BLAST/PSIBLAST alignment of GI: 254780612 and GI: 315121812 at iteration 1
>gi|315121812|ref|YP_004062301.1| putative transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 500
>gi|313495214|gb|ADR51813.1| putative transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 500
 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 294/504 (58%), Positives = 382/504 (75%), Gaps = 8/504 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+LVIQRAVDNL ENTPE RSHIYE AR +V+R+LESM PR P++ILERQ +KLE+A
Sbjct: 1   MVDFVLVIQRAVDNLSENTPEMRSHIYERARVAVSRQLESMNPRTPRDILERQLSKLEKA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           ILQVE++N+K      +D+    PKS V SK+N+FL  RL SISSILR+ K K+  +I+S
Sbjct: 61  ILQVERKNKKFPRALDKDRVLLAPKSHVNSKKNVFLTSRLTSISSILRNRKRKRTVDIVS 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +G  +T T+  P     +LR+IL  S N Q   ++ +  + +IE++K+RLRR KL   F
Sbjct: 121 TKGNKKTTTH-RP----YQLRDILHLSSNVQQGSNAQILSMESIEYNKNRLRRDKLLRKF 175

Query: 181 SFPTG-SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
           S  +  SIF+ + +YF NK R  +SFY+AL E+H FK  VFL++ LGM +G+SYS  ++K
Sbjct: 176 SVSSSRSIFFLLQSYFSNKIRVFISFYTALLEYHFFKQSVFLVVFLGMMMGLSYSFWQNK 235

Query: 240 GSITHFLRRESLDGGNVDKKNVFS-GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
            S +H L  + L+  + +KK + + G RPKITRRLL +GSEVD+G +     + +NTSN+
Sbjct: 236 VSFSHILENKILNRDSDNKKVLHALGSRPKITRRLLANGSEVDMGTAISSPINSSNTSNV 295

Query: 299 AFKNYI-GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
            FKN+I   D+  + +L +K+    NP+  +GRVFIN+G G+SSI +G I WSLQ+EK+Q
Sbjct: 296 FFKNHIDSNDQAVSHILERKKSGTENPIDEDGRVFINQGSGRSSIFAGNIFWSLQKEKTQ 355

Query: 358 GLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISM 417
           GLKGLVIKGDIP I+NAFSAS+TLKCNADI+LS+TH+MEI FSFPKESQ+++VDLR+ISM
Sbjct: 356 GLKGLVIKGDIPTINNAFSASITLKCNADIALSVTHLMEITFSFPKESQNSIVDLRQISM 415

Query: 418 RKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKIL 477
           RKT+NSPS+LIDSNIF ISKNSYLISLKG  ED  RNSKILEEYR+IDIPITY SGQKI 
Sbjct: 416 RKTENSPSILIDSNIFRISKNSYLISLKGDAEDFLRNSKILEEYRWIDIPITYHSGQKIT 475

Query: 478 FTIDKGKKGADIFKSAIMQWENRS 501
            TIDKGK G+D+FKSA+M W++ S
Sbjct: 476 LTIDKGKVGSDVFKSAVMDWKDHS 499