ss_pred             CCCCCCCCCCEEEEECC
T ss_conf             04769067856899699


No 48 
>>1g62_A Ribosome anti-association factor EIF6; alpha-beta barrel, velcro closure, subdomain, structural genomics, PSI; 2.50A {Saccharomyces cerevisiae} (A:)
Probab=23.88  E-value=37  Score=13.26  Aligned_cols=28  Identities=14%  Similarity=0.124  Sum_probs=10.6

Q ss_pred             CCCCCCEEEEECCCEEEEECCCCCHHHH
Q ss_conf             6631100167469828998178825688
Q gi|254780612|r  425 SVLIDSNIFVISKNSYLISLKGSEEDPF  452 (503)
Q Consensus       425 g~~l~~~~~kv~~~~f~v~l~~~~~~~~  452 (503)
                      |..++|..+.+++...||.-.-.+.+.+
T Consensus       144 g~~~VGs~~v~nn~G~LVhp~~t~~El~  171 (224)
T 1g62_A          144 GNILVGSYCSLSNQGGLVHPQTSVQDQE  171 (224)
T ss_dssp             TBSCGGGSEEECSSCEEECTTCCHHHHH
T ss_pred             CCCCCEEEEEEECCCEEECCCCCHHHHH
T ss_conf             7465413799806725777999999999


No 49 
>>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} (A:204-282)
Probab=23.60  E-value=39  Score=13.10  Aligned_cols=31  Identities=13%  Similarity=0.176  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCE-EEEEE
Q ss_conf             68877999730781168788379967-89996
Q gi|254780612|r  450 DPFRNSKILEEYRFIDIPITYRSGQK-ILFTI  480 (503)
Q Consensus       450 ~~~~n~~ll~~~~w~dip~~y~ngrr-a~~~~  480 (503)
                      ....-+++|.++++-.+|+|..||+- .|||+
T Consensus        36 ~~~~a~~~m~~~~~~~lpVvd~~g~lvGiit~   67 (79)
T 2yzq_A           36 TVHEVALKMAKYSIEQLPVIRGEGDLIGLIRD   67 (79)
T ss_dssp             BHHHHHHHHHHHTCSEEEEEETTTEEEEEEEH
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCEEEEEEEH
T ss_conf             29999999998499889999479979999999


No 50 
>>3k2n_A Sigma-54-dependent transcriptional regulator; PSI-2, protein structure initiative, structural genomics; 2.50A {Chlorobium tepidum tls} (A:)
Probab=23.59  E-value=39  Score=13.10  Aligned_cols=87  Identities=10%  Similarity=0.020  Sum_probs=52.1

Q ss_pred             CCCEECCCCCCCCCCC-CCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCC-----CCH
Q ss_conf             2310213321246631-1001674698289981788256887799973078116878837996789996158-----768
Q gi|254780612|r  413 RRISMRKTDNSPSVLI-DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKG-----KKG  486 (503)
Q Consensus       413 ~~~~~k~~e~~~g~~l-~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg-----~~g  486 (503)
                      ..+.+...+.--+..+ .+-++.+.|....-.+.........-+.-+.-++++-+||.+.+.-.++|.|..-     ...
T Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~vPl~~~~~~~G~l~~~~~~~~~f~~~  148 (177)
T 3k2n_A           69 RHQTRSIAGTWLEGHLDDRTVTVASIARDIPSFGADGAPLLWTLHELGXRQIVLSPLRSGGRVIGFLSFVSAEEKLWSDG  148 (177)
T ss_dssp             CCSEEECTTSGGGGGTTCCSCEEEETTTTCTTTTTTTCHHHHHHHHHTCCEEEEEEEEETTEEEEEEEEEESSCCCCCHH
T ss_pred             CCCCCCCCCCHHHHHHHCCCEEEEECHHHHHHHCCCCHHHHHHHHHHCCCEEEEEEEEECCEEEEEEEEECCCCCCCCHH
T ss_conf             03346755347999982594499812445555304641678888862881999998755884799999860888999999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999852
Q gi|254780612|r  487 ADIFKSAIMQWEN  499 (503)
Q Consensus       487 ~~~f~~a~~~w~~  499 (503)
                      +..|=+.|+.+.+
T Consensus       149 ~~~~l~~la~~~a  161 (177)
T 3k2n_A          149 DKSLLSGVSSSIA  161 (177)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 51 
>>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP-binding, nucleotide-binding; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} (A:1-193)
Probab=23.42  E-value=7.1  Score=18.26  Aligned_cols=86  Identities=15%  Similarity=0.207  Sum_probs=43.2

Q ss_pred             EEEEECCCCCCCCCE-EEEEEEE-EECCCCCCCCHHHCCCCEECCCCCCCCCCCC-C-------EEEEECCCEEEEECCC
Q ss_conf             999951789877781-2889999-7168888732110323102133212466311-0-------0167469828998178
Q gi|254780612|r  377 ASMTLKCNADISLSI-THVMEIM-FSFPKESQDAVVDLRRISMRKTDNSPSVLID-S-------NIFVISKNSYLISLKG  446 (503)
Q Consensus       377 ~~~~~rrn~d~slpa-sh~~e~~-f~~~~~~~~~v~~v~~~~~k~~e~~~g~~l~-~-------~~~kv~~~~f~v~l~~  446 (503)
                      +.++++...|..|-. ++|-||+ |.+=-     -..+..+.|+.=+-=||.-|. +       .-+.-.+++..+||.+
T Consensus        43 L~I~~~~~~~~~l~~l~~I~EItGyL~I~-----~~~~~~~~l~nL~vIrG~~l~~~~~al~v~~~~~~n~~L~~L~l~s  117 (193)
T 3i2t_A           43 LELTWLPNENLDLSFLDNIREVTGYILIS-----HVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPD  117 (193)
T ss_dssp             EEEEEECCTTCCCGGGTTCCEESSCEEEE-----EECCSEEECTTCCEECCSSCBCSSTTSCCEEEEEESCCCSEEECTT
T ss_pred             EEEEECCCCCCCCCCCCCCEEEEEEEEEE-----ECCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCC
T ss_conf             99984377887632268877983589999-----7443564078833973862312556677647999438877648742


Q ss_pred             CCHHH--------HHHHHHHHCCCCEEEE
Q ss_conf             82568--------8779997307811687
Q gi|254780612|r  447 SEEDP--------FRNSKILEEYRFIDIP  467 (503)
Q Consensus       447 ~~~~~--------~~n~~ll~~~~w~dip  467 (503)
                      +..=.        ..+|-.+...+|.+|-
T Consensus       118 L~~I~~G~v~i~~Np~LCy~~ti~w~~i~  146 (193)
T 3i2t_A          118 LRDVLNGQVGFHNNYNLCHMRTIQWSEIV  146 (193)
T ss_dssp             CCEECSSEEEEESCSSCCSTTTSCGGGTB
T ss_pred             HHHHCCCCEEECCCCCCCCCCCCCHHHHC
T ss_conf             54421386898238655166887899961


No 52 
>>3da0_A Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and P2; lactococcal phage P2; 1.65A {Lactococcus phage tp901-1} (A:)
Probab=23.07  E-value=40  Score=13.03  Aligned_cols=48  Identities=19%  Similarity=0.344  Sum_probs=26.7

Q ss_pred             CCCCCEEECCCCCCC----CCCEEEEEEECCCC--------CEEEEEEECCCCCCCCCEEEEEEEEEE
Q ss_conf             662212304577777----67423676307877--------717999951789877781288999971
Q gi|254780612|r  345 GKILWSLQQEKSQGL----KGLVIKGDIPMIDN--------AFSASMTLKCNADISLSITHVMEIMFS  400 (503)
Q Consensus       345 GsVvWs~~~es~~~~----~~~aira~i~iP~~--------~~~~~~~~rrn~d~slpash~~e~~f~  400 (503)
                      |+||-....++..+.    -+..|.|-|.+|-.        ||.+.+| |||+|       ++|+.|.
T Consensus         1 gnvv~k~i~~t~~~~~~~~ndi~i~Gsi~vptq~~tvq~gnGl~l~lt-KK~nD-------lV~v~f~   60 (136)
T 3da0_A            1 GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLT-KKNND-------LVIVRFF   60 (136)
T ss_dssp             -CBCBSSSCEEECSCEEECSCEEESSCEECCEEEEEEEEETTEEEEEE-EETTT-------EEEEEEE
T ss_pred             CCEEEECCCCEECCCCEEECCEEEEEEEEEEEEEEEEEECCCEEEEEE-ECCCC-------EEEEEEE
T ss_conf             970261240000246215054788306750037889994796799999-63897-------9999986


No 53 
>>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} (A:)
Probab=22.96  E-value=40  Score=13.02  Aligned_cols=34  Identities=3%  Similarity=0.130  Sum_probs=29.1

Q ss_pred             EEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             6878837996789996158768999999999985
Q gi|254780612|r  465 DIPITYRSGQKILFTIDKGKKGADIFKSAIMQWE  498 (503)
Q Consensus       465 dip~~y~ngrra~~~~ekg~~g~~~f~~a~~~w~  498 (503)
                      -+-++|.||||..+...+|..=-++.++|..-..
T Consensus        11 sv~vi~~n~rr~~VKvtp~ttl~~VL~~ac~k~~   44 (90)
T 2al3_A           11 AVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQD   44 (90)
T ss_dssp             CEEEECTTSCEEEECCCTTSBHHHHHHHHHHHTT
T ss_pred             EEEEECCCCCEEEEEECCCCCHHHHHHHHHHHHC
T ss_conf             5999878996888862898689999999999819


No 54 
>>2hng_A Hypothetical protein; alpha-beta, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.63A {Streptococcus pneumoniae TIGR4} (A:)
Probab=22.58  E-value=41  Score=12.97  Aligned_cols=46  Identities=7%  Similarity=0.109  Sum_probs=36.6

Q ss_pred             CCCCCEEEEEEECCCCCCCCCEEEEEEEEEE-CCCCC--CCCHHHCCCC
Q ss_conf             7877717999951789877781288999971-68888--7321103231
Q gi|254780612|r  370 MIDNAFSASMTLKCNADISLSITHVMEIMFS-FPKES--QDAVVDLRRI  415 (503)
Q Consensus       370 iP~~~~~~~~~~rrn~d~slpash~~e~~f~-~~~~~--~~~v~~v~~~  415 (503)
                      .|+.++.+...++.-.+--.--++.+=|.|. ++++|  .|-|+.|-.|
T Consensus        31 ~pet~~~v~f~l~~~~~e~~~t~~~~vl~F~iv~~~F~iSG~IsQivqi   79 (127)
T 2hng_A           31 APETKVDVNFQLLQHDQENQVTSLIVILSFXIVFDKFVISGTISQVNHI   79 (127)
T ss_dssp             CCCCEEEEEEEEEEEETTTTEEEEEEEEEEEEECSSEEEEEEEEEEEEE
T ss_pred             CCEEEEEECCCCCHHHHHCCEEEEEEEEEEEECCCCEEEEEEEEEEEEE
T ss_conf             8346654033410013305806899999989727766998666342233


No 55 
>>2qyg_A Ribulose bisphosphate carboxylase-like protein 2; beta-alpha-barrel, unknown function; 3.30A {Rhodopseudomonas palustris CGA009} (A:165-452)
Probab=22.54  E-value=41  Score=12.96  Aligned_cols=19  Identities=16%  Similarity=0.036  Sum_probs=16.1

Q ss_pred             CCHHHHHHHHHHHHHHCCC
Q ss_conf             7689999999999852236
Q gi|254780612|r  484 KKGADIFKSAIMQWENRSN  502 (503)
Q Consensus       484 ~~g~~~f~~a~~~w~~~~~  502 (503)
                      ..|-++|.+|+.+|.+..+
T Consensus       249 ~aGa~A~RqA~ea~~~g~~  267 (288)
T 2qyg_A          249 AAGATSIRQAWDAIAAGIP  267 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             8899999999999974997


No 56 
>>1yew_A Particulate methane monooxygenase, B subunit; membrane protein, copper, zinc, beta barrel, oxidoreductase; 2.80A {Methylococcus capsulatus str} (A:1-14,A:244-382)
Probab=22.38  E-value=41  Score=12.94  Aligned_cols=109  Identities=12%  Similarity=0.109  Sum_probs=65.3

Q ss_pred             EEEEEEECCCCCEEEEEEECCCCCCCCCE--EEEEEEEEECCCCC------CCCHHHCCCCEECCCC-CCCCCCCCCEEE
Q ss_conf             23676307877717999951789877781--28899997168888------7321103231021332-124663110016
Q gi|254780612|r  363 VIKGDIPMIDNAFSASMTLKCNADISLSI--THVMEIMFSFPKES------QDAVVDLRRISMRKTD-NSPSVLIDSNIF  433 (503)
Q Consensus       363 aira~i~iP~~~~~~~~~~rrn~d~slpa--sh~~e~~f~~~~~~------~~~v~~v~~~~~k~~e-~~~g~~l~~~~~  433 (503)
                      .++|.-.+|.|.|+|+|.+.-|+|.-+=-  =.+.-|-|+-|+.+      ..-..+-.||.+.+++ =+.|.- ..+.+
T Consensus        25 v~~A~Y~VPGR~l~~~~~VTN~g~~pvrLgEF~TAnvRFlN~~v~~~~~~yp~~lla~~GL~v~d~~pI~PGET-k~v~v  103 (153)
T 1yew_A           25 VEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGET-RTVDV  103 (153)
T ss_dssp             EEEEEEESSCSEEEEEEEEEECSSSCEEEEEEECSSCEEECTTTCCCCSCCCGGGEETTCEEESCCSCBCTTCE-EEEEE
T ss_pred             EECCEEECCCCEEEEEEEEECCCCCCEEEEEEEECCEEEECCCCCCCCCCCCHHHHCCCCCEECCCCCCCCCCC-EEEEE
T ss_conf             82557634781799999997489874688656514267757765557899986784678715089987599962-48999


Q ss_pred             EECCCEEEEECCCCCHHHHHHHHHHHCCC---CEEEEEEECCCCEEEEEEC
Q ss_conf             74698289981788256887799973078---1168788379967899961
Q gi|254780612|r  434 VISKNSYLISLKGSEEDPFRNSKILEEYR---FIDIPITYRSGQKILFTID  481 (503)
Q Consensus       434 kv~~~~f~v~l~~~~~~~~~n~~ll~~~~---w~dip~~y~ngrra~~~~e  481 (503)
                      +++|         ..=+.+|=..|+..-+   |==+=.....|+|-++.|.
T Consensus       104 ~a~D---------A~WEveRLs~L~~DpdSrfgGLLfF~d~~G~R~i~eI~  145 (153)
T 1yew_A          104 TASD---------AAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQID  145 (153)
T ss_dssp             EEEC---------HHHHHTCGGGGGGSSCCEEEEEEEEEETTSCEEEEEEE
T ss_pred             EEEC---------HHHHHHHHHHHHCCCCCCEEEEEEEECCCCCEEEEECC
T ss_conf             9610---------05569999887569612000699998488878741037


No 57 
>>3fcg_A F1 capsule-anchoring protein; beta barrel, beta strand swapping, cell membrane, cell outer membrane, cell projection, fimbrium, membrane; 2.85A {Yersinia pestis} (A:)
Probab=22.38  E-value=37  Score=13.26  Aligned_cols=28  Identities=21%  Similarity=0.215  Sum_probs=24.0

Q ss_pred             HHHHHHHCCCCEEEEEEECCCCEEEEEE
Q ss_conf             7799973078116878837996789996
Q gi|254780612|r  453 RNSKILEEYRFIDIPITYRSGQKILFTI  480 (503)
Q Consensus       453 ~n~~ll~~~~w~dip~~y~ngrra~~~~  480 (503)
                      +|+-++...+=++|-|.+.+||+-.+++
T Consensus        51 ~dlp~~~g~gdl~v~i~d~~G~~~~~~~   78 (90)
T 3fcg_A           51 ANLPLGGGSGELKVIIHESDGTKQVFTV   78 (90)
T ss_dssp             CCCC---CCEEEEEEEECTTSCEEEEEE
T ss_pred             CCCCCCCCCEEEEEEEEECCCCEEEEEE
T ss_conf             0777658740599999978999999998


No 58 
>>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} (A:203-286)
Probab=22.17  E-value=42  Score=12.91  Aligned_cols=30  Identities=17%  Similarity=0.376  Sum_probs=23.8

Q ss_pred             HHHHHHHHHCCCCEEEEEEECCCC-EEEEEE
Q ss_conf             887799973078116878837996-789996
Q gi|254780612|r  451 PFRNSKILEEYRFIDIPITYRSGQ-KILFTI  480 (503)
Q Consensus       451 ~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~  480 (503)
                      ..-=+++|++.+|=-+|+|..||| .++||.
T Consensus        18 i~ea~~~m~~~~~~~lpVvd~~~~lvGiit~   48 (84)
T 2oux_A           18 QEDVAQTIRDYDFLAVPVTDYDDHLLGIVTV   48 (84)
T ss_dssp             HHHHHHHHHHHTCSEEEEECTTCBEEEEEEH
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCEEEEEEEH
T ss_conf             8899999997498666388679969999889


No 59 
>>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} (A:66-82,A:256-394)
Probab=22.11  E-value=42  Score=12.91  Aligned_cols=90  Identities=12%  Similarity=0.115  Sum_probs=61.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEEEEEECCCCCCCCHHHCCCCEECCCCCCCCCCCCC--------EEEEECCCEEEEECCC
Q ss_conf             17999951789877781288999971688887321103231021332124663110--------0167469828998178
Q gi|254780612|r  375 FSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDS--------NIFVISKNSYLISLKG  446 (503)
Q Consensus       375 ~~~~~~~rrn~d~slpash~~e~~f~~~~~~~~~v~~v~~~~~k~~e~~~g~~l~~--------~~~kv~~~~f~v~l~~  446 (503)
                      +.+.|+|-|---.+-=+-|+--.+|.+-++-|-.|..=+++-+|     +||-...        +...-.||+.|..+||
T Consensus        56 ~g~~~~~l~~g~~~~~~r~t~~~iy~v~eGaG~~~vg~~~f~w~-----~~Dif~~pawtw~Eh~~~~~~e~a~lLt~sD  130 (156)
T 3bu7_A           56 MGASMQMLRPGEHTKAHRHTGNVIYNVAKGQGYSIVGGKRFDWS-----EHDIFCVPAWTWHEHCNTQERDDACLFSFND  130 (156)
T ss_dssp             CEEEEEEECTTCBCCCEEESSCEEEEEEECCEEEEETTEEEEEC-----TTCEEEECTTCCEEEEECCSSCCEEEEEEES
T ss_pred             HHHHEEEECCCCCCCCCCCCCCEEEEEEECCEEEEECCEEEEEE-----CCCEEEECCCCCEEEEECCCCCCEEEEEECC
T ss_conf             43003783899877885735827999996829999999998972-----8998994999867864068998789999468


Q ss_pred             CCHHHHHHHHHHHCCCCEEEEEEECCCCEEE
Q ss_conf             8256887799973078116878837996789
Q gi|254780612|r  447 SEEDPFRNSKILEEYRFIDIPITYRSGQKIL  477 (503)
Q Consensus       447 ~~~~~~~n~~ll~~~~w~dip~~y~ngrra~  477 (503)
                      ..  ++--|.|++|+      +.-.|||.-|
T Consensus       131 ~P--~q~alGlwrE~------mGE~~~~h~I  153 (156)
T 3bu7_A          131 FP--VMEKLGFWAEQ------ALEDNGGHQI  153 (156)
T ss_dssp             HH--HHHHTTCCCEE------ECCSTTTCCC
T ss_pred             HH--HHHHHHHHHHH------HCCCCCCCCC
T ss_conf             89--99885316653------3122578677


No 60 
>>2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} (C:187-278)
Probab=21.62  E-value=43  Score=12.84  Aligned_cols=60  Identities=13%  Similarity=0.143  Sum_probs=38.9

Q ss_pred             CCCCCEEE-EECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCC--CHHHHHHHHHH
Q ss_conf             63110016-746982899817882568877999730781168788379967899961587--68999999999
Q gi|254780612|r  426 VLIDSNIF-VISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGK--KGADIFKSAIM  495 (503)
Q Consensus       426 ~~l~~~~~-kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~--~g~~~f~~a~~  495 (503)
                      .+.+++.+ +|.+++|+|=.+..+..          .++.|+.++|..-+.-++-.+-|.  --+.-|.+++.
T Consensus         7 ~~~~avt~g~~~~~~~ivDpt~~Ee~----------~~~~~l~va~~~~~~~~~l~~~g~~~~~~~~~~~~l~   69 (92)
T 2nn6_C            7 THPVATSFAVFDDTLLIVDPTGEEEH----------LATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMS   69 (92)
T ss_dssp             CCCEEEEEEECTTTCCEESCCTTTTT----------SCSEEEEEEECTTCCEEEEEESCCSCCCHHHHHHHHH
T ss_pred             CCCEEEEEEEECCCEEEECCCHHHHH----------HCCCEEEEEECCCCCEEEEEECCCCCCCHHHHHHHHH
T ss_conf             66215799987496389659877896----------5488699999399989999946898879999999999


No 61 
>>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} (A:144-201)
Probab=21.60  E-value=43  Score=12.84  Aligned_cols=29  Identities=14%  Similarity=0.272  Sum_probs=23.3

Q ss_pred             EECCCEEEEECCCCCHHHHHHHHHHHCCCCEE
Q ss_conf             74698289981788256887799973078116
Q gi|254780612|r  434 VISKNSYLISLKGSEEDPFRNSKILEEYRFID  465 (503)
Q Consensus       434 kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~d  465 (503)
                      |---|||+..   ...|-.+.+..|.+++||+
T Consensus        18 kggRGyF~a~---s~eef~~k~~~l~~~Gii~   46 (58)
T 2r7k_A           18 RGGRGYFIAS---STEEFYKKAEDLKKRGILT   46 (58)
T ss_dssp             CC---EEEES---SHHHHHHHHHHHHHTTSCC
T ss_pred             HCCCCEEEEE---CHHHHHHHHHHHHHHHHHC
T ss_conf             3796359998---8789999999998652310


No 62 
>>3dnx_A Uncharacterized protein SPO1766; structural genomics, APC88088, protein of unknown function, PSI-2, protein structure initiative; HET: MSE; 1.94A {Silicibacter pomeroyi} (A:)
Probab=21.24  E-value=43  Score=12.79  Aligned_cols=21  Identities=19%  Similarity=0.070  Sum_probs=8.7

Q ss_pred             EEEECCCCCCCCCEEEEEEEEEECCC
Q ss_conf             99951789877781288999971688
Q gi|254780612|r  378 SMTLKCNADISLSITHVMEIMFSFPK  403 (503)
Q Consensus       378 ~~~~rrn~d~slpash~~e~~f~~~~  403 (503)
                      .|+|+.+-+     +.++||+-...+
T Consensus        45 v~a~~~~g~-----~~~iEiKvSraD   65 (153)
T 3dnx_A           45 VXGLGPKGE-----IWVIECKSSRAD   65 (153)
T ss_dssp             EEEECTTCC-----EEEEEECSSHHH
T ss_pred             EEEECCCCC-----EEEEEEECCHHH
T ss_conf             999889994-----999997357888


No 63 
>>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} (A:80-164)
Probab=20.86  E-value=44  Score=12.74  Aligned_cols=51  Identities=18%  Similarity=0.304  Sum_probs=38.7

Q ss_pred             CCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCC-CEEEEEEECCCCEEEEEECCCCC
Q ss_conf             1001674698289981788256887799973078-11687883799678999615876
Q gi|254780612|r  429 DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYR-FIDIPITYRSGQKILFTIDKGKK  485 (503)
Q Consensus       429 ~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~-w~dip~~y~ngrra~~~~ekg~~  485 (503)
                      -|-.|-|+++++.|=+++.....+.=+++|+..+ -++|   -+.|+-|   |++|.-
T Consensus        31 ~akIvDv~~~s~iiE~tg~~~kid~fi~~l~~~g~I~Ei---~RTG~vA---i~Rg~~   82 (85)
T 2f1f_A           31 RGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEV---ARSGVVG---LSRGDK   82 (85)
T ss_dssp             TCEEEEECSSEEEEEEEECHHHHHHHHHHHTTTSEEEEE---EECCCEE---EESTTC
T ss_pred             CCEEEECCCCEEEEEEECCHHHHHHHHHHHHCCCCEEEE---ECCCHHH---HHCCCH
T ss_conf             969997379989999939989999999986141878999---7478743---105601


No 64 
>>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} (A:1-151,A:211-252)
Probab=20.77  E-value=44  Score=12.72  Aligned_cols=40  Identities=15%  Similarity=0.193  Sum_probs=32.3

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCE
Q ss_conf             46982899817882568877999730781168788379967
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK  475 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrr  475 (503)
                      -.+|.|++.+.+...+--|.+-||.||-+-.+-| |.|=+|
T Consensus       136 kpgG~lii~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  175 (193)
T 1wzn_A          136 KPGGVFITDFPCWFYGTPREVRLLAEKYFEKVKI-YGNLKR  175 (193)
T ss_dssp             EEEEEEEEEEEC----CHHHHHHHHTTTSSEEEE-EETTBS
T ss_pred             CCCCEEEEEECCCHHCCHHHHHHHHHCCCEEEEE-EECCCC
T ss_conf             9882899997672102999999999859989999-948888


No 65 
>>1f8n_A Lipoxygenase-1; dioxygenase, metalloprotein, fatty acids, oxidoreductase; 1.40A {Glycine max} (A:1-152)
Probab=20.05  E-value=42  Score=12.92  Aligned_cols=17  Identities=18%  Similarity=0.286  Sum_probs=13.0

Q ss_pred             EEEEEEEECCCCCC--CCH
Q ss_conf             88999971688887--321
Q gi|254780612|r  393 HVMEIMFSFPKESQ--DAV  409 (503)
Q Consensus       393 h~~e~~f~~~~~~~--~~v  409 (503)
                      -.-|+.|.||++||  |+|
T Consensus        79 ~~y~~~F~v~~~fG~pGAi   97 (152)
T 1f8n_A           79 SAFNIHFEWDGSMGIPGAF   97 (152)
T ss_dssp             EEEEEEEECCGGGCCEEEE
T ss_pred             EEEEEEEEECCCCCCCCEE
T ss_conf             5889898720667985469


Done!