BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780612|ref|YP_003065025.1| putative transmembrane protein
[Candidatus Liberibacter asiaticus str. psy62]
         (503 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040289|gb|ACT57085.1| putative transmembrane protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 503

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 503/503 (100%), Positives = 503/503 (100%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA
Sbjct: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS
Sbjct: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
           VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF
Sbjct: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG
Sbjct: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF
Sbjct: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
           KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK
Sbjct: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360

Query: 361 GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKT 420
           GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKT
Sbjct: 361 GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKT 420

Query: 421 DNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTI 480
           DNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTI
Sbjct: 421 DNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTI 480

Query: 481 DKGKKGADIFKSAIMQWENRSNN 503
           DKGKKGADIFKSAIMQWENRSNN
Sbjct: 481 DKGKKGADIFKSAIMQWENRSNN 503


>gi|240850015|ref|YP_002971408.1| putative transmembrane protein [Bartonella grahamii as4aup]
 gi|240267138|gb|ACS50726.1| putative transmembrane protein [Bartonella grahamii as4aup]
          Length = 473

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 97/511 (18%), Positives = 204/511 (39%), Gaps = 58/511 (11%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+ ++++A+D     T + R  IY+ A  ++  +   +  ++P+ I + Q   L+ A
Sbjct: 1   MVDFVGILKKAIDAQNNVTSQVRKRIYKRAIETLEYQF--VTAKIPQAIADEQRKILQSA 58

Query: 61  ILQVEKQNQKS----LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
           I  VE++        L +      ++I +    +K+ I  +    S+  I R        
Sbjct: 59  IATVEEEYLAVEKKLLSSVIGWDPTNINEDKKYTKKTILPKNNEFSVLDIKRKQ------ 112

Query: 117 NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
           + ++    S+        +        +   V +QH     +   ++ + D   +     
Sbjct: 113 DFVTHPKDSKLFDEPWVSDIPDAEPVNMEADVPSQHVNSCELKI-SSSQEDNPHIVSHIF 171

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
           +                      + L     +L +  +    V ++      IG+ +  G
Sbjct: 172 S----------------------QALRRANKSLVQRRIVISAVSVVSFAVFTIGIFFIGG 209

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG-PSTIPVADFANT 295
           +   S  H +  E+L   +   K +   ++ K+T+RLLEDGSE+DVG       +D    
Sbjct: 210 RVFVSNDHQVLGENLQVSHEVPKAL--SVKRKLTQRLLEDGSEIDVGLKQATDSSDEEGV 267

Query: 296 SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
           S +   N    D+             G  +  + R   +       I +G + W+L +E 
Sbjct: 268 STVVSSNLQSLDKL------------GEAVFYQARTNYDAE----KIATGSVRWTLIKES 311

Query: 356 S--QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQDAVVDL 412
                 +   I+GDI + D   S  + L+ N D +    ++M+++F      S  A+  +
Sbjct: 312 YVKGAPEETAIQGDITIPDEGLSLRLILRRNTDRTFPAAYIMDLIFILSDKFSGKAISSV 371

Query: 413 RRISMRKTDNSPSVLID-SNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYR 471
           + ++ + ++ S    +  +    I+ + +L++L  +     RN +++ E  ++ + +T +
Sbjct: 372 QALTFKASEQSIGQPLVRTISTKINDDFFLVALSDNHPFLDRNLQLMRELDWVRLVLTDK 431

Query: 472 SGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           +G+    T  KG  G  IF   I QW  + +
Sbjct: 432 NGRINELTFAKGPTGESIFNKVIGQWLAQQD 462


>gi|121602864|ref|YP_988609.1| hypothetical protein BARBAKC583_0286 [Bartonella bacilliformis
           KC583]
 gi|120615041|gb|ABM45642.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 499

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 109/510 (21%), Positives = 219/510 (42%), Gaps = 47/510 (9%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+ ++++ +D     TP+ R  +YE A  ++  +L  ++  +P+ +++ Q   L+ A
Sbjct: 1   MVDFVGILKKTIDAQNNVTPQVRKQVYERAIETLEHKL--VEANMPETVIDAQRQALQSA 58

Query: 61  ILQVEKQN----QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
           I  VE++     ++ L +    K ++       +    FL+ ++ S+   +   +H  + 
Sbjct: 59  ISVVEEEYLAVEKELLSSVIGWKFTNEFDDHKRTPSTAFLKSKVMSV--FVTKQQHSFVT 116

Query: 117 NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
             +  +  ++++  LS  +            VN    + S       IE  KS+      
Sbjct: 117 ESIKNEILNKSSKILSIPDAE---------LVNMDSFFASEHKINQNIEKKKSKNDAISS 167

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
           A + +F   S  ++         + L     A     +       +    + I   +   
Sbjct: 168 AQVDNFHIISHIFA---------QALQRANRASVRKRIVIGVCVFVSFCFVFISAFFVGK 218

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
           +   S  H L+ +     N+    V +   PK+T+RLLEDGSE++VGP     A     +
Sbjct: 219 RVFVSSDHQLQEDDTYVPNLSSTVVQAN--PKLTQRLLEDGSEINVGPVEEEEAQGEKGT 276

Query: 297 NIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
           +    N I   +++           G  +  + R   +       + +G  LWSL +E S
Sbjct: 277 STVVANDINSMKHA-----------GEVVFYQSRTDYDAE----KVATGSALWSLVKETS 321

Query: 357 --QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQDAVVDLR 413
                + L I+GDI + D   S  +TL+ N D+SL   ++M+++F      S  A+ D++
Sbjct: 322 VNGQSEELAIRGDIKIPDEGLSLRLTLRRNTDLSLPAAYIMDLIFITSDKFSGQAISDIK 381

Query: 414 RISMRKTDNSPSVLID-SNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
            ++ + ++ S    +  + +  I  + +L++L G      RN +++ E  +I + +  ++
Sbjct: 382 TLTFKASEQSVGQALTRTVVAKIDDDFFLVALSGHYPFLNRNLQLIRELDWIRLVMNDKN 441

Query: 473 GQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           G+    T  KG+ G  IF   I QW  ++N
Sbjct: 442 GRVNELTFAKGETGEAIFNQVIGQWLAQTN 471


>gi|49473930|ref|YP_031972.1| hypothetical protein BQ02810 [Bartonella quintana str. Toulouse]
 gi|49239433|emb|CAF25782.1| hypothetical protein BQ02810 [Bartonella quintana str. Toulouse]
          Length = 475

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 95/515 (18%), Positives = 201/515 (39%), Gaps = 64/515 (12%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+ ++++A+D     TP+ R  +Y+ A  ++  +  +    +PK I + Q   L+ A
Sbjct: 1   MVDFVGILKKAIDAQINVTPQVRERVYKRAIETLEHQFAAAT--IPKAIADEQKKILQSA 58

Query: 61  ILQVEKQNQKSLHT---------SKQDKESDIP-KSSVTSKENIFLEPRLRSISSILRSN 110
           I  VE++                 K   E D   ++S+  +EN F   ++ S    + S+
Sbjct: 59  IAAVEEEYLAVEKELLSSVIGWNPKGIAEDDKHIQNSILPQENEFSVVKMESRQGSITSS 118

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
           K  +     S  G             + +  +  +F  +             +++ D   
Sbjct: 119 KDNQAFGESSESGIPDAELVNMEAYLTSQDADNNTFKTS---------PLALSLQGDNPH 169

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
           +     +                      + L     +  +  +      +   + + IG
Sbjct: 170 IVSHIFS----------------------QALRRANRSSMQRRIVISAAVVTSFVMLIIG 207

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
           + +   +      H L   ++   ++  K     ++ K+T+RLLEDGSEVDVG +    +
Sbjct: 208 IYFIGVRVFVLNDHQLSGGNVQASHLLPKAPA--VKRKLTKRLLEDGSEVDVGLNPTADS 265

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                 +                  +   + G  +  + R   +       + +G   W+
Sbjct: 266 SNEEGISTVVT-----------SNLQSIEQPGEAVFYQARTNYDAE----KVATGNARWT 310

Query: 351 LQQEKS--QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQD 407
           L +E S   G +   I+GDI + D   S  + L+ N D+S    ++M+++F      S  
Sbjct: 311 LIKESSVKGGPEESAIQGDITIPDKGLSLRLILRRNTDLSFPAAYIMDLIFILSDKFSGQ 370

Query: 408 AVVDLRRISMRKTDNSPSVLI-DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDI 466
           A+ +++ ++ + ++ S    +  +    I  + +L++L G+     RN +++ E  ++ +
Sbjct: 371 AIRNVQAVTFKASEQSVGQALKRAVAAKIDDDFFLVALSGNHPFLNRNLQLMRELDWMRL 430

Query: 467 PITYRSGQKILFTIDKGKKGADIFKSAIMQWENRS 501
            +T ++G+    T  KG  G  IF   I QW  ++
Sbjct: 431 VLTDKNGRINELTFAKGPTGKSIFNEVIGQWLAQT 465


>gi|163867807|ref|YP_001609011.1| hypothetical protein Btr_0568 [Bartonella tribocorum CIP 105476]
 gi|161017458|emb|CAK01016.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 473

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 99/517 (19%), Positives = 202/517 (39%), Gaps = 70/517 (13%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDFI ++++A++     TP+ R  IY+ A  ++  +   +  ++P+ I + Q   L+ A
Sbjct: 1   MVDFIGILKKAINAQNNVTPQVRQRIYKRATETLEHQF--LTAKIPQAIADEQRRILQSA 58

Query: 61  ILQVEKQNQKSLH----------TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
           I  VE++  +                 +++    K  +  K N F     +S    ++ +
Sbjct: 59  ITTVEEEYLEVEKRLLSSAMGWNPKDINEDKRYIKEVILPKNNEFSVVSTKSKQDFVKIS 118

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
           K  ++ N   V                                 +     V+  + D   
Sbjct: 119 KDNEVLNEPCVSDMPEAEPVNMQAYLPSE-------------HVNRCALKVSPSQEDNPH 165

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
           +     +                      + L     +L +  +    + ++  + + +G
Sbjct: 166 IVSHIFS----------------------QALRRANKSLVQRRIVISAISVVSFVVLTVG 203

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG-PSTIPV 289
           + +  G+   S  H L  E+L       K +   ++ K+T+RLLEDGSEVDVG       
Sbjct: 204 IFFIGGRVFVSNDHQLLGETLQASQGVPKAL--SVKRKLTQRLLEDGSEVDVGLKQAADS 261

Query: 290 ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILW 349
            D    S +  KN    +++            G  +  + R   +       + +G   W
Sbjct: 262 YDEEGISKVVAKNLQSLEKS------------GEAVFYQARTNYDAE----KVATGSARW 305

Query: 350 SLQQEKSQGLK--GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQ 406
           +L +E         + I+GDI + D   S  + L+ NAD S    ++M+++F      S 
Sbjct: 306 TLIRESHVKGASEEMAIQGDITIPDEGLSLRLILRRNADRSFPAAYIMDLIFILSDKFSG 365

Query: 407 DAVVDLRRISMRKTDNSPSVLID-SNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFID 465
            A+ +++ ++ + ++ S    +  +    I+ + +L++L G+     RN +++ E  +I 
Sbjct: 366 KAISNVQALTFKASEQSIGQALTRTISAKINDDFFLVALSGNHPFLDRNLQLMRELNWIR 425

Query: 466 IPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           + +T ++G+    T  KG  G  IF   I QW  + +
Sbjct: 426 LVLTDKNGRINELTFAKGPTGESIFNEVIGQWLAQQD 462


>gi|49475180|ref|YP_033221.1| hypothetical protein BH03800 [Bartonella henselae str. Houston-1]
 gi|49237985|emb|CAF27190.1| hypothetical protein BH03800 [Bartonella henselae str. Houston-1]
          Length = 451

 Score =  283 bits (722), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 94/504 (18%), Positives = 185/504 (36%), Gaps = 68/504 (13%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+ ++++A++     TP+ R  IY+ A  ++  +  +    +P+ I E Q   L+ A
Sbjct: 1   MVDFVGILKKAINAQNNVTPQLRKRIYKRALKTLEHQFVATT--IPQAIAEEQRKILQSA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I  VE +                                      I  + K    A+  +
Sbjct: 59  IATVEAEYLAVEKELLSSV--------------------------IGWNPKGITEADKHT 92

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                      S    S      +     +QH  D++   V+ +           ++ IF
Sbjct: 93  QTSVLSQGHESSILGMSDAEPVNMKACFASQHA-DNTTLRVSPLASPLQGDNPHIVSHIF 151

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           S                  + L     +  +  +      +     + IG+ +  G+   
Sbjct: 152 S------------------QALRRANRSSMQRRIVISTAIVTGFFTLIIGICFVGGRVFI 193

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           S  H L   ++   +V  + +   ++ K+T+RLLEDGSEVD   S    AD +N   I+ 
Sbjct: 194 SNDHQLSGGNVKASHVLPQTL--SVKRKLTQRLLEDGSEVDT--SLDQTADSSNEEGIST 249

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK--SQG 358
                                G  +  + R   +       + +G   W+L +E      
Sbjct: 250 AISSSLQSMEQL---------GEAVFYQARTDYDTE----KVATGSARWTLIKESRVKGA 296

Query: 359 LKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQDAVVDLRRISM 417
            +   I+GDI + D   S  + L+ N D+S    ++M+++F      S  A+  ++ ++ 
Sbjct: 297 PEESAIQGDITIPDKGLSLRLILRRNTDVSFPAAYIMDLIFILSDKFSGQAISSVQALTF 356

Query: 418 RKTDNSPSVLID-SNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKI 476
           + ++ S    +  +    I  + +L++L        RN +++ E  ++ + +T ++G+  
Sbjct: 357 KASEQSVGQALTRTVTAKICDDFFLVALSSKHPFLNRNLQLMRELDWMRLVLTDKNGRTN 416

Query: 477 LFTIDKGKKGADIFKSAIMQWENR 500
             T  KG  G  IF   I +W   
Sbjct: 417 ELTFAKGPIGESIFNKVIGKWLEE 440


>gi|85715271|ref|ZP_01046254.1| hypothetical protein NB311A_05223 [Nitrobacter sp. Nb-311A]
 gi|85697917|gb|EAQ35791.1| hypothetical protein NB311A_05223 [Nitrobacter sp. Nb-311A]
          Length = 510

 Score =  279 bits (712), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 87/517 (16%), Positives = 175/517 (33%), Gaps = 29/517 (5%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E+R  +YE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISGLDVNAPGEQRRALYERARTALIAQLRGVEPPLSESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + +   S    +   +       P   +   I          +  
Sbjct: 61  AVRKVESEAAQRAREASRSGGSRSGDAFRAATRAAMKSPDTATQPPI---------RSRA 111

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
           +   + R        +     R                      +  +    R       
Sbjct: 112 NATPQPRNLRGDPAPSPPPSWRPPGPPISLQDEPPARERQSQEHLRRNSEPERPPPPVPG 171

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV----SYSI 235
           F   T                   ++ +  S+   F      +   G   G         
Sbjct: 172 FRDVTADADDLGRAAAQANRLARRTYANVRSQSPEFDRLEPSLEDRGGFEGAYPPHEPPF 231

Query: 236 GKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE-----DGSEVDVGPSTIPVA 290
           G +       L R     G    K  F G  P  +  ++       G+ +  GP+ +   
Sbjct: 232 GGNVDDQPPPLPRSWPQPGRDRPKLSFGGGFPLKSAIVVGLVLILAGAGIVWGPNAVSTV 291

Query: 291 -----DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS- 344
                    T+ +A     G        +G+    E    + +  V  ++          
Sbjct: 292 RGLFDSSHKTAELAKPATPGLKPKIADRVGQPASSETIAPVAQRVVLYDEDPSDPKGKQY 351

Query: 345 -GKILWSLQQE--KSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSF 401
            G ++W  ++    +     + ++ +I + +  F  +M+ + N D SL  +H  E+ F  
Sbjct: 352 VGSVVWRTEEVKGAAGNKPEIAVRAEIDIPERKFKMTMSFRRNTDTSLPASHTAELTFVL 411

Query: 402 PKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEE 460
           P++     V ++  I M+  + S    +      ++   +L+ L   E D  RN ++L+E
Sbjct: 412 PQDFDGGGVSNVPGILMKSNEQSRGTPLAGLAVKVTDGFFLVGLSNVESDRVRNLQLLKE 471

Query: 461 YRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             + D+P+ Y + ++ +  I+KG  G   F  A   W
Sbjct: 472 RSWFDVPLVYTNQRRAIIAIEKGAPGERAFNEAFTAW 508


>gi|75677145|ref|YP_319566.1| hypothetical protein Nwi_2964 [Nitrobacter winogradskyi Nb-255]
 gi|74422015|gb|ABA06214.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 540

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 84/538 (15%), Positives = 171/538 (31%), Gaps = 41/538 (7%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E+R  +YE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDVNAPGEQRRALYERARTALIAQLRGVEPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + +   S    +   +       P + +   +         +  L
Sbjct: 61  AVRKVESEAAQRAREASRSSGSRSGDAFRAATRAAMKSPDVAAQPPVRSRANATPQSRNL 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA----------------- 162
                  +  + SP                     +                        
Sbjct: 121 RADSTPTSAPSPSPPPSVSPTPSWRPPGPPIPLPDEPPPPARERLGLGQNQNHNHQNQNQ 180

Query: 163 ---AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
                  +  R         F   T                   ++ +  S    F    
Sbjct: 181 GQPRRGPEPDRPPPRPPVPGFRDVTADADDLGRAAAQANRSARRTYANVRSPSPEFDRLE 240

Query: 220 FLIILLGMAIGVSYS-----IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLL 274
             +   G   G   S      G +    T  L R          + V  G  P  +  + 
Sbjct: 241 PSLEDRGAFEGAYPSDQSFSGGAAVDQPTAPLPRSWPHPDRERPERVLGGGFPLKSAIVA 300

Query: 275 E----------DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP 324
                            V            TS +      G     T  +G+  + E   
Sbjct: 301 GLLLILAGAGIIWGSNVVSAVRGLFDSSNQTSEMTKPVAPGLKPKITDRVGQPSMSETIA 360

Query: 325 LIGEGRVFINKGRGQSSILS--GKILWSLQQE--KSQGLKGLVIKGDIPMIDNAFSASMT 380
            + +  V  ++           G ++W  ++    +     + ++ +I + +  F  +M+
Sbjct: 361 PVAQRVVLYDEDPSDPKGKQYVGSVVWRTEEVKGAAGSKPEIAVRAEIDIPERKFKMTMS 420

Query: 381 LKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNS 439
            + N D SL  +H  E+ F  P +     V ++  + M+  + +    +      ++   
Sbjct: 421 FRRNTDTSLPASHTAELTFVLPPDFDGGGVSNVPGVLMKSNEQARGTPLAGLAVKVTDGF 480

Query: 440 YLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           +L+ L   E D  RN ++++E  ++DIP+ Y + ++ +  I+KG  G   F  A  +W
Sbjct: 481 FLVGLSNVESDRTRNLQLMKERSWLDIPLVYTNQRRAIIAIEKGAPGERAFNEAFTEW 538


>gi|27382162|ref|NP_773691.1| hypothetical protein bll7051 [Bradyrhizobium japonicum USDA 110]
 gi|27355332|dbj|BAC52316.1| bll7051 [Bradyrhizobium japonicum USDA 110]
          Length = 541

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 87/540 (16%), Positives = 170/540 (31%), Gaps = 44/540 (8%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E R  +YE AR ++  +L S++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAALDPNAPGESRRALYERARTALIAQLRSVQPPLSESEITRERLSLEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + +        S                  +        +     
Sbjct: 61  AVRKVESEAAQRAREASRPGGGGTRSSGSGDAFRRASTRATEGNPAAAPPAAPPRARPAP 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRR------ 173
                 R + N+  +  + R      F    Q    +   P   +     R R       
Sbjct: 121 PPPRADRPSFNVDDQGEAQRPPRAPRFDAPRQPGPPAPPPPEPPVPPPAGRERAGGRRPP 180

Query: 174 ----------GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                           F   T  +                ++ +  S    F      + 
Sbjct: 181 DIGPPPPLPPAPGVRGFRDITADVNDLGGAAAQANRAARRTYANVPSPSPEFDRLEPSLE 240

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                    YS  +S      +  R+   G            +PK  R +    S + VG
Sbjct: 241 NRAGEGDAPYSYDESVEEAERYAPRQ-PSGRPHIPVLDRDAKKPKRARSVFPFKSAIAVG 299

Query: 284 PST---------------------IPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEG 322
                                            +           +    V      ++ 
Sbjct: 300 IVLILVGAGILWGKPLLQTVSGLFKSSPTQVVEAPKDASQPQSKPKIPDRVGQPSASDQP 359

Query: 323 NPLIGEGRVFINKGRGQSSILS--GKILWSLQ--QEKSQGLKGLVIKGDIPMIDNAFSAS 378
              + +  V  ++           G ++W L+  +        + ++ DI + D  F  +
Sbjct: 360 VAPVAQKVVLYDEDPSDPKGKQYVGSVVWRLEPIKASGNQKADVAVRADIEIPDRKFKMT 419

Query: 379 MTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRISMRKTDNSPSVLIDSNIFVISK 437
           M+ + N D SL  +H  E+ F  P++     V ++  I M+  + +    +      ++ 
Sbjct: 420 MSFRRNTDSSLPASHTAELTFILPQDFPGGSVSNVPGILMKSNEQARGTPLAGLAVKVTD 479

Query: 438 NSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             +L+ L   + D  RN ++L+E  + D+P+ Y + ++ +  I+KG  G   F  A  QW
Sbjct: 480 GFFLVGLSNVDADRARNVQLLKERSWFDVPLVYANQRRAIIAIEKGAPGERAFNDAFAQW 539


>gi|239832769|ref|ZP_04681098.1| Myristoylated alanine-rich C-kinase substrate [Ochrobactrum
           intermedium LMG 3301]
 gi|239825036|gb|EEQ96604.1| Myristoylated alanine-rich C-kinase substrate [Ochrobactrum
           intermedium LMG 3301]
          Length = 475

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/501 (17%), Positives = 182/501 (36%), Gaps = 32/501 (6%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNILEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE          +   E            + FL+   R+      S  H       +
Sbjct: 59  IAEVEAFYAPPATPPEPPVE---------DALDDFLQEANRAAVDRAPS--HDDEPAFSA 107

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                R        +         +         + + +  +      S+  +    G  
Sbjct: 108 APHDERRGRVSGEDDDEPAFVAERNDDWKLDRAKEKAQARRSEYIERTSKKEKRSYKGPV 167

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                 +      Y     +  +   ++                   A G          
Sbjct: 168 VALIAVLALGTAGYVVWNNKDKIQELASSLGRSD-----------APATGSDSQTQPQDT 216

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           +        +  G    ++        K+T+RL+ DGSE D GP+         TS  A 
Sbjct: 217 TPPADSNAATTGGEQTPEQPQQPAGEQKLTQRLMPDGSETDSGPAGGANGIGEGTSTAAS 276

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSS--ILSGKILWSLQQEKSQG 358
                    +    G +  +     +G+  +   +  G  S  +  G ++WS+ +E  + 
Sbjct: 277 ---TPAPAETNSPAGAQPGQNQTVAVGQQALLYEERGGAGSDSVERGNVVWSVIEESPED 333

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAV-VDLRRI 415
            +     ++  + M  +     MT++ N D S+  +H++E++F+ P+     V  +++R+
Sbjct: 334 GQPAQPAVRATVTMPTSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFSGGVVDNVQRV 393

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I  N +++ L  +      N  ++   ++IDIPI+YR+G++
Sbjct: 394 TFKDTEQAAGNPLIAVPSKIGDNFFIVWLNDARTAQDTNLSLMRRLQWIDIPISYRNGRR 453

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 454 ALISLEKGVPGEKAFNDVLGA 474


>gi|306844674|ref|ZP_07477259.1| Basic-leucine zipper transcription factor [Brucella sp. BO1]
 gi|306274846|gb|EFM56616.1| Basic-leucine zipper transcription factor [Brucella sp. BO1]
          Length = 465

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/501 (17%), Positives = 188/501 (37%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL      +     S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEVEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                R   +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSTGPRAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLV 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PKDNASTAGGSSAGGQDQASQAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G   ++         +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPPST---------QEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|62290553|ref|YP_222346.1| hypothetical protein BruAb1_1666 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700469|ref|YP_415043.1| basic-leucine zipper (bZIP) transcription factor [Brucella
           melitensis biovar Abortus 2308]
 gi|189024774|ref|YP_001935542.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           S19]
 gi|237816059|ref|ZP_04595055.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254689851|ref|ZP_05153105.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 6 str. 870]
 gi|254697999|ref|ZP_05159827.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254730885|ref|ZP_05189463.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 4 str. 292]
 gi|256258104|ref|ZP_05463640.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 9 str. C68]
 gi|260547200|ref|ZP_05822938.1| basic-leucine zipper transcription factor [Brucella abortus NCTC
           8038]
 gi|260755383|ref|ZP_05867731.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758604|ref|ZP_05870952.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762436|ref|ZP_05874773.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884399|ref|ZP_05896013.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248954|ref|ZP_06932662.1| basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 5 str. B3196]
 gi|62196685|gb|AAX74985.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616570|emb|CAJ11649.1| Basic-leucine zipper (bZIP) transcription factor [Brucella
           melitensis biovar Abortus 2308]
 gi|189020346|gb|ACD73068.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           S19]
 gi|237788722|gb|EEP62934.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260095565|gb|EEW79443.1| basic-leucine zipper transcription factor [Brucella abortus NCTC
           8038]
 gi|260668922|gb|EEX55862.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672862|gb|EEX59683.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675491|gb|EEX62312.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873927|gb|EEX80996.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297174087|gb|EFH33444.1| basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 5 str. B3196]
          Length = 465

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 84/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEVERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ +GSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPNGSEVDAGHASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVQRGNVVWSVIEESRED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|153008563|ref|YP_001369778.1| hypothetical protein Oant_1232 [Ochrobactrum anthropi ATCC 49188]
 gi|151560451|gb|ABS13949.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 479

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 87/500 (17%), Positives = 184/500 (36%), Gaps = 28/500 (5%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNILEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE        T+        P+  V      FL+   +  +  + S++        S
Sbjct: 59  IAEVEAFYAPPAATA--------PEEPVDDALEDFLQEANQDAAERVPSHEDDDEPAFSS 110

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                R +   S  + +       S         + + +  +      S+  +    G+ 
Sbjct: 111 APRDERRDNFSSEDDDAPAFAAERSDDWKLDRAKEKAQARRSEYIERTSKKEQRSYKGLI 170

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  +   ++                         +   +  
Sbjct: 171 AALVAVLVLGGAGYAVWANKDKIQELASSLGRSDAPATGSDTGTHPEDSTTPPADTNTAT 230

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           +       +                 PK+T+RL+ DGSE D G +         TS  A 
Sbjct: 231 TGGEQTPEQ----------PQQPAGEPKMTQRLMPDGSETDSGSAGAANGIGEGTSTAAS 280

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSS--ILSGKILWSLQQEKS-- 356
                     T     +  +     +G+  +   +  G  S  +  G ++WS  +E    
Sbjct: 281 TPAPAETNTQTG---AQPGQNQTVAVGQQALLYEERGGAGSDSVERGNVVWSTIEESPED 337

Query: 357 QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAV-VDLRRI 415
                  ++  + M  +     MT++ N D S+  +H++E++F+ P+     V  +++RI
Sbjct: 338 GQPAEPAVRATVTMPTSKVELKMTIRKNTDQSIPASHLIELVFTVPEGFTGGVVDNVQRI 397

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I  N +++ L  +      N  ++   ++IDIPI+YR+G++
Sbjct: 398 TFKDTEQAAGNPLIAVPSKIGDNFFIVWLNDARTAQDTNLSLMRRLQWIDIPISYRNGRR 457

Query: 476 ILFTIDKGKKGADIFKSAIM 495
            L +++KG  G   F   + 
Sbjct: 458 ALISLEKGVPGEKAFNDVLG 477


>gi|254694343|ref|ZP_05156171.1| Basic-leucine zipper (bZIP) transcription factor [Brucella abortus
           bv. 3 str. Tulya]
 gi|261214651|ref|ZP_05928932.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260916258|gb|EEX83119.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 465

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEVERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGHASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESRED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|254719686|ref|ZP_05181497.1| hypothetical protein Bru83_09113 [Brucella sp. 83/13]
 gi|265984701|ref|ZP_06097436.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837856|ref|ZP_07470718.1| hypothetical protein BROD_0663 [Brucella sp. NF 2653]
 gi|264663293|gb|EEZ33554.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306407095|gb|EFM63312.1| hypothetical protein BROD_0663 [Brucella sp. NF 2653]
          Length = 465

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 84/501 (16%), Positives = 185/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + + E R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSSELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVNEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSTGPHAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASQAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G   ++         +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPPST---------QEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|256045292|ref|ZP_05448186.1| hypothetical protein Bmelb1R_12432 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565815|ref|ZP_05836298.1| basic-leucine zipper transcription factor [Brucella melitensis bv.
           1 str. 16M]
 gi|265991719|ref|ZP_06104276.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151188|gb|EEW86283.1| basic-leucine zipper transcription factor [Brucella melitensis bv.
           1 str. 16M]
 gi|263002675|gb|EEZ15078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 465

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEDADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESRED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|306841399|ref|ZP_07474102.1| Basic-leucine zipper transcription factor [Brucella sp. BO2]
 gi|306288584|gb|EFM59933.1| Basic-leucine zipper transcription factor [Brucella sp. BO2]
          Length = 465

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 86/501 (17%), Positives = 186/501 (37%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL      +     S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEVEQRAPSHSVDEEDEKSS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                R   +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSTGPRAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSADGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|148559726|ref|YP_001259535.1| hypothetical protein BOV_1625 [Brucella ovis ATCC 25840]
 gi|148370983|gb|ABQ60962.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 465

 Score =  256 bits (652), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEAERGDSDWKFERAREKASARCSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|225853139|ref|YP_002733372.1| hypothetical protein BMEA_A1735 [Brucella melitensis ATCC 23457]
 gi|256114250|ref|ZP_05454995.1| hypothetical protein Bmelb3E_15653 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263370|ref|ZP_05465902.1| basic-leucine zipper transcription factor [Brucella melitensis bv.
           2 str. 63/9]
 gi|265995556|ref|ZP_06108113.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641504|gb|ACO01418.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|262766840|gb|EEZ12458.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093368|gb|EEZ17437.1| basic-leucine zipper transcription factor [Brucella melitensis bv.
           2 str. 63/9]
 gi|326409695|gb|ADZ66760.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539402|gb|ADZ87617.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 465

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESRED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|254700343|ref|ZP_05162171.1| hypothetical protein Bsuib55_05734 [Brucella suis bv. 5 str. 513]
 gi|261750839|ref|ZP_05994548.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261740592|gb|EEY28518.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 465

 Score =  254 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 185/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G+ D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGSQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|23502539|ref|NP_698666.1| hypothetical protein BR1681 [Brucella suis 1330]
 gi|161619612|ref|YP_001593499.1| hypothetical protein BCAN_A1719 [Brucella canis ATCC 23365]
 gi|163845261|ref|YP_001622916.1| hypothetical protein BSUIS_B1156 [Brucella suis ATCC 23445]
 gi|225628250|ref|ZP_03786284.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254703462|ref|ZP_05165290.1| hypothetical protein Bsuib36_05962 [Brucella suis bv. 3 str. 686]
 gi|254708451|ref|ZP_05170279.1| hypothetical protein BpinM_16230 [Brucella pinnipedialis
           M163/99/10]
 gi|254708696|ref|ZP_05170507.1| hypothetical protein BpinB_00256 [Brucella pinnipedialis B2/94]
 gi|254714543|ref|ZP_05176354.1| hypothetical protein BcetM6_14632 [Brucella ceti M644/93/1]
 gi|254717441|ref|ZP_05179252.1| hypothetical protein BcetM_13761 [Brucella ceti M13/05/1]
 gi|256030222|ref|ZP_05443836.1| hypothetical protein BpinM2_06176 [Brucella pinnipedialis
           M292/94/1]
 gi|256160396|ref|ZP_05458086.1| hypothetical protein BcetM4_15424 [Brucella ceti M490/95/1]
 gi|256255604|ref|ZP_05461140.1| hypothetical protein BcetB_15248 [Brucella ceti B1/94]
 gi|256370091|ref|YP_003107602.1| hypothetical protein BMI_I1702 [Brucella microti CCM 4915]
 gi|260167897|ref|ZP_05754708.1| hypothetical protein BruF5_05927 [Brucella sp. F5/99]
 gi|260568770|ref|ZP_05839238.1| basic-leucine zipper transcription factor [Brucella suis bv. 4 str.
           40]
 gi|261219273|ref|ZP_05933554.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222809|ref|ZP_05937090.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315949|ref|ZP_05955146.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316189|ref|ZP_05955386.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322334|ref|ZP_05961531.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261754092|ref|ZP_05997801.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261757337|ref|ZP_06001046.1| basic-leucine zipper transcription factor [Brucella sp. F5/99]
 gi|265987252|ref|ZP_06099809.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265998767|ref|ZP_06111324.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294850934|ref|ZP_06791610.1| hypothetical protein BAZG_03064 [Brucella sp. NVSL 07-0026]
 gi|23348538|gb|AAN30581.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161336423|gb|ABX62728.1| Hypothetical protein BCAN_A1719 [Brucella canis ATCC 23365]
 gi|163675984|gb|ABY40094.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|225616096|gb|EEH13144.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|256000254|gb|ACU48653.1| hypothetical protein BMI_I1702 [Brucella microti CCM 4915]
 gi|260154154|gb|EEW89236.1| basic-leucine zipper transcription factor [Brucella suis bv. 4 str.
           40]
 gi|260921393|gb|EEX88046.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924362|gb|EEX90930.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261295024|gb|EEX98520.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295412|gb|EEX98908.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304975|gb|EEY08472.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737321|gb|EEY25317.1| basic-leucine zipper transcription factor [Brucella sp. F5/99]
 gi|261743845|gb|EEY31771.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262553456|gb|EEZ09225.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264659449|gb|EEZ29710.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294821577|gb|EFG38573.1| hypothetical protein BAZG_03064 [Brucella sp. NVSL 07-0026]
          Length = 465

 Score =  254 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGTETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|256061719|ref|ZP_05451856.1| hypothetical protein Bneo5_15366 [Brucella neotomae 5K33]
 gi|261325725|ref|ZP_05964922.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301705|gb|EEY05202.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 465

 Score =  253 bits (645), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 85/501 (16%), Positives = 184/501 (36%), Gaps = 42/501 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +D   + +PE R  +Y  AR ++ ++L  +     + +  RQ N LE A
Sbjct: 1   MADFVAVLKKTIDAQADKSPELRQRVYAKARATIEQKL--VTANASQAVAVRQRNLLEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE           + +             + FL            S+   +     S
Sbjct: 59  IAEVEASYAPPAPPRAEPQ---------HDPLDDFLHEANHEAEQRAPSHSVDEEDEKPS 109

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                    +    + +    E        +   + + +  +      +   +    G+ 
Sbjct: 110 FSAGPHAEADEEEADGALPEAERGDSDWKFERAREKASARRSEYIERNAPREKRPYKGLI 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +     +      Y     +  L   ++                       + +      
Sbjct: 170 AGLIALLVIGGGGYAVWANKDKLQELASSLGR-----------------SDAPATSTDGQ 212

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +         G  D+ +       K T+RL+ DGSEVD G ++        TS  A 
Sbjct: 213 PQDNASAAGGSSAGGQDQASPAPAEERKFTQRLMPDGSEVDAGRASGAPGIGEGTSTAAS 272

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG--QSSILSGKILWSLQQEKSQG 358
               G              +E    +G+  +   +  G    S+  G ++WS+ +E  + 
Sbjct: 273 TAGPGNPP---------SAQEQPVAVGQQALLYEERGGAETGSVERGNVVWSVIEESPED 323

Query: 359 LKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDA-VVDLRRI 415
            +     I+ ++ + ++     MT++ N D S+  +H++E++F+ P+      + +++RI
Sbjct: 324 GQPAQPAIRANVTIPNSKVELKMTIRKNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRI 383

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
           + + T+ +    + +    I+ N ++I L  +      N  ++   ++IDIPI YR+G++
Sbjct: 384 TFKDTEQAAGNPLIAVPSKIADNFFIIWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRR 443

Query: 476 ILFTIDKGKKGADIFKSAIMQ 496
            L +++KG  G   F   +  
Sbjct: 444 ALISLEKGVPGEKAFNDVLGA 464


>gi|115526134|ref|YP_783045.1| hypothetical protein RPE_4140 [Rhodopseudomonas palustris BisA53]
 gi|115520081|gb|ABJ08065.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 515

 Score =  246 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 83/513 (16%), Positives = 171/513 (33%), Gaps = 16/513 (3%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E R  +YE AR+++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDPNAPGEARRALYERARSALIAQLRGVQPPLSESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPK--SSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
           A+ +VE +  +    + +DKE +     S           P  +       + K  +  +
Sbjct: 61  AVRKVESEAAQRAREATRDKERNRSSGDSMRAGGRPAPPRPDTKPADGRPAAAKPAEPKS 120

Query: 118 ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
             +   ++R      P+       +      + +       +        +         
Sbjct: 121 AETKSSENRPAEPAPPRPERGAGEDQPQRPPHPEPPRPEQPNRERPAAPPRRTPESNAAM 180

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
             F      +                ++ +  S    F      +     A         
Sbjct: 181 RGFRDVVADVDDLGRAAAQANRAARKTYANVTSPSPEFDRLEPSLENRTEAEQPYSYDES 240

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP--------- 288
            + +  +           +  K V  G   K    L      V  G    P         
Sbjct: 241 PEEAARYQPPVRPQPEKTLKTKRVGGGFPIKSAIVLGVVLMLVGAGLLWGPGLYFSLRAM 300

Query: 289 -VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS--G 345
             +  A                 T  +G+    +    + +  V  ++           G
Sbjct: 301 LSSQPAAVDAPKDAATPQNRPKITDRVGQPSSMDQVAPVAQRVVLYDEDPNDPKGKQYVG 360

Query: 346 KILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES 405
            ++W  +Q K      + ++ D+ + + +F  +M+ + N D SL  +H  E+ F  P + 
Sbjct: 361 TVVWRTEQIKGGKGSDIAVRADLEIPERSFKMTMSFRRNTDSSLPASHTAELTFMLPADF 420

Query: 406 -QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFI 464
               V ++  I M+  + +    +      ++   +L+ L   E D  RN ++L+E  + 
Sbjct: 421 AGGGVSNVPGILMKSNEQARGTPLAGLAVKVTDGFFLVGLSNVESDRARNIQLLKERSWF 480

Query: 465 DIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           D+P+ Y + ++ +  I+KG  G   F  A   W
Sbjct: 481 DVPLVYTNQRRAIIAIEKGSPGDRAFADAFAAW 513


>gi|148253375|ref|YP_001237960.1| hypothetical protein BBta_1851 [Bradyrhizobium sp. BTAi1]
 gi|146405548|gb|ABQ34054.1| hypothetical protein BBta_1851 [Bradyrhizobium sp. BTAi1]
          Length = 546

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 77/544 (14%), Positives = 163/544 (29%), Gaps = 47/544 (8%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E R  +YE AR ++  +L S++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDPNAPGESRRALYERARAALIAQLRSVQPPLSESEITRERLSLEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPK-----SSVTSKENIFLEPRLRSISSILRSNKHKK 114
           A+ +VE +  +    +++              +     +    P  +      ++     
Sbjct: 61  AVRKVEAEAAQRAREAQRASSGAARPGDALRRAGARNPDGPAAPVAQPGPGPDQAPSPAP 120

Query: 115 LANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
                +V   SR +                            +           ++    
Sbjct: 121 RPRPAAVPPMSRDDRPPLGSEPPDARPARAPRPDLPPAAAAPTAPLRPQPPQAAAQDAPP 180

Query: 175 KLAGIFSFPTGSIFWSVHNYFFNKTRG------------LLSFYSALSEHHLFKYFVFLI 222
                 +        S         RG              +  +  +    +       
Sbjct: 181 PPVRERTAAPRRGPDSNGPAATPAMRGFRDITADVDDLGKATAQANRAARKTYANVPATE 240

Query: 223 ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
           +           + +   S    ++               +G   +  ++    GS    
Sbjct: 241 LDRLDGDDDRPPLPEPPYSYDESVQEAERYALPATSARQRAGAEREGKKKSERSGSTFPF 300

Query: 283 GPSTIPV------------------------ADFANTSNIAFKNYIGGDENSTFVLGKKE 318
             +                               +                 T  +G+  
Sbjct: 301 KAAIGAGIVLILIGAGILWGRPLVSAVTNLFKSSSTVEVPKDNGAPLTKPKITDRVGQAP 360

Query: 319 IEEGNPLIGEGRVFINKGRGQSSILS--GKILWSLQQ--EKSQGLKGLVIKGDIPMIDNA 374
             +    + +  V  ++  G        G ++W  +Q          + ++ DI + D  
Sbjct: 361 SSDQIAPVAQRVVLYDEDPGDPKGKQYIGSVVWRTEQIKATGTQKADIAVRADIEIPDRK 420

Query: 375 FSASMTLKCNADISLSITHVMEIMFSFP-KESQDAVVDLRRISMRKTDNSPSVLIDSNIF 433
           F  +M+ + N D SL  +H  E+ F  P   S   V ++  I M+  + S    +     
Sbjct: 421 FKMTMSFRRNTDTSLPASHTAELTFILPQDFSGGGVGNVPGILMKSNEQSRGTPLAGLAV 480

Query: 434 VISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSA 493
            ++   +L+ L   + D  RN ++L+E  + D+P+ Y + ++ +  I+KG  G   F  A
Sbjct: 481 KVTDGFFLVGLSNVDADRTRNVQLLKERSWFDVPLVYTNQRRAIIAIEKGAPGERAFNDA 540

Query: 494 IMQW 497
              W
Sbjct: 541 FTLW 544


>gi|209886266|ref|YP_002290123.1| hypothetical protein OCAR_7154 [Oligotropha carboxidovorans OM5]
 gi|209874462|gb|ACI94258.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 515

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 86/513 (16%), Positives = 162/513 (31%), Gaps = 16/513 (3%)

Query: 1   MVDFILVIQRAVDNL-PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RAV  L P  T E R  +YE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAVAGLDPNATGESRRALYERARTALIAQLRGVQPPLTEAEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +    +       E                   +   S+   +          
Sbjct: 61  AVRKVEAEAAHRMRGDNHRPEGPRGPRPEGPGREGPRRGDILRDSARAAAGARAAQPGPH 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS--VSPVAAIEHDKSRLRRGKLA 177
                +R   +                S       +    +               G   
Sbjct: 121 GGPHGARPTVSRGDTPPPPYEDRDRPPSRPPGPPREGRDILPGGHLPPGPGRPPHPGVGT 180

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM----AIGVSY 233
             F                       +F    S    F+     +   G     A   S+
Sbjct: 181 RGFRDVVADTDELGRAASQATRSARKTFAKVASPTPEFERTEPDMEERGAYPAYAEDESF 240

Query: 234 SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPV---- 289
                +       RR++L G  V       GI       +L  G  +        +    
Sbjct: 241 DELSPQEPAGAKGRRDALAGDKVRGGFPLKGIMIAGLALILIGGGILGFQKYGASLKAMF 300

Query: 290 ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS--GKI 347
                ++     N  G     T  +G+ +  +    + +  +   +           G +
Sbjct: 301 GSAQQSAKQTGTNNTGVQPKITDRVGQPDAGQQVAPVAQRAILYEEDPSDPQGKQTVGTV 360

Query: 348 LWSL--QQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSI-THVMEIMFSFPKE 404
           +W L       +      IK D+ + D     ++T+  N D ++   +H MEI+F    +
Sbjct: 361 VWRLDQVAPSPKQKPDTAIKADVELPDRKVKVALTIMRNTDPTMPATSHTMEIVFVVGPD 420

Query: 405 SQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFI 464
               + ++  +  +  D      + +    +    +LI L   + D  RN ++L+E   +
Sbjct: 421 FGTTIANVPGVYAKSPDQPRGTPLAATSVKVQDGYFLIGLSNVDVDRARNIQVLKERSSL 480

Query: 465 DIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           DIPI Y +G++ + +I+KG  G   F  A   W
Sbjct: 481 DIPIVYGNGKRAILSIEKGSPGDRAFNEAFSAW 513


>gi|299134306|ref|ZP_07027499.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298591053|gb|EFI51255.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 513

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 83/513 (16%), Positives = 168/513 (32%), Gaps = 18/513 (3%)

Query: 1   MVDFILVIQRAVDNL-PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RAV  L P  + E R  +YE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAVAGLDPNASGESRRALYERARTALIAQLRGVQPPLTEAEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +    +       E    +     +E       LR  +      +  +    +
Sbjct: 61  AVRKVEAEAAHRMRGESHRSEPPRGRPEAPPREGPRRGDILRDSARAATGARAAQPGAPM 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
           +    SR +     ++ S           ++      + +     +      + G     
Sbjct: 121 ARPTVSRNDAPPPFEDRSRVPGRPRGPEPDSFSGQPHAPAGQG--QGRPPHPQGGVGTRG 178

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
           F                       +F +  S    F      +   G   G        +
Sbjct: 179 FRDVVADTDELGRAASQANRSARKTFANVSSPTPEFDRSEPDMEQRGAYSGYPDDESYEE 238

Query: 240 GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
            +       +   G +   + + SG   K           +  G         +  S   
Sbjct: 239 LTGHEPAPAKVRRGYDSGPEKMRSGFPLKGVLFAGLALILIGGGILGYQKYGASMKSMFK 298

Query: 300 FKNYIGGD----------ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS--GKI 347
                                T  +G+ +  +    + +  +   +           G +
Sbjct: 299 SSPRTAIQNGAGSDTGVRPKITDRVGQSDSNQQVAQVAQRAILYEEDSSDPQGKQTVGTV 358

Query: 348 LWSL--QQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSI-THVMEIMFSFPKE 404
           +W L       +      IK D+ + D     ++T+  N D S+   +H MEI+F+   +
Sbjct: 359 VWRLDQVAASPKQKPDTAIKADVELPDRKMKVALTIMRNTDPSMPATSHTMEIVFTVGPD 418

Query: 405 SQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFI 464
               + ++  +  +  D      + +    +    +LI L   + D  RN ++L+E   +
Sbjct: 419 FGTTIANVPGVYAKSPDQPRGTPLAATSVKVQDGYFLIGLSNVDVDRARNIQVLKERSSL 478

Query: 465 DIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           DIPI Y +G++ + +I+KG  G   F  A   W
Sbjct: 479 DIPIVYGNGKRAILSIEKGSPGERTFNEAFSAW 511


>gi|92116702|ref|YP_576431.1| hypothetical protein Nham_1124 [Nitrobacter hamburgensis X14]
 gi|91799596|gb|ABE61971.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 518

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 92/519 (17%), Positives = 178/519 (34%), Gaps = 25/519 (4%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E+R  +YE AR ++  +L S++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDANAPGEQRRALYERARTALIAQLRSVEPPLSESEITRERLSLEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + +   S    +   S        + +  ++    +   +     
Sbjct: 61  AVRKVESEAAQRARDASRGSGSRSGDAFRASTRAAM---KSQDATAPSPPHLRPRANATP 117

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
             +          P   S R         +                + +S          
Sbjct: 118 QPRNPRADQPPAPPPPSSWRPPAPPIPVQDAPPPPRERQGQSQPRRNPESDRPPPPPVPG 177

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY---SIG 236
           F   T                   ++ +  S    F      +   G   G      S G
Sbjct: 178 FRDVTADADDLGRAAAQANRSARRTYANVPSPSPEFDRLEPSLEDRGAFEGAYPYDQSSG 237

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE-------DGSEVDVGPSTIPV 289
           ++       L R     G    K VF G      +  +         G+ +  GP  +  
Sbjct: 238 EAANDQPPPLPRSWPQPGRDKPKRVFGGGFGFPFKSAIAVGLVLILAGAGIVWGPKAVST 297

Query: 290 ------ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                 +    TS I      G     T  +G+    E    + +  V  ++        
Sbjct: 298 VRGLFSSSPDQTSEIPKPATPGPRPKITDRVGQPPSSETVAPVAQRVVLYDEDPSDPKGK 357

Query: 344 S--GKILWSLQQEKSQGL--KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMF 399
              G ++W  ++ K        + ++ DI + +  F  +M+ + N D SL  +H  E+ F
Sbjct: 358 QYVGSVVWRTEEVKGVAGKTPEIAVRADIDIPERQFKMTMSFRRNTDTSLPASHTAELTF 417

Query: 400 SFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKIL 458
             P++     V ++  I M+  + +    +      ++   +L+ L   E D  RN ++L
Sbjct: 418 VLPQDFEGGGVSNVPGILMKSNEQARGTPLAGLAVKVTDGFFLVGLSNVEADRSRNLQLL 477

Query: 459 EEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           +E  + D+P+ Y + ++ +  I+KG  G   F  A   W
Sbjct: 478 KERSWFDVPLVYTNQRRAIIAIEKGAPGERAFNEAFTAW 516


>gi|319405170|emb|CBI78775.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 474

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 93/506 (18%), Positives = 195/506 (38%), Gaps = 38/506 (7%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M+DF+ +++  ++   E TP+ R  +YE A   +  ++ ++K  L K  +E Q   L+ A
Sbjct: 1   MIDFVGILKNTINAQKEITPKLREQVYERATKILEHKIVNIK--LSKAAIEEQRRALQSA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I  VE++                     + ++N          + +      K+    ++
Sbjct: 59  ITTVEEEYLAVEKEQLSSIMGWNCTEKTSDEKNAQS-SLASLENDVAVLAIEKQHQLSIT 117

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
               +     +S  +       +   + N  HE  S++    +         +   + I 
Sbjct: 118 SLVDNEIVDEVSVISDMPDAELVNVDAFNNAHEEGSNIEKDMSKNVPLVSPSQVDNSHIV 177

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           S                 ++ L     +  +  +    +    ++ +   + +  G+   
Sbjct: 178 SHI--------------FSQALRRANRSTLQKRILVSIISFFSIIILFSSIFFISGRIFI 223

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           S    L+ ++    N  +K   +    K+T+RLLEDGSEVDVGP+       +  ++   
Sbjct: 224 SDNQNLQEKNTQISNTAQKATQTN--RKLTQRLLEDGSEVDVGPAEKSEFPSSEGTSTVI 281

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL- 359
              +     +           G  ++ +     +         +G   WSL  E S    
Sbjct: 282 ATNLKSFGQA-----------GEAVLYQMPTKHD----TGKAATGSASWSLITEDSVKGL 326

Query: 360 -KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQDAVVDLRRISM 417
              L I+GDI + D   S  +TL+ N D SL   ++++++F      S  A+ D++ ++ 
Sbjct: 327 QGELAIRGDIIIPDEGLSLRLTLRRNTDESLHAAYIIDLIFITSDKFSGQAINDIKSLTF 386

Query: 418 RKTDNSPSVLIDS-NIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKI 476
           ++++ S    +       I  + ++ +L GS     RN +++ +  ++ + I+ ++G+  
Sbjct: 387 KESETSIGQTLVGTVTAKIDNDFFVFALIGSHPFLDRNLQLIRDLDWLRLVISDKNGRMY 446

Query: 477 LFTIDKGKKGADIFKSAIMQWENRSN 502
             T  KG  G  IF   I QW  + N
Sbjct: 447 ELTFTKGPAGQTIFNEIIGQWLMKKN 472


>gi|154243994|ref|YP_001414952.1| hypothetical protein Xaut_0036 [Xanthobacter autotrophicus Py2]
 gi|154158079|gb|ABS65295.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 460

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 76/500 (15%), Positives = 159/500 (31%), Gaps = 63/500 (12%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+ +LP+ T E R  +Y+ AR ++ R+L  + P LP+  + R+   LE+A
Sbjct: 1   MADYYPLLVRAISSLPQKTGEGRRAVYDRARTALMRQLRGVDPPLPEGEITRERMSLEEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE    +  +++                          ++     +    +     +
Sbjct: 61  IRRVEADYAQQDNSAD-------------------------TVEDEAEAAPEDREEAEPT 95

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +   +   +P      LR   +           S          + R    +     
Sbjct: 96  AAPEPPAHAPAAPPTARDLLRPPPAAPAEPHAPAPESNGRAERRLPPRQRSEEEEDDAEA 155

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                               G     +        K+ ++L + L +  G+++++     
Sbjct: 156 DSRPPVRGRGEVRSRVAAANGARHSTNGEGGPSWKKFALWLALALLVLGGIAFAVVNR-- 213

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                    S +          S  +PKI+ R++    +                +    
Sbjct: 214 ---DMFLGGSSEQRAAAPAASGSSDQPKISDRVVRASGDAARRAPAAAPRAGGGPARAVL 270

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILW--SLQQEKSQG 358
                G                                Q  +  G ++W           
Sbjct: 271 LEETPG------------------------------GAQPQVFEGTVVWKTETVNAGPGL 300

Query: 359 LKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ-DAVVDLRRISM 417
              + ++GD+ + +   + S  L+ N D +L  +H +EI F  P +     V ++  + M
Sbjct: 301 PPDIGLRGDVVIPERKINMSFVLRRNTDQTLPASHTIEIGFKLPDDFPFGGVSNVDAVRM 360

Query: 418 RKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKIL 477
           +    +    +      ++   +L+ L     D  RN  +L+ Y ++D  ITY + +K +
Sbjct: 361 KPNQQALGTPLAGLAVRVNPTLFLVGLSEKPADRQRNVTLLQAYPWLDTLITYTNNKKAV 420

Query: 478 FTIDKGKKGADIFKSAIMQW 497
              +KG  G   F  A   W
Sbjct: 421 LAFEKGPAGEQAFNDAFSAW 440


>gi|146342760|ref|YP_001207808.1| hypothetical protein BRADO5934 [Bradyrhizobium sp. ORS278]
 gi|146195566|emb|CAL79593.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 546

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 77/544 (14%), Positives = 170/544 (31%), Gaps = 47/544 (8%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  N P E R  +YE AR ++  +L S++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDPNAPGESRRALYERARAALIAQLRSVQPPLSESEITRERLSLEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPK---------------SSVTSKENIFLEPRLRSIS 104
           A+ +VE +  +    +++                       ++  ++     EP    + 
Sbjct: 61  AVRKVEAEAAQRAREAQRASSGAARPGDALRRAGARNPEAPAAPAAEPGATPEPATAPVP 120

Query: 105 SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
               +       +   +  +   +  + P             +        + +S V  +
Sbjct: 121 RPRPAPAPAARNDRPPLGPEPADSKPVRPVRPEAPPPAAAPTTPLRPQPTPAGISDVPPV 180

Query: 165 EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
               +  RR   A   +  T S+             G  +  +  +    +       + 
Sbjct: 181 RERPAAPRRAPDANGSAAATPSMRGFRDITADVDDLGKATAQANRAARKTYANVPATDLD 240

Query: 225 LGMAIGVSYSIGKSKG-SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                     +      S    ++                    +  ++  E        
Sbjct: 241 RLEDDDDRPPLPAEPAYSYDESVQEAERYAVPATASARSRAGGEREAKKKSERSGSTFPF 300

Query: 284 PSTIPVA-------------------------DFANTSNIAFKNYIGGDENSTFVLGKKE 318
            + I                              +                 T  +G+  
Sbjct: 301 KAAIAAGIVLILVGAGILWGRPLVGAVSGLFKSNSTVEAPKDTAAPLSKPKITDRVGQSP 360

Query: 319 IEEGNPLIGEGRVFINKGRGQSSILS--GKILWSLQQ--EKSQGLKGLVIKGDIPMIDNA 374
             +    + +  V  ++           G ++W  +Q          + ++ DI + D  
Sbjct: 361 SSDQIAPVAQKVVLYDEDPADPKGKQYLGSVVWRTEQIKATGTQKADIAVRADIEIPDRK 420

Query: 375 FSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIF 433
           F  +M+ + N D SL  +H  E+ F  P+      V ++  I M+  + +    +     
Sbjct: 421 FKMTMSFRRNTDTSLPASHTAELTFILPQNFDGGGVGNVPGILMKSNEQARGTPLAGLAV 480

Query: 434 VISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSA 493
            ++   +L+ L   + D  RN ++L+E  + D+P+ Y + ++ +  I+KG  G   F  A
Sbjct: 481 KVTDGFFLVGLSNVDADRTRNVQLLKERSWFDVPLVYSNQRRAIIAIEKGAPGERAFNDA 540

Query: 494 IMQW 497
              W
Sbjct: 541 FAVW 544


>gi|319781042|ref|YP_004140518.1| hypothetical protein Mesci_1308 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166930|gb|ADV10468.1| hypothetical protein Mesci_1308 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 552

 Score =  229 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/554 (16%), Positives = 173/554 (31%), Gaps = 57/554 (10%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ +++ A+D   + TPE+R+ IY   R  +A++L    P    E +  Q   LE A
Sbjct: 1   MADFVAILKNALDKHGDETPEKRTRIYASVRTMLAKKLGERSPPWAPEAIATQMRSLEDA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I  VE+   KS+  +    E +   SS+   +N     R  + +                
Sbjct: 61  ITSVERDYAKSVPETDPLAELEHIFSSIDRNKNQPSHTRQPAKAESAWPAPPVAKPEPYQ 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                      S +  +    +                +  A  E D           + 
Sbjct: 121 PAPPPAAKVEPSWQRSTPAPAQPARADTPL----PGMNAEEADDEADVFSSNEDNEEPVQ 176

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                         +      +++        +           +    G   +  +   
Sbjct: 177 DTFQRLRPAERKRSYGGLIAAVVALLVVAGGGYGIWLNKDAFGKMLGLGGNQVAKTEPVK 236

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                   ++                 K T+RL   G EVD GP+          S  A 
Sbjct: 237 PAPAKPATDAAAAPPAPAAGGTEAESTKFTQRLTPQGGEVDPGPAGGQSGIGEGESVAAL 296

Query: 301 KNYIGGDENSTFVLGKKEIEEGNP------------------------------------ 324
                                                                       
Sbjct: 297 TTPPSATNAPAISAPAAGTPAATTPPATDAAPATPPANGAAPAAPAGAAGTPPAPAGAAP 356

Query: 325 ------------LIGEGRVFINKGRG--QSSILSGKILWSLQQEKSQG--LKGLVIKGDI 368
                        +G+  +F  +     Q S   G I+WSL QE   G       I+ + 
Sbjct: 357 PAPAAAPAEAALPVGQKAIFYEERTSTAQGSAEPGNIVWSLVQESPGGDLPPEPAIRAEA 416

Query: 369 PMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVL 427
            +        MT++ N D +L  +H++E++F  P       V ++ R++M+ ++      
Sbjct: 417 TIPGKDIQLRMTIRRNTDQTLPASHIIEMIFLTPDGFEGGGVDNILRVAMKASEQDAGSP 476

Query: 428 IDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGA 487
           +      I+   +L++L  ++ D   N  +L    +ID+P+ Y++G++ L T++KG  G 
Sbjct: 477 LIGIPAKIADGFFLVALNDTKADEDANMTLLRGQDWIDVPVVYKTGRRALLTMEKGIPGE 536

Query: 488 DIFKSAIMQWENRS 501
            +F  AI  W+ ++
Sbjct: 537 KVFDEAIKAWQAKT 550


>gi|316935810|ref|YP_004110792.1| hypothetical protein Rpdx1_4509 [Rhodopseudomonas palustris DX-1]
 gi|315603524|gb|ADU46059.1| hypothetical protein Rpdx1_4509 [Rhodopseudomonas palustris DX-1]
          Length = 534

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 81/532 (15%), Positives = 172/532 (32%), Gaps = 35/532 (6%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+ +L  + P E+R  IYE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISSLDPSAPGEQRRAIYERARAALIAQLRGVQPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS--ISSILRSNKHKKLAN 117
           A+ +VE +  +    + + +     +     +    L    R            ++  A 
Sbjct: 61  AVRKVESEAAQRARDAARAELKGRGRPGDAPRPGDALRASSRPLGRPGDPPPQVNRGAAP 120

Query: 118 ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI-EHDKSRLRRGKL 176
               + +  ++      +      E      +     D    P               + 
Sbjct: 121 NSMPEPELPSSVRPRAPDDEPISEEPAEQRPSRTLRVDPPPIPPEPPLSGRAPATPPRRG 180

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                 P  +    +  +            +A   +   +     +        +  ++ 
Sbjct: 181 VPPNQPPPPANSPGLRGFRDVTADLDGLGNAAAQANRAARKTYANVAPSPEFDRLEPTME 240

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE--------------------- 275
                   +   ES+D              P   +R                        
Sbjct: 241 NRSDPDAPYAYDESIDEAARYAPPPAGMRPPAEPKRKPPRAPWKFPLRSALVIGVVVMLI 300

Query: 276 -DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK---KEIEEGNPLIGEGRV 331
             G     G  +  ++   + S                 +     +   E    + +  V
Sbjct: 301 GAGLVWGPGVVSSLMSLMRSPSTQTAAPATPAPSTERPKITDRVGQPSTEQAAPVAQRVV 360

Query: 332 FINKGRGQSSILS--GKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNAD 386
             ++           G ++W  +Q     ++G   + ++ DI + +  F  +M+ + N D
Sbjct: 361 LYDEDPNDPKGKQYVGSVVWKTEQVKGASAKGGGDIAVRADIEVPERQFKMTMSFRRNTD 420

Query: 387 ISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLK 445
            SL  +H  E+ F  P +     V ++  I M+  + S    +      ++   +L+ L 
Sbjct: 421 TSLPASHTAELTFILPADFQGGGVSNVPGILMKSNEQSRGTPLAGLAVKVTDGFFLVGLS 480

Query: 446 GSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             E D  RN ++L+E  + D+PI Y +G++ +  I+KG  G   F  A   W
Sbjct: 481 NVEADRSRNLQLLKERSWFDVPIVYGNGRRAIIAIEKGGPGERAFNDAFKAW 532


>gi|218508086|ref|ZP_03505964.1| hypothetical protein RetlB5_11022 [Rhizobium etli Brasil 5]
          Length = 182

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 54/177 (30%), Positives = 97/177 (54%), Gaps = 4/177 (2%)

Query: 330 RVFINKGRGQ--SSILSGKILWSLQQEKSQGL-KGLVIKGDIPMIDNAFSASMTLKCNAD 386
                +  GQ   + + G ++WS+Q E  QG  +   ++G+I + +   SA +T K N+D
Sbjct: 1   MFLYEERIGQSSPTAIEGSVVWSVQHEAGQGGRQEATVQGNITVPERNLSALVTFKRNSD 60

Query: 387 ISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLK 445
            SL  +H++EI+FS P      ++  ++RISM++T+      + +    I+ + ++I+L 
Sbjct: 61  PSLPASHLVEIVFSVPPNFEGGSIDSVQRISMKRTEQDRGDALIAVPAKITDDFHMIALN 120

Query: 446 GSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
              +    N  ++    +IDIPITYR+G++ L T+DKG  G D F +AI +W    +
Sbjct: 121 DYPDARKANLDLMSTRNWIDIPITYRNGRRALLTMDKGGTGTDAFNTAIKEWTALGD 177


>gi|90425560|ref|YP_533930.1| hypothetical protein RPC_4085 [Rhodopseudomonas palustris BisB18]
 gi|90107574|gb|ABD89611.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 553

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 73/551 (13%), Positives = 158/551 (28%), Gaps = 54/551 (9%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  + P E R  +YE AR+++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAIAGLDPSAPGESRRALYERARSALIAQLRGVQPPLSESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDI------------------------------------ 83
           A+ +VE +  +      +  +                                       
Sbjct: 61  AVRKVESEAAQRARDVTRSADQKARNRSAEASRAGDSLRAGSRPAAKPGDGRPGEIRPGE 120

Query: 84  --PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLR 141
             P      +             +   S              +                +
Sbjct: 121 IRPGEIRPGEPEPEAGDAAPQDGAPRPSAPPLSTRGERPPLREEPPLPRNLRVELPRPGQ 180

Query: 142 EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRG 201
                 ++               +  +           F   T  +            + 
Sbjct: 181 PSPFADLDDPQASRDRPPQPPRRQEPERPPSASTGMRGFRDVTADVDDLGRAAAQANRQA 240

Query: 202 LLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNV 261
             ++ +  S    F      +   G              +  +     S          +
Sbjct: 241 RKTYANVTSPSPEFDRLEPSMENRGDPEPPYSYDESPDEAARYQSSVRSRPEPKQKPNRL 300

Query: 262 FSGIRPKITR----------RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
             G  P  +                            ++          ++         
Sbjct: 301 AGGGFPIKSALAIGVVLVLVGAAMLWGPSAWSSLRAMLSAEPAVVEAPKESAPTSRPKIA 360

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS--GKILWSLQQEKSQGLKG--LVIKGD 367
             +G+    +    + +  V  ++           G ++W  +Q K  G K   + ++ D
Sbjct: 361 DRVGQPSSMDQVAPVAQRVVLYDEDPADPKGKQYVGTVVWRTEQIKGSGGKPGDIAVRAD 420

Query: 368 IPMIDNAFSASMTLKCNADISLSITHVMEIMFSFP-KESQDAVVDLRRISMRKTDNSPSV 426
           + + +  F  +M+ + N D SL  +H  E+ F  P   S   V ++  I M+  + +   
Sbjct: 421 VEIAERKFKMTMSFRRNTDASLPASHTAELTFVLPADFSGGGVSNVPGILMKSNEQARGT 480

Query: 427 LIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKG 486
            +      ++   +L+ L   + D  RN ++L+E  + DIP+ Y + ++ +  I+KG  G
Sbjct: 481 PLAGLAVKVTDGFFLVGLSNVDADRARNLQLLKERSWFDIPLVYSNQRRAIIAIEKGSPG 540

Query: 487 ADIFKSAIMQW 497
              F  A   W
Sbjct: 541 ERAFSDAFTSW 551


>gi|86748456|ref|YP_484952.1| hypothetical protein RPB_1331 [Rhodopseudomonas palustris HaA2]
 gi|86571484|gb|ABD06041.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 540

 Score =  226 bits (574), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 84/538 (15%), Positives = 170/538 (31%), Gaps = 41/538 (7%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  + P E+R  IYE AR+++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISGLDPSAPGEQRRAIYERARSALITQLRGVQPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + + +  +   +   ++    L    R              A + 
Sbjct: 61  AVRKVESEAAQRSRDAARAELKNRRPAGDPARPGDSLRASSRPAPRPGDPPPQVSRAPLP 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
               ++                         Q        P+        R R       
Sbjct: 121 PTAAQADAEPPPIRPRSQPPAPPAPPRDERAQRNLRVEPPPIPPEPPLPGRERPAPRRPD 180

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSF--YSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                     +     F      L+    +A   +   +     +        +  S+  
Sbjct: 181 QGPAANQGADNAGLRGFRDVTADLADLGQAAAQANRSARKTYANVAPSTEFDRLEPSMEN 240

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP------------- 284
                  +   ES+D     +    +        R                         
Sbjct: 241 RTDPDAPYSYDESVDEAARYQPPPAAARTRVEPDRKGPPRKPTRPPSRFPLKSALVIGLV 300

Query: 285 -------------------STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
                              + +  A    T+  +           T  +G+    E    
Sbjct: 301 LVLAGAGILWGPSLYTSLRAMMSSAPSTETATPSAPPSSTERPKITDRVGQPSSSEAIAP 360

Query: 326 IGEGRVFINKGRGQSSILS--GKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASMT 380
           + +  V  ++           G ++W  +Q     ++G   L ++ DI + +  F  +M+
Sbjct: 361 VAQRVVLYDEDPSDPKGKQYVGTVVWRTEQIKGASAKGGADLAVRADIEVPERKFKMTMS 420

Query: 381 LKCNADISLSITHVMEIMFSFP-KESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNS 439
            + N D SL  +H  E+ F  P   S   V ++  I M+  + +    +      ++   
Sbjct: 421 FRRNTDTSLPASHTAELTFILPQDFSGGGVSNVPGILMKSNEQARGTPLAGLAVKVTDGF 480

Query: 440 YLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           +L+ L   E D  RN ++L+E  + D+PI Y + ++ +  I+KG  G   F  A   W
Sbjct: 481 FLVGLSNVEADRARNLQLLKERSWFDVPIVYTNQRRAIIAIEKGPPGERAFGEAFAAW 538


>gi|192293134|ref|YP_001993739.1| hypothetical protein Rpal_4773 [Rhodopseudomonas palustris TIE-1]
 gi|192286883|gb|ACF03264.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 534

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 82/532 (15%), Positives = 171/532 (32%), Gaps = 35/532 (6%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+ +L  + P E+R  IYE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISSLDPSAPGEQRRAIYERARAALIAQLRGVQPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS---ISSILRSNKHKKLA 116
           A+ +VE +  +    + + +     +     +    L    R                  
Sbjct: 61  AVRKVESEAAQRARDASRAELKGRGRPGDPPRPGDALRASSRPLGRPGDPPPQVNRGAPP 120

Query: 117 NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
           N +       +    +P++         S    T       + P   +          + 
Sbjct: 121 NSMPEPELPSSVRPRNPEDPVAAEDTDESRPSRTLRVDPPPIPPEPPLPGRGPAAPPRRG 180

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                 P  +    +  +            +A   +   +     +        +  ++ 
Sbjct: 181 PLPNQPPPAANSPGLRGFRDVTADLDDLGRAAAQANRSARKTYANVAPSPEFDRLEPTME 240

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKIT----------------------RRLL 274
                   +   ES D          +                               L+
Sbjct: 241 NRSDPEAPYSYDESPDEAARYTPPPAAPRAQAEPKLKGSRKPSKFPLRTALVIGVVAMLI 300

Query: 275 EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK---KEIEEGNPLIGEGRV 331
             G     G  +  ++   + S                 +     +   E    + +  V
Sbjct: 301 GAGLVWGPGMVSSLMSMMRSPSTQTAAPATPAPSTERPKITDRVGQPSTEQAAPVAQRVV 360

Query: 332 FINKGRGQSSILS--GKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNAD 386
             ++           G ++W  +Q     ++G   + ++ DI + + AF  +M+ + N D
Sbjct: 361 LYDEDPNDPKGKQYVGTVVWKTEQVKGASAKGGADIAVRADIEVPERAFKMTMSFRRNTD 420

Query: 387 ISLSITHVMEIMFSFP-KESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLK 445
            SL  +H  E+ F  P       V ++  I M+  + S    +      ++   +L+ L 
Sbjct: 421 TSLPASHTAELTFILPADFPGGGVSNVPGILMKSNEQSRGTPLAGLAVKVTDGFFLVGLS 480

Query: 446 GSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             E D  RN ++L+E  + D+PI Y +G++ +  I+KG  G   F  A   W
Sbjct: 481 NVEADRARNLQLLKERSWFDVPIVYSNGRRAIIAIEKGGPGERAFNDAFKAW 532


>gi|39937354|ref|NP_949630.1| hypothetical protein RPA4294 [Rhodopseudomonas palustris CGA009]
 gi|39651212|emb|CAE29735.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 533

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 82/531 (15%), Positives = 171/531 (32%), Gaps = 34/531 (6%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+ +L  + P E+R  IYE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISSLDPSAPGEQRRAIYERARAALIAQLRGVQPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS---ISSILRSNKHKKLA 116
           A+ +VE +  +    + + +     +     +    L    R                  
Sbjct: 61  AVRKVESEAAQRARDASRAELKGRGRPGDPPRPGDALRASSRPLGRPGDPPPQVNRGAPP 120

Query: 117 NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
           N +       +    +P++         S    T       + P   +          + 
Sbjct: 121 NSMPEPELPSSVRPRNPEDPVAAEDTDESRPSRTLRVDPPPIPPEPPLPGRGPAAPPRRG 180

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                 P  +    +  +            +A   +   +     +        +  ++ 
Sbjct: 181 PLPNQPPPPANSPGLRGFRDVTADLDDLGRAAAQANRSARKTYANVAPSPEFDRLEPTME 240

Query: 237 KSKGSITHFLRRESLDGGN--VDKKNVFSGIRPKITRRLLEDGSE--------------- 279
                   +   ES D            +   PK+                         
Sbjct: 241 NRSDPEAPYSYDESPDEAARYTPPAAPRAQAEPKLKGSRKPSKFPLRTALVIGVVAMLIG 300

Query: 280 ----VDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK---KEIEEGNPLIGEGRVF 332
                  G  +  ++   + S                 +     +   E    + +  V 
Sbjct: 301 AGLVWGPGMVSSLMSMMRSPSTQTAAPATPAPSTERPKITDRVGQPSTEQAAPVAQRVVL 360

Query: 333 INKGRGQSSILS--GKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADI 387
            ++           G ++W  +Q     ++G   + ++ DI + + AF  +M+ + N D 
Sbjct: 361 YDEDPNDPKGKQYVGTVVWKTEQVKGASAKGGADIAVRADIEVPERAFKMTMSFRRNTDT 420

Query: 388 SLSITHVMEIMFSFP-KESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKG 446
           SL  +H  E+ F  P       V ++  I M+  + S    +      ++   +L+ L  
Sbjct: 421 SLPASHTAELTFILPADFPGGGVSNVPGILMKSNEQSRGTPLAGLAVKVTDGFFLVGLSN 480

Query: 447 SEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
            E D  RN ++L+E  + D+PI Y +G++ +  I+KG  G   F  A   W
Sbjct: 481 VEADRARNLQLLKERSWFDVPIVYSNGRRAIIAIEKGGPGERAFNDAFKAW 531


>gi|17986635|ref|NP_539269.1| transcriptional regulator [Brucella melitensis bv. 1 str. 16M]
 gi|17982250|gb|AAL51533.1| hypothetical transcription regulator [Brucella melitensis bv. 1
           str. 16M]
          Length = 177

 Score =  224 bits (569), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 89/175 (50%), Gaps = 5/175 (2%)

Query: 327 GEGRVFINKGRGQ--SSILSGKILWSLQQEKSQGLKG--LVIKGDIPMIDNAFSASMTLK 382
           G+  +   +  G    S+  G ++WS+ +E  +  +     I+ ++ + ++     MT++
Sbjct: 2   GQQALLYEERGGTETGSVERGNVVWSVIEESREDGQPAQPAIRANVTIPNSKVELKMTIR 61

Query: 383 CNADISLSITHVMEIMFSFPKESQDA-VVDLRRISMRKTDNSPSVLIDSNIFVISKNSYL 441
            N D S+  +H++E++F+ P+      + +++RI+ + T+ +    + +    I+ N ++
Sbjct: 62  KNTDQSIPASHLIEMVFTVPEGFPGGAIDNVQRITFKDTEQAAGNPLIAVPSKIADNFFI 121

Query: 442 ISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQ 496
           I L  +      N  ++   ++IDIPI YR+G++ L +++KG  G   F   +  
Sbjct: 122 IWLNDARTAQDTNLSLMRRLQWIDIPIAYRNGRRALISLEKGVPGEKAFNDVLGA 176


>gi|319408109|emb|CBI81762.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 481

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 95/515 (18%), Positives = 195/515 (37%), Gaps = 55/515 (10%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ- 59
           MVDFI ++++ +D     TP+ R  IY+ A   +  +   ++ ++PK++ + Q   L+  
Sbjct: 1   MVDFIGILKKKIDAQNNITPQLRERIYKQAFEILEHKF--LEIKMPKKVADAQRQALQSA 58

Query: 60  --AILQ----VEKQNQKSLHTSKQDKES---DIPKSSVTSKENIFLEPRLRSISSILRSN 110
             AI +     EK+   S+       +    +  + S+ S+                  +
Sbjct: 59  IVAIEEEYLTAEKELLSSVMGWDLTGKDNNNENVQKSILSQSGDTAAVVTEEKKQQPPVS 118

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
           + K      ++  +S+ +        +           N +     +V+      H  S 
Sbjct: 119 RRKSKKTPDNLSIESKMSNTEPTDMNTSLAPCSSKVHSNIKKNTRKNVALQTDTSHVVSH 178

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
           +                            + L     ++ +  +    V  I+ L + IG
Sbjct: 179 IFA--------------------------QALRRANRSIVKKRILIGIVIFIVFLILLIG 212

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
             +       S  + ++  ++   N  +K   +  +  +T+RLLEDGSEVD G       
Sbjct: 213 AFFVGEYMFTSYNNQIQEVNIQASNGLQKEGQANQK--LTQRLLEDGSEVDAGSIERTDK 270

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                S       + G+  +           G  +  +     +       ++ G + WS
Sbjct: 271 KTEFLSEEETSTVVTGNSKT-------IEHPGEAIFYKTHADHDSE----KVVMGNVWWS 319

Query: 351 LQQEKS--QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMF-SFPKESQD 407
           L +E S     + L I+GDI +        +TL+ N D S    ++M+++F +  K S  
Sbjct: 320 LIKEASVKNAPEELAIRGDINIPSEGLLLQLTLRRNVDPSFPTAYIMDLVFMTTDKFSGQ 379

Query: 408 AVVDLRRISMRKTDNSPSVLI-DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDI 466
           A+ D++ ++ + +  S    +  ++I  I  + +L +L  +     +N +I+ E  +I +
Sbjct: 380 AIHDIKELTFKASKQSVGQPLERASIAKIDDDFFLFALSNNHPFLDQNLQIIRELDWIHL 439

Query: 467 PITYRSGQKILFTIDKGKKGADIFKSAIMQWENRS 501
            I+ ++G     T  KG  G  IF   I QW  ++
Sbjct: 440 VISDKNGHMSELTFAKGPTGKAIFNEVIEQWLAQT 474


>gi|170752007|ref|YP_001758267.1| putative CheA signal transduction histidine kinase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170658529|gb|ACB27584.1| putative CheA signal transduction histidine kinase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 496

 Score =  221 bits (562), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 75/510 (14%), Positives = 165/510 (32%), Gaps = 26/510 (5%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ TP  R  +Y+ ARN++  +L S+ P L +  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRTPALRKAVYDRARNALISQLRSLDPPLSEADIDLERRALDAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS--------ISSILRSNKH 112
           I ++E  +      +    ++    +  T+         +          + +       
Sbjct: 61  IERLEVDHGGLPAPANDAAQAPEKPAPATAPAPTPAAAPVVPVPAAPEPIVPTATEPEIP 120

Query: 113 KKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR 172
           +                  +   F+   RE      +   E    ++P        +   
Sbjct: 121 EPSPPEPGPGPMPAPILPPARPPFAVTAREGDRDPEDGPREPPIPIAPPRPGTPPPAAPD 180

Query: 173 RGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
                   S                   G       +      +  V   + +G  + V 
Sbjct: 181 AAPPVAETSATEAPAVEDPDAEAAEGAGGRQRPRIEVVPPRTGRSRVLRNVFVGGVLAVV 240

Query: 233 YSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF 292
             +      +     +     G             K   R+  D +     P+ +  +  
Sbjct: 241 IGLIAVAAFLLRDRPQNLPSSGMEAGDTQQPEGETKFGDRVGGDAAPAPKAPTRVENSAP 300

Query: 293 ANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
              +        G        L ++                    GQ ++  G++ W L+
Sbjct: 301 PRAAATPAPADAGVAVAQRAELVEEATGAQ--------------GGQPTVTPGRVTWRLE 346

Query: 353 QEKSQGLKGL--VIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMF--SFPKESQDA 408
                  + +   +   + + D   +  MT++ N D +L  +H + + F  +    +   
Sbjct: 347 SVNGDQGQPVQNAVIATVTIPDAGLTLVMTIQRNLDATLPASHTVSLAFSQTGSNGASRT 406

Query: 409 VVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPI 468
           V D+  +  +   ++    +      +  N +LI L   + D  RN+ +L    + DI +
Sbjct: 407 VQDVGLLQAKDEQSARGSPVSGLPVRVRDNLFLIGLSSLQNDVERNTDLLLHRNWFDIAL 466

Query: 469 TYRSGQKILFTIDKGKKGADIFKSAIMQWE 498
            Y SG++ + T +KG  GA + ++A   W+
Sbjct: 467 RYTSGRRAVLTFEKGAAGAQVMQNAFDAWQ 496


>gi|13473316|ref|NP_104883.1| hypothetical protein mll3872 [Mesorhizobium loti MAFF303099]
 gi|14024064|dbj|BAB50669.1| mll3872 [Mesorhizobium loti MAFF303099]
          Length = 575

 Score =  220 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 81/573 (14%), Positives = 165/573 (28%), Gaps = 72/573 (12%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++A+D   E TPE R+  Y+ AR+++ ++L    P L  +++ +Q   LE A
Sbjct: 1   MADFVAVLKKALDKYGEPTPETRTRTYDGARSALVKKLAEFSPPLSADVVAKQKRSLEDA 60

Query: 61  ILQVEKQNQKSLHTSKQDKE---------------------------------------- 80
           I  VE +  KS+  +    E                                        
Sbjct: 61  IASVEHEYTKSVPEADPLAELEHIFSSIDRNKNQPSHTRQPVKAEPAWPAPPAAKAEPYR 120

Query: 81  ------SDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
                 +               EP  +  + +           +  +      +      
Sbjct: 121 PAPPPAATPEPYQSVPSPAAKAEPSWQKPTPVQPVAPDLADPALPGMDTDQDDDRADVFP 180

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA----------------- 177
           N               +          A +           +                  
Sbjct: 181 NDEEPAAADTFRLRPAERRRSYGGLIAAVVALLVVAGGGYGIWLNKDAFGKMLGLDGSKV 240

Query: 178 ----GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                                         + ++        +                 
Sbjct: 241 VAKTEPVKPAPAKPATDAPATPAPAAGTEATKFTQRLTPEGGETDPGPAGGQTGVGEGES 300

Query: 234 SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
               +                        +              +       T P A   
Sbjct: 301 VAALTTPPSATNAPANPPPAAAAPAAVPAAAAPAATAPAAGAAPAAPPPANGTTPAAPAN 360

Query: 294 NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG--QSSILSGKILWSL 351
             +  A          +T       +   +  +G+  +F  +     Q S   G I+WSL
Sbjct: 361 AAATPAPAGATPAPAGATPAAPAAPVAAASVPVGQKAIFYEERTSTAQGSAEPGSIVWSL 420

Query: 352 QQEKSQG--LKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDA 408
            QE   G       I+ +  +        MT++ N D +L  +H++E++F  P       
Sbjct: 421 VQESPGGDLPPEPAIRAEATIPGKDIQLRMTIRRNTDQTLPASHIIEMIFLTPDGFEGGG 480

Query: 409 VVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPI 468
           V ++ R++M+ ++      +      I+   +L++L  ++ D   N  +L    +ID+P+
Sbjct: 481 VDNILRVAMKSSEQDAGSPLIGIPAKIADGFFLVALNDTKADEDANMTLLRGQDWIDVPV 540

Query: 469 TYRSGQKILFTIDKGKKGADIFKSAIMQWENRS 501
            Y++G++ L T++KG  G  +F  AI  W+ ++
Sbjct: 541 VYKTGRRALLTMEKGIPGEKVFDEAIKAWQAKT 573


>gi|158426295|ref|YP_001527587.1| hypothetical protein AZC_4671 [Azorhizobium caulinodans ORS 571]
 gi|158333184|dbj|BAF90669.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 450

 Score =  220 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 88/500 (17%), Positives = 168/500 (33%), Gaps = 62/500 (12%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+  LP+NT E R  +Y+ AR ++ ++L S+ P LP+  + R+   LE+A
Sbjct: 1   MADYYPLLVRAISGLPQNTAEARKVVYDRARAALLKQLRSVDPPLPEGEIGRERLSLEEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++EK+       +        P       E     P      +               
Sbjct: 61  IRRIEKEYVGDAPEAAPPAPPPSPAPRPPRPEAAPHAPLNPRRPASP------------- 107

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                         +         +           SV          +    G      
Sbjct: 108 --------------DQPPEPVRAGASKPAFVRPAPGSVPEDETTVIRDAEPTGGAEPSGD 153

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +               N+     +  +      +  +    ++LLG   G+  +I K   
Sbjct: 154 APADERRPRVGRATVRNRNGADAAPETGGKGKRIAIFAGISLVLLG---GIGVAIWKHSA 210

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
               F  R              +  +PK T R+ +              A  A       
Sbjct: 211 IAALFGERPQQQAAPSAPPA--TPDQPKSTDRVTQ--------------AGGAARPAQPA 254

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK--SQG 358
           +      + +T      E   GN    +                G + W  +        
Sbjct: 255 QAPRAPGQATTTRALLFEESPGNAQQIQQ-------------FEGTVTWKTETVSGGPGQ 301

Query: 359 LKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ-DAVVDLRRISM 417
              + I+ +I + +   + S TL+ N D +L  +H +EI F+ P +     V ++  + +
Sbjct: 302 PPDIGIRAEIQIPERKINVSFTLRRNLDQTLPASHTIEINFALPPDFPYGGVANVPVVRV 361

Query: 418 RKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKIL 477
           ++T+++    +      +S  S+L+ L  ++ D  RN ++L+   +IDIPI Y + ++ +
Sbjct: 362 KQTESAQGAPLAGLSVKVSSTSFLVGLSAAQVDKERNLQLLQTRPWIDIPIVYTNNKRAI 421

Query: 478 FTIDKGKKGADIFKSAIMQW 497
              DKG  G   F+ A   W
Sbjct: 422 IAFDKGAAGTQAFQDAFSAW 441


>gi|91978356|ref|YP_571015.1| hypothetical protein RPD_3893 [Rhodopseudomonas palustris BisB5]
 gi|91684812|gb|ABE41114.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 541

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 85/539 (15%), Positives = 176/539 (32%), Gaps = 42/539 (7%)

Query: 1   MVDFILVIQRAVDNLPENTP-ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
           M D+  +I RA+  L  + P E+R  IYE AR ++  +L  ++P L +  + R+   LE+
Sbjct: 1   MADYYPLIARAISGLDPSAPGEQRRAIYERARAALIAQLRGVQPPLTESEITRERLALEE 60

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
           A+ +VE +  +    + + +  +   +   ++    L    R+ S           A + 
Sbjct: 61  AVRKVESEAAQRSRDASRAELKNRRPAGEAARPGDALRASSRAPSRPGDPPPQVSRAPLP 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
               ++     + P++ S           N + +                R  +G+ AG 
Sbjct: 121 PGAAQAEPEPPVRPRSQSPAPPREDRPQRNLRVDPPPIPPEPGRERPAPRRPDQGQSAGQ 180

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLS----FYSALSEHHLFKYFVFLIILLGMAIGVSYSI 235
                     +  N                 +A   +   +     +        +  S+
Sbjct: 181 GPGAGQGANPAADNGLRGFRDVTADLDDIGRAAAQANRSARKTYANVAPSPEFDRLEPSM 240

Query: 236 GKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST--------- 286
                    +   ES+D  +       +        R                       
Sbjct: 241 ENRTDPGAPYSYDESIDEASRYAPQPATTRPRIEPDRKASRKPTRKPSRFPLRSALVIGL 300

Query: 287 ----------------------IPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP 324
                                 +       T+              T  +G+    E   
Sbjct: 301 VLVLVGAGILWGPSLWSAMRGLMKSQPSTETATTTAPPASTERPKITDRVGQPSSSEMVA 360

Query: 325 LIGEGRVFINKGRGQSSILS--GKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASM 379
            + +  V  ++           G ++W  +Q     ++G   L ++ DI + +  F  +M
Sbjct: 361 PVAQRVVLYDEDPSDPKGKQYVGTVVWRTEQIKGASAKGGADLAVRADIEVPERKFKMTM 420

Query: 380 TLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKN 438
           + + N D SL  +H  E+ F  P++     V ++  I M+  + +    +      ++  
Sbjct: 421 SFRRNTDTSLPASHTAELTFILPQDFTGGGVANVPGILMKSNEQARGTPLAGLAVKVTDG 480

Query: 439 SYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
            +L+ L   E D  RN ++L+E  + D+PI Y + ++ +  I+KG  G   F  A   W
Sbjct: 481 FFLVGLSNVEADRARNLQLLKERSWFDVPIVYTNQRRAIIAIEKGPPGERAFSEAFGAW 539


>gi|260461444|ref|ZP_05809691.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032514|gb|EEW33778.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 205

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 89/182 (48%), Gaps = 5/182 (2%)

Query: 325 LIGEGRVFINKGRG--QSSILSGKILWSLQQEKSQG--LKGLVIKGDIPMIDNAFSASMT 380
            +G+  +F  +     Q S   G I+WSL QE   G       I+ +  +        MT
Sbjct: 22  PVGQKAIFYEERTSTAQGSAEPGSIVWSLVQESPGGDLPPEPAIRAEATIPGKDIQLRMT 81

Query: 381 LKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNS 439
           ++ N D +L  +H++E++F  P       V ++ R++M+ ++      +      I+   
Sbjct: 82  IRRNTDQTLPASHIIEMIFLTPDGFEGGGVDNILRVAMKSSEQDAGSPLIGIPAKIADGF 141

Query: 440 YLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWEN 499
           +L++L  ++ D   N  +L    +ID+P+ Y++G++ L T++KG  G  +F  AI  W+ 
Sbjct: 142 FLVALNDTKADEDANMTLLRGQDWIDVPVVYKTGRRALLTMEKGIPGEKVFDEAIKAWQA 201

Query: 500 RS 501
           ++
Sbjct: 202 KT 203


>gi|218680390|ref|ZP_03528287.1| hypothetical protein RetlC8_16460 [Rhizobium etli CIAT 894]
          Length = 159

 Score =  203 bits (515), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 84/151 (55%), Gaps = 1/151 (0%)

Query: 353 QEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVD 411
           +    G +   ++G++ + +   SA +T K N+D SL  +H++EI+FS P      ++  
Sbjct: 4   EAGQGGRQEATVQGNVTVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPPNFEGGSIDS 63

Query: 412 LRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYR 471
           ++RISM++T+      + +    I+ + ++I+L    +    N  ++    +IDIP+TYR
Sbjct: 64  VQRISMKRTEQDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRSWIDIPVTYR 123

Query: 472 SGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           +G++ L T++KG  G + F +AI +W    +
Sbjct: 124 NGRRALLTMEKGDTGTEAFNTAIKEWAALGD 154


>gi|110635486|ref|YP_675694.1| hypothetical protein Meso_3157 [Mesorhizobium sp. BNC1]
 gi|110286470|gb|ABG64529.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 544

 Score =  202 bits (514), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 101/545 (18%), Positives = 183/545 (33%), Gaps = 45/545 (8%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF  V+++AV+ L ENTPE R  IY  AR+++  +L ++      EI +RQ   +E A
Sbjct: 1   MADFAAVLRKAVEALKENTPEAREKIYTKARSTIEAKLAAVSSPP--EIADRQRRLIEDA 58

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I  V+ +            +      S     +    P +R++          + A    
Sbjct: 59  IATVKAEYATPPAAKAGVDDELERLLSDLQVAHPKSAPVVRALPEEPAPAVASQPAEDAQ 118

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH-----DKSRLRRGK 175
           +    R +             E            +   +  A  E        S +    
Sbjct: 119 ITDADREDNPAEAFAEPEAASEEEREPDPADEIVEPEPAKTAPAEDFGKLAPVSPVDDID 178

Query: 176 LAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH---------------------- 213
            +     P                                                    
Sbjct: 179 WSQTRPAPVEGPEVLPPLEATLPGNIAPDEAPQRGRGRRLVLPVLLVLVVCAVALGGWLY 238

Query: 214 --------LFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
                           +     A G   ++  +  S     +R+S               
Sbjct: 239 REDVAQLAGMSNAGDGVDETEAAEGEEPTVQVAAPSEQPQEQRQSTAEAQATPDAPAESA 298

Query: 266 RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEI---EEG 322
             K T+RLL DG EVD GP+         TS                    +      + 
Sbjct: 299 PQKFTQRLLPDGREVDEGPAGGEAGLGEGTSVAQAVQGSEAPVQGRPGGSAEPAESQPDQ 358

Query: 323 NPLIGEGRVFINKGRG--QSSILSGKILWSLQQEKSQG--LKGLVIKGDIPMIDNAFSAS 378
           +  IG+  +F  +     +    +G ++WS+ +E           I+ +  + +      
Sbjct: 359 SLPIGQKAIFYEERTSALEGYAENGSVVWSVVEESPGENLPPEPAIQAEATIPEKGLQLR 418

Query: 379 MTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISK 437
           MT++ N D SL  +H++E++F  P+      + ++ RI+M++++      +      I+ 
Sbjct: 419 MTIRRNTDQSLPASHIVELIFLTPENFPGGGINNVLRINMKRSEQDTGSPLLGIPAKIAD 478

Query: 438 NSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             +L++L  ++ED   NS +L    +IDIPI Y SG++ L T++KG  G  IF  A+  W
Sbjct: 479 GFFLVALSDTQEDQRVNSTLLRRQSWIDIPIVYSSGRRALITMEKGLPGERIFNEALDAW 538

Query: 498 ENRSN 502
              ++
Sbjct: 539 SRDTS 543


>gi|298292947|ref|YP_003694886.1| hypothetical protein Snov_2991 [Starkeya novella DSM 506]
 gi|296929458|gb|ADH90267.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 490

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 77/502 (15%), Positives = 161/502 (32%), Gaps = 32/502 (6%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+  LP+ + E R  +YE AR ++  +L +++P LP++ +ER+   LE A
Sbjct: 1   MADYYPLLARAIGGLPDKSAEARKAVYERARRALTAQLRAVEPPLPEDDVEREQQALENA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E  +  S   +     +    ++ +                        +  +   
Sbjct: 61  IRRIEADHGVSAPAAPTSAPNTSAPATPSPATPPVTPAPSAPAVPPPPRPAAAESPSAPV 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +   +   S                    E +          HD        +    
Sbjct: 121 RPAEPTGDFAPSEAEAVAA-----------GIEPEGYAGKDEGERHDWRSEAARMVRARE 169

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS--IGKS 238
           +        +      +            S           +I L + I  +      + 
Sbjct: 170 AAALSDDDEAGQATADDGDSIAAEVPEETSGGSGRVRLFGALIFLALLIAGAVVGYTQRE 229

Query: 239 KGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
                      S            +   PK T R+ +         S  P     N  + 
Sbjct: 230 TILALVGGAPASAPQTAQAPARPATPDAPKSTDRIAQAPDSSRPAQSGQPAQPAQNAPSG 289

Query: 299 AFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQG 358
                I   + +          E                       G + WS ++     
Sbjct: 290 TAAQGIDAPQRAVLFEESAGGGEQ----------------GLQQYVGTVKWSTERSPGSA 333

Query: 359 L--KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ-DAVVDLRRI 415
                + I+ DI +     SA++TL+ N D S+  +H++E+ F  P       V ++  +
Sbjct: 334 GTAPDVGIRADITIPARDISATLTLRRNQDTSIPASHIIEVQFKLPPNFDLGNVSNVPGM 393

Query: 416 SMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQK 475
             + ++++    +      ++ + +LI L   + D  RN   L    ++D+PI + +G++
Sbjct: 394 RAKASESAQGAPLVGLAVRVAPSYFLIGLSALDSDIQRNLSFLITRNWLDLPIVFENGRR 453

Query: 476 ILFTIDKGKKGADIFKSAIMQW 497
            +  ++KG+ G   F+ A   W
Sbjct: 454 AILVLEKGEAGDQAFRQAFSAW 475


>gi|146337477|ref|YP_001202525.1| hypothetical protein BRADO0322 [Bradyrhizobium sp. ORS278]
 gi|146190283|emb|CAL74279.1| hypothetical protein; putative exported protein [Bradyrhizobium sp.
           ORS278]
          Length = 484

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 49/300 (16%), Positives = 98/300 (32%), Gaps = 3/300 (1%)

Query: 201 GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                 + L         V      G +   +  +          L       G   K+ 
Sbjct: 178 ATSVPANTLLSFSAQPGTVGQRGPYGHSAFTNALVEALTAPSPGALLATLNQAGVAVKRA 237

Query: 261 VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                +P +    L     V   P   P    A ++     N       +          
Sbjct: 238 TSGAQQPLLLATPLGGSEVVFGPPRANPAPGTAESTIKTPANRQAAATAAMGPPPASTAS 297

Query: 321 EGNPLIGEGRVFINKGRGQSSILSGKILW--SLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
           +G           +    +    +G + W     +    G    VI+ +I + D    A+
Sbjct: 298 DGRTPGLAVLYDEDPSDPKGKRYTGSVTWRMETIKSPQSGRAVPVIRAEIDVPDRKLKAT 357

Query: 379 MTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISK 437
           + L+ N D +L  +HV E+ F+   +     + ++  I M+  + +    +      +++
Sbjct: 358 LQLRRNDDPTLPASHVAELTFARADDFAGGGINNVPGILMKSNEQARGTPLAGLAVKVTE 417

Query: 438 NSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
            S+L+ L   + D  RN ++L    + DIP+ Y + ++ +  I KG  G  +F      W
Sbjct: 418 GSFLVGLSNVDADRARNGELLAGREWFDIPLVYSNQRRGILAIGKGPSGDRVFADVFAAW 477


>gi|319898404|ref|YP_004158497.1| hypothetical protein BARCL_0226 [Bartonella clarridgeiae 73]
 gi|319402368|emb|CBI75907.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 474

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 84/512 (16%), Positives = 188/512 (36%), Gaps = 50/512 (9%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+ +++  ++   + T                       P+L + + ER    LE  
Sbjct: 1   MVDFVGILKNTINAQKDAT-----------------------PKLRERVYERATETLEHK 37

Query: 61  IL--QVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE----PRLRSISSILRSNKHKK 114
           I+  ++ K+  ++   + Q   + + +  +  ++ +             +    +     
Sbjct: 38  IVNMKLPKEAIEAQRRALQSAITTVEEEYLAVEKELLSSIMGWNYTEKRNDEKNAQNSLL 97

Query: 115 LANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
                     +           S       + SV +       V+  +   ++K +    
Sbjct: 98  SLENDGSVLVTEKQQQQLSVTNSVDNEIFDNASVISDMPDAKLVNIDSLNIYEKGQNIEE 157

Query: 175 KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS 234
            ++      +     + H      ++ L     +  +  +    +    L+ +  G  + 
Sbjct: 158 SMSKNALLASNLQADNSHIVSHIFSQALRRANRSSLQKRILIGVIVFFSLIILFSGTFFV 217

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
            G+   S    L+ +++   N  +K   +    K+T+RLLEDGSEVDVGP+   V+    
Sbjct: 218 SGRIFISGDQNLQEKNIQISNTLQKAAQTN--RKLTQRLLEDGSEVDVGPAEKTVSSSEE 275

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
            ++                  K   + G  ++ + R   +       +  G   WSL +E
Sbjct: 276 GTSTVVATN-----------LKLFGQVGEAVLYQMRTKHDAE----KVTKGSASWSLIEE 320

Query: 355 KSQGLK--GLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK-ESQDAVVD 411
            S       L ++GDI +     S  +TL+ N D SL   ++++++F      S   + +
Sbjct: 321 DSVKGASGELALRGDITIPSEGLSLRLTLRRNTDESLCAAYIIDLIFITSDKFSGQTINN 380

Query: 412 LRRISMRKTDNSPSVLIDS-NIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITY 470
           ++ ++ +  + S    +       I  + +L +L G+     RN +++ +  ++ + ++ 
Sbjct: 381 IKSLTFKANEKSIGQTLFGTVTAKIDNDFFLFALTGNHPFLDRNLQLIRDLDWLRLVMSD 440

Query: 471 RSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           ++G+    T  KG  G  IF   I QW  + N
Sbjct: 441 KNGRVHELTFAKGPAGEAIFNKVIGQWLMQKN 472


>gi|260459390|ref|ZP_05807645.1| peptidase C14 caspase catalytic subunit p20 [Mesorhizobium
           opportunistum WSM2075]
 gi|259034944|gb|EEW36200.1| peptidase C14 caspase catalytic subunit p20 [Mesorhizobium
           opportunistum WSM2075]
          Length = 558

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 109/304 (35%), Gaps = 9/304 (2%)

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
             + +       +      +      G     S ++ ++       L            K
Sbjct: 194 APVEAPAGTYIAYSTSPGRIAQDGEEGGNSPYSQALAEAITVPGLSLESVFKMVRRNVIK 253

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEI 319
              S   P  +  +  +           PV DF             G    +      + 
Sbjct: 254 ATGSAQVPWDSSSITGEFYFSRQESPGPPVKDFPAPVPSPEVKLAPGISTFSRT----DP 309

Query: 320 EEGNPLIGEGRVFINKGRG--QSSILSGKILWSLQQEKSQG--LKGLVIKGDIPMIDNAF 375
              +       +F  +     Q S   G ++WSL QE   G   +   I+ +  +    F
Sbjct: 310 PSISATSVGKAIFYEERTATKQGSADPGNVIWSLVQESPGGDLPREPAIRAEATIPGKNF 369

Query: 376 SASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFV 434
              MT + N D +L  +H++E++F  P       V ++ R++M+ ++      +      
Sbjct: 370 RLRMTFRRNTDKTLPASHIVEMIFLTPDGFEGGGVDNILRVAMKSSEQDAGSPLIGIPAK 429

Query: 435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAI 494
           IS   +L++L  ++ D   N  +L   ++ DIPI Y+SG++ L T++KG    + F+ A+
Sbjct: 430 ISDGFFLVALNDAKADEDANLTLLRSQQWFDIPIVYKSGRRALMTLEKGSGAEETFQEAL 489

Query: 495 MQWE 498
             W 
Sbjct: 490 QAWA 493


>gi|146338377|ref|YP_001203425.1| helicase [Bradyrhizobium sp. ORS278]
 gi|146191183|emb|CAL75188.1| hypothetical protein; putative helicase [Bradyrhizobium sp. ORS278]
          Length = 1644

 Score =  199 bits (505), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 60/450 (13%), Positives = 135/450 (30%), Gaps = 11/450 (2%)

Query: 52   RQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNK 111
            R+  + ++ +      + +     +         +S     +I  +  L    +    ++
Sbjct: 1200 REHARRDEPVALPMASSSQPFTRLQPSAYGGHADASGGVTADIPPDSSLVVRPAYSLEDE 1259

Query: 112  HKKLANI---LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
               +A           S         ++          S     E  ++ +         
Sbjct: 1260 IATVAENLSLARHSAPSVMPVLGPAPDWLRGAASSSGASSPALIETGTATTAAERQPGAH 1319

Query: 169  SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
            +       AG F                 + R   S           +       L+   
Sbjct: 1320 APPALDDAAGTFVVAPADESEKPARNSRVRARRAQSDQIIKHPALAERARAVQDDLITPP 1379

Query: 229  IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
             G       +  ++       +          + +      T+  +      + G     
Sbjct: 1380 RGSLRRYVMAAAAVVAMAIVGASISWPPAASRLAAAWHTVTTQVAV----AWNAGSPAAA 1435

Query: 289  VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
            +        +A +        +              +        +          GK+ 
Sbjct: 1436 LPAEPGPHKVAAERMTPDVRTTAANATTTGSAAEPIISHAVLYQEDPQDPLGKRFLGKVT 1495

Query: 349  WSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ-D 407
            W +++    G     IKGD+ + D    A+++L+ N +  +  +H+ME+ F++P +    
Sbjct: 1496 WRVERAA--GSVPASIKGDVEI-DRQMKATLSLRPNKEADMPASHIMEVKFNWPDDPSHA 1552

Query: 408  AVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIP 467
             V  L+ +SM+  +      + +    ++   ++I+L  +E D  RN  +L+   +IDIP
Sbjct: 1553 GVDSLKGVSMKAKEAGRGSALSTLTAKVTPEFFMIALSANEVDKTRNVLLLKGKEWIDIP 1612

Query: 468  ITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
            I Y  G + +  I+KG  G   F  A   W
Sbjct: 1613 IVYNGGSRAVLAIEKGADGERAFADAFTAW 1642


>gi|148251921|ref|YP_001236506.1| hypothetical protein BBta_0307 [Bradyrhizobium sp. BTAi1]
 gi|146404094|gb|ABQ32600.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 472

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 50/347 (14%), Positives = 106/347 (30%), Gaps = 13/347 (3%)

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
           +  D +  +   LA         +              L +F +              ++
Sbjct: 119 VPVDAAPAKADDLATELRDLGAILRELDGPSGRQNVVILDAFRANPFAARGIAGLAAGLV 178

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP----KITRRLLEDGSE 279
            +GM      S     G+I                  +               +    + 
Sbjct: 179 PVGMPARTVLSFAAQAGTIGQRGPDGHSAFTAALADVLQQPGPRLIDIFNQTNMAVQRAT 238

Query: 280 VDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG----RVFINK 335
                  +        + ++          ++                       V  ++
Sbjct: 239 SGAQQPFVMFTLLDGGAQLSPAAAKPASPVASQAPAPPRPAASAVAADARTPGLAVLYDE 298

Query: 336 GRGQS--SILSGKILW--SLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSI 391
              +      SG ++W     +    G     I+ +I + +     S+ L+ N D +L  
Sbjct: 299 DVSEPRGKRYSGSVVWRIETVKSAQSGADTAAIRAEIDIPERKLKVSLQLRRNDDPTLPA 358

Query: 392 THVMEIMF-SFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEED 450
           +HV E+ F   P+    A+ ++  + M+ ++ +    +      I++ S+L+ L   E D
Sbjct: 359 SHVAELTFKPAPEFVGGAISNVPGMLMKTSEQARGTPLAGLAVKITEGSFLVGLSNVEAD 418

Query: 451 PFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
             RN ++L    + DIP+ Y S ++ +  I KG  G  +F  A   W
Sbjct: 419 RARNEELLAGREWFDIPLVYASQRRGILAIGKGPSGDRVFADAFAAW 465


>gi|218528992|ref|YP_002419808.1| hypothetical protein Mchl_0963 [Methylobacterium chloromethanicum
           CM4]
 gi|218521295|gb|ACK81880.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 493

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/508 (14%), Positives = 162/508 (31%), Gaps = 23/508 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPEADIDLERKALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + +          E     +            R   +S         +     +
Sbjct: 61  IGRLEAEYEAPPAAVTTPAEEPAAAAPEAPPPPPPEPTRPEPLSPGPLPPTLPEPEPPQT 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                                   +           S  P    E         +     
Sbjct: 121 SDEPL---------------VLPPASVPAGIGSDTGSAEPKPPAETVPFMPPTRRPKADE 165

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +                +   +     + +               G           +  
Sbjct: 166 AVKPEPENEGGFIPPVAEPEPVSVASESEAGADPASPETNGAGEAGNGRQRPRIDVVTPP 225

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                L R    GG +        +     R    D  +      T      A  S+   
Sbjct: 226 EGRSRLLRNLFVGGVLAAVIALIAVAAFFLRDQPSDLQQSAAEQETPAEQPDAKFSDRVG 285

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK----GRGQSSILSGKILWSLQQEKS 356
                 +             +    + +  +   +     R Q    +G  +W L+    
Sbjct: 286 AERNEAEARPKPAAPGAAPTQPEVTVSQRAILYEENQSDTRAQPIATNGHTVWRLEAVNG 345

Query: 357 QGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ--DAVVDL 412
           +  +     ++ ++   +   + +MT++ N D +L  +H +E+ F+   ++    AV ++
Sbjct: 346 EQGEPLQTALRVNVEFPEAGLTLAMTMRKNLDATLPASHTVELAFTNNADAGAQRAVQNI 405

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
             + ++  + S    +      + +N +LI L   + D  RN+++L    + D+ +TY +
Sbjct: 406 GLLQLKDEEASRGSPVSGLPVRVRENLFLIGLSSLKSDVDRNTELLLHKNWFDLALTYAN 465

Query: 473 GQKILFTIDKGKKGADIFKSAIMQWENR 500
           GQ+ + + +KG  GA   +SA  QW   
Sbjct: 466 GQRAVISFEKGSAGAQALQSAFAQWRRD 493


>gi|254559687|ref|YP_003066782.1| hypothetical protein METDI1148 [Methylobacterium extorquens DM4]
 gi|254266965|emb|CAX22765.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 492

 Score =  194 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 74/505 (14%), Positives = 162/505 (32%), Gaps = 23/505 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPEADIDLERKALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + +          E     +            R   +S         +     +
Sbjct: 61  IGRLEAEYEAPPAAVTMPAEEPAAAAPEAPLPLPPEPTRPEPLSPGPLPPTLPEPEPPQT 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                                   +              P    E         +     
Sbjct: 121 SDEPL---------------VLPPASVPAGIGSDTGPAEPKPPAETVPFMPPTRRPKAEE 165

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +                +   +     A +  +            G           +  
Sbjct: 166 AVKPEPENEGGFIPPVAEPEAVSVASEAEASANPASPETNGAGEAGNGRQRPRIDVVTPP 225

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                L R    GG +        +     R    D  +      T      A  S+   
Sbjct: 226 EGRSRLLRNLFVGGVLAAVIALIAVAAFFLRDQPSDLQQSAAEQETPAEQPDAKFSDRVG 285

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK----GRGQSSILSGKILWSLQQEKS 356
                 +             +    + +  +   +     R Q    +G  +W L+    
Sbjct: 286 AERNEAEARPKPAAPGAAPAQPEVTVSQRAILYEENQSDTRAQPIATNGHTVWRLEAVNG 345

Query: 357 QGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ--DAVVDL 412
           +  +     ++ ++   +   + SMT++ N D +L  +H +E+ F+   ++    AV ++
Sbjct: 346 EQGEPLQTALRVNVEFPEAGLTLSMTMRKNLDATLPASHTVELAFTNNADAGAQRAVQNI 405

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
             + ++  + S    +      + +N +LI L   + D  RN+++L    + D+ +TY +
Sbjct: 406 GLLQLKDEEASRGSPVSGLPVRVRENLFLIGLSSLKSDVDRNTELLLHKNWFDLALTYAN 465

Query: 473 GQKILFTIDKGKKGADIFKSAIMQW 497
           GQ+ + + +KG  GA   +SA  QW
Sbjct: 466 GQRAVISFEKGSAGAQALQSAFAQW 490


>gi|148254075|ref|YP_001238660.1| hypothetical protein BBta_2605 [Bradyrhizobium sp. BTAi1]
 gi|146406248|gb|ABQ34754.1| hypothetical protein BBta_2605 [Bradyrhizobium sp. BTAi1]
          Length = 1680

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 68/453 (15%), Positives = 138/453 (30%), Gaps = 19/453 (4%)

Query: 46   PKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS 105
            P+  + R  + LE  I  V  +N       ++D  S+  +              LRS   
Sbjct: 1244 PRLPVTRPAHSLEDEIATV-AENLSIARRDQRDALSEPTEHPAPD--------WLRSGII 1294

Query: 106  ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
                    + +        S           S  L   +        + +   +   +I 
Sbjct: 1295 GGAPADEARASRRSGHDVASEKLDVSPLDAPSPALPPWMEPVAPATDKENELRAQATSIS 1354

Query: 166  HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +D S   R K A                             + L              L 
Sbjct: 1355 NDPSDAARAKPAKAPDTGAAMARGQFGPARGRAIIDHQRLSARLRPALDQIRARPRSSLR 1414

Query: 226  GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPS 285
               +  +  +  +  + +   +          +  +                        
Sbjct: 1415 RPVVAAAAVLTITLVTASLVWQPTGRRIATSWQTALTQLTASWNAAPPAAALPATTEPHK 1474

Query: 286  TIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSG 345
                    + ++ A +    G   +T    +        +        +          G
Sbjct: 1475 VTAERMTPDVTSTASREGSPGSTITTGNAAQPM------VSHAVLYQEDPQDPGGKRYLG 1528

Query: 346  KILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES 405
            K+ W +  E + G     IKGD+ + D    A+++L+ N +  +  +H++E+ F++P + 
Sbjct: 1529 KVTWRV--EPAAGSVPASIKGDVEI-DKQMKATLSLRPNKESEMPASHILEVKFNWPGDP 1585

Query: 406  Q-DAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFI 464
                V  L+ +SM+  +      + +    ++   ++I+L  +E D  RN  +L+   +I
Sbjct: 1586 SHAGVDTLKGVSMKAKEAGRGAALSTLTAKVTPEFFMIALSANEVDKTRNFLLLKGKEWI 1645

Query: 465  DIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
            DIPI Y  G + +  I+KG  G   F  A   W
Sbjct: 1646 DIPIVYNGGSRAVLAIEKGADGERAFTDAFTAW 1678


>gi|163850433|ref|YP_001638476.1| hypothetical protein Mext_1000 [Methylobacterium extorquens PA1]
 gi|163662038|gb|ABY29405.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 492

 Score =  193 bits (490), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 73/505 (14%), Positives = 162/505 (32%), Gaps = 23/505 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPEADIDLERKALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + +          E     +            R   +S         +     +
Sbjct: 61  IGRLEAEYEAPPAAVTTPAEEPAAAAPEAPPPPPPEPTRPEPLSPGPLPPTLPEPEPPQT 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                                   +              P    E         +     
Sbjct: 121 SDEPL---------------VLPPASVPAGIGSDTGPAEPKPPTETVPFMPPTRRPKADE 165

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +        +       +   +     A +               G           +  
Sbjct: 166 AVKPEPENENGFIPPVAEPEPVSVASEAEAGADPASPETNGAGEAGNGRQRPRIDVVTPP 225

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                L R    GG +        +     R    D  +      T      A  S+   
Sbjct: 226 EGRSRLLRNLFVGGVLAAVIALIAVAAFFLRDQPSDLQQSAAEQETPAEQPDAKFSDRVG 285

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK----GRGQSSILSGKILWSLQQEKS 356
                 +             +    + +  +   +     R Q    +G  +W L+    
Sbjct: 286 AERNEAEARPKPAAPGAAPAQPEVTVSQRAILYEENQSDTRAQPIATNGHTVWRLEAVNG 345

Query: 357 QGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ--DAVVDL 412
           +  +     ++ ++   +   + +MT++ N D +L  +H +E+ F+   ++    AV ++
Sbjct: 346 EQGEPLQTALRVNVEFPEAGLTLAMTMRKNLDATLPASHTVELAFTNNADAGAQRAVQNI 405

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
             + ++  + S    +      + +N +LI L   + D  RN+++L    + D+ +TY +
Sbjct: 406 GLLQLKDEEASRGSPVSGLPVRVRENLFLIGLSSLKSDVDRNTELLLHKNWFDLALTYAN 465

Query: 473 GQKILFTIDKGKKGADIFKSAIMQW 497
           GQ+ + + +KG  GA   +SA  QW
Sbjct: 466 GQRAVISFEKGSAGAQALQSAFAQW 490


>gi|240137509|ref|YP_002961980.1| hypothetical protein MexAM1_META1p0777 [Methylobacterium extorquens
           AM1]
 gi|240007477|gb|ACS38703.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 493

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/505 (14%), Positives = 168/505 (33%), Gaps = 22/505 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPEADIDLERKALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + +     +      +   +   +      EP      S               
Sbjct: 61  IGRLEAEYEAPPPAAATMPAEEPAATVPEAPPPPPPEPTRPEPLSPGPLPPTLPEPEPPQ 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +       S                  +       +     +       + +    F
Sbjct: 121 TSDEPLVLPPASVPAAIGTDTGPAEPKPPAETVPFMPPTRRPKADEAVKPEPQNEN--GF 178

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P      +        +    S  +  +           I ++    G S  +     
Sbjct: 179 IPPVTEPEPASVASEAEASADPASPETNGAGEAGNGRQRPRIDVVTPPEGRSRLLRNLFV 238

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                       GG +        +     R    D  +      T      A  S+   
Sbjct: 239 ------------GGVLAAVIALIAVAAFFLRDQPSDLQQSAAEQETPAEQPDAKFSDRVG 286

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK----GRGQSSILSGKILWSLQQEKS 356
                 +             +    + +  +   +     R Q    +G  +W L+    
Sbjct: 287 AERNEAEARPKPAAPGAAPAQPEVTVSQRAILYEENQSDTRAQPIATNGHTVWRLEAVNG 346

Query: 357 QGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ--DAVVDL 412
           +  +     ++ ++   +   + +MT++ N D +L  +H +E+ F+   ++    AV ++
Sbjct: 347 EQGEPLQTALRVNVEFPEAGLTLAMTMRKNLDATLPASHTVELAFTNNADAGAQRAVQNI 406

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
             + ++  + S    +      + +N +LI L   + D  RN+++L    + D+ +TY +
Sbjct: 407 GLLQLKDEEASRGSPVSGLPVRVRENLFLIGLSSLKSDVDRNTELLLHKNWFDLALTYAN 466

Query: 473 GQKILFTIDKGKKGADIFKSAIMQW 497
           GQ+ + + +KG  GA   +SA  QW
Sbjct: 467 GQRAVISFEKGSAGAQALQSAFAQW 491


>gi|319406709|emb|CBI80342.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 480

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 107/246 (43%), Gaps = 19/246 (7%)

Query: 262 FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEE 321
            +    K+T+RLLEDGSEVDVGP+    +      +                  K   + 
Sbjct: 242 ATQTNRKLTQRLLEDGSEVDVGPAERTESPSTEGISTVVATN-----------LKSFGQV 290

Query: 322 GNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL--KGLVIKGDIPMIDNAFSASM 379
           G  ++ +     +         +G + WSL  E S       L I+GDI + D   S  +
Sbjct: 291 GEAVLHQMATKHD----SGKATTGSVSWSLITEDSVKGIQGELAIRGDITIPDEGLSLRL 346

Query: 380 TLKCNADISLSITHVMEIMFSFPK-ESQDAVVDLRRISMRKTDNSPSVLIDS-NIFVISK 437
           TL+ N D +L   ++++++F      S  A+ +++ +  +++  S    +       I  
Sbjct: 347 TLRRNTDEALHAAYIIDLIFIISDKFSGQAINNIKSLIFKESGKSIGQTLVGTVTAKIDN 406

Query: 438 NSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           + ++++L G+     RN +++ +  +  + I+ ++G+       KG  G  IFK  I +W
Sbjct: 407 DFFVVALIGNHPFLDRNLQLMRDLDWFHLVISDKNGRMHELNFAKGPAGQAIFKEVIEKW 466

Query: 498 ENRSNN 503
             + N+
Sbjct: 467 LMKENS 472



 Score = 72.3 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 1  MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
          MVDF+ +++  ++   + TP  R  IYEHA  ++   + +MK  LPKE +E Q + L+ A
Sbjct: 1  MVDFVGILKNKINAQKDITPRLRKQIYEHATKTLEHTIVNMK--LPKEAIEAQRSALQSA 58

Query: 61 ILQVEKQNQKSLHT 74
          I  VE++       
Sbjct: 59 ITIVEEEYLAVEKE 72


>gi|188580209|ref|YP_001923654.1| hypothetical protein Mpop_0941 [Methylobacterium populi BJ001]
 gi|179343707|gb|ACB79119.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 493

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/505 (14%), Positives = 163/505 (32%), Gaps = 22/505 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPETDIDLERQALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + +     +   +    P  +            L                    
Sbjct: 61  IGRLEAEYEAPPAAASAPQPVPEPAPAPPPPPEAPRPEPLAPAPLPAEFLPPALPEPEPP 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                      +            +              P  A   +  R       G  
Sbjct: 121 QNPDGPLVLPPASMPAGIGADLPPAEPKPPGETVPFMPPPRRAKAEEAPRPTPETADGFI 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P+     +                 A    +  +     ++                 
Sbjct: 181 PAPSSGDAAADAPGADPTAEPPPEANGAGEAGNGRQRPRIDVVTPPAGRS---------- 230

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                L R    GG +        +     R    D  +      +      A  S+   
Sbjct: 231 ----RLLRNLFVGGVLAAVIALIAVAAFFLRDQPSDLQQSTAEQESPAEKPDAKFSDRVG 286

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK----GRGQSSILSGKILWSLQQEKS 356
             +   +  +          +    + +  +   +     R Q    +G  +W  +    
Sbjct: 287 AEHSEAEARAKPAAPGTAPAQPEVTVSQRAILYEENQSDTRAQPIATNGNAVWRTEAVNG 346

Query: 357 QGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ--DAVVDL 412
              +    V++ ++       + +MT++ N D +L  +H +E+ F+   E+    AV ++
Sbjct: 347 GQGEPLQTVLRVNVEFPSAGLTLAMTMRKNLDANLPASHTIELAFTNSGEAGAKRAVQNI 406

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
             + ++  + +    +      + +N +LI L   + D  RN+++L    ++D+ +TY  
Sbjct: 407 GLLQLKDEEAARGSPVSGLPVRVRENLFLIGLSSLKGDVDRNTELLLHKNWLDLALTYAD 466

Query: 473 GQKILFTIDKGKKGADIFKSAIMQW 497
           GQ+ + + +KG  GA   +SA  QW
Sbjct: 467 GQRAVISFEKGGAGAQAVQSAFTQW 491


>gi|163758774|ref|ZP_02165861.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
 gi|162284064|gb|EDQ34348.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 104/527 (19%), Positives = 203/527 (38%), Gaps = 29/527 (5%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI++AVDNL ENTPE R+ +Y+ AR ++ R+LE++ P    E++  Q +KL  A
Sbjct: 1   MADFVAVIRKAVDNLSENTPENRAKVYDKARAAIRRQLEAINPPPSDEVMASQLDKLGAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L     + ++ + +     +++  +    R+             +  ++
Sbjct: 61  IDEVESEHAEALPADLDETDALMAELESMVEKSPVVAEPARAAPPPAPVAPEPVASAPVA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            + + +    +     +      +             +S  A  +               
Sbjct: 121 PRMEQQPAAAVYEPQAAVPQAAPIDEREPEAVMASGDLSGPAHDDAFGLGPDANATGAAR 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGL--------------LSFYSALSEHHLFKYFVFLIILLG 226
               GS                               +  S  +E             + 
Sbjct: 181 KPALGSGGVLALVVALALAGVGYAGWAYKDTFMAMLGTSQSETAEPAAPSETAPETAAVT 240

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST 286
                  +    + + +     E +       +        K T+RL  DG+E D GP+ 
Sbjct: 241 PETSTPETPAAPETTPSEPAPAEPVTSDAAPSEPADPAEGEKFTQRLNADGTETDAGPAP 300

Query: 287 IPVADFA-----------NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
            P  D              T            E           +     + +  +   +
Sbjct: 301 GPATDAPVEGRSVAGLTDTTPADEAIAEESTAEAEVTTEEAAVPQSDPLGVSQKMILYEE 360

Query: 336 GRGQSS--ILSGKILWSLQQEKSQGLKG-LVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
             GQ S  +  G ++W+L  E S       VI+G+I   D   SA +T+K N D SL  +
Sbjct: 361 RLGQQSLEVKPGTVVWTLVSEPSSEGPDSPVIRGEINNPDTGLSALLTIKKNNDPSLPAS 420

Query: 393 HVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDP 451
           H++EI+F+ P+     ++  L+RIS ++T+      + +    I+++ Y+++L    E  
Sbjct: 421 HLVEIVFAVPEGFSGGSIDQLQRISFKQTEADQGSPLIAVPAKITQDFYMVALNDLPEAA 480

Query: 452 FRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWE 498
             N+ ++ +  +IDIP+ Y +G++ L T++KG  G ++F  A+  W 
Sbjct: 481 EANTGLMRQRSWIDIPVVYANGRQALITLEKGTTGTEVFNQALDAWA 527


>gi|319403702|emb|CBI77287.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 477

 Score =  183 bits (464), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 110/246 (44%), Gaps = 19/246 (7%)

Query: 262 FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEE 321
            +    K+T+RLLEDGSEVDVGP+    +  A  ++                  K   + 
Sbjct: 242 ATQTNRKLTQRLLEDGSEVDVGPAERTESPSAEGTSTVVATN-----------LKSFGQV 290

Query: 322 GNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL--KGLVIKGDIPMIDNAFSASM 379
           G  ++ +     +         +G + WSL  E S       L I+GDI + D   S  +
Sbjct: 291 GEVVLYQMATKHD----SGKATTGSVSWSLITEDSVKGIQGELAIRGDITIPDEGLSLRL 346

Query: 380 TLKCNADISLSITHVMEIMFSFPK-ESQDAVVDLRRISMRKTDNSPSVLIDS-NIFVISK 437
           TL+ N D +L   ++++++F      S  A+ +++ ++ +++  S S  +       I  
Sbjct: 347 TLRRNTDEALHAAYIIDLIFIISDKFSGQAINNIKSLTFKESGKSISQTLVGTVTAKIDN 406

Query: 438 NSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           + ++ +L G+     RN +++ +  +  + I+ ++G+       KG  G  IFK  I +W
Sbjct: 407 DFFVFALVGNHPFLDRNLQLIRDLDWFHLVISDKNGRMHELNFAKGPAGQAIFKEVIGKW 466

Query: 498 ENRSNN 503
             + NN
Sbjct: 467 LMKENN 472



 Score = 70.4 bits (170), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 1  MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
          M+DF+ +++  ++   + TP  R  IYEHA  ++   + +MK  LPKE +E Q + L+ A
Sbjct: 1  MIDFVGILKNKINAQKDITPRLRKQIYEHATKTLEHTIVNMK--LPKEAIEAQRSALQSA 58

Query: 61 ILQVEKQNQKSLHT 74
          I  VE++       
Sbjct: 59 ITIVEEEYLAVEKE 72


>gi|315121812|ref|YP_004062301.1| putative transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495214|gb|ADR51813.1| putative transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 500

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 162/236 (68%), Positives = 197/236 (83%), Gaps = 1/236 (0%)

Query: 264 GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG-DENSTFVLGKKEIEEG 322
           G RPKITRRLL +GSEVD+G +     + +NTSN+ FKN+I   D+  + +L +K+    
Sbjct: 261 GSRPKITRRLLANGSEVDMGTAISSPINSSNTSNVFFKNHIDSNDQAVSHILERKKSGTE 320

Query: 323 NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLK 382
           NP+  +GRVFIN+G G+SSI +G I WSLQ+EK+QGLKGLVIKGDIP I+NAFSAS+TLK
Sbjct: 321 NPIDEDGRVFINQGSGRSSIFAGNIFWSLQKEKTQGLKGLVIKGDIPTINNAFSASITLK 380

Query: 383 CNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLI 442
           CNADI+LS+TH+MEI FSFPKESQ+++VDLR+ISMRKT+NSPS+LIDSNIF ISKNSYLI
Sbjct: 381 CNADIALSVTHLMEITFSFPKESQNSIVDLRQISMRKTENSPSILIDSNIFRISKNSYLI 440

Query: 443 SLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWE 498
           SLKG  ED  RNSKILEEYR+IDIPITY SGQKI  TIDKGK G+D+FKSA+M W+
Sbjct: 441 SLKGDAEDFLRNSKILEEYRWIDIPITYHSGQKITLTIDKGKVGSDVFKSAVMDWK 496



 Score = 93.1 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 69/86 (80%)

Query: 1  MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
          MVDF+LVIQRAVDNL ENTPE RSHIYE AR +V+R+LESM PR P++ILERQ +KLE+A
Sbjct: 1  MVDFVLVIQRAVDNLSENTPEMRSHIYERARVAVSRQLESMNPRTPRDILERQLSKLEKA 60

Query: 61 ILQVEKQNQKSLHTSKQDKESDIPKS 86
          ILQVE++N+K      +D+    PKS
Sbjct: 61 ILQVERKNKKFPRALDKDRVLLAPKS 86


>gi|222149602|ref|YP_002550559.1| hypothetical protein Avi_3542 [Agrobacterium vitis S4]
 gi|221736584|gb|ACM37547.1| conserved hypothetical Protein [Agrobacterium vitis S4]
          Length = 715

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 93/509 (18%), Positives = 170/509 (33%), Gaps = 29/509 (5%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
           E TP   + ++       +R+ E+ KP +   I   +    ++A              + 
Sbjct: 210 EPTPAPLAPVHSFEAQPQSRQEEAEKPAVYPSIPPARQPVFDEA-------EALGAFDAF 262

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
                       +  +    +P+     S    N               +   N +  + 
Sbjct: 263 VRDNKQPAAQGGSFSQAGHEDPKDLLDWSDKHQNTSFGTPAGQESGNDEKAVRNGASASK 322

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
           +          V  Q    ++                  +A + +               
Sbjct: 323 AGEDPAWFDDFVAAQPVPPAAAKKQQRAAAPDRSNSSEDMAAVLAKANRKAGLRTKKSRR 382

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH-FLRRESLDGGN 255
                +      L     +  +     L G   G+  ++     S         S   G+
Sbjct: 383 TAPYIITGVLILLIGGGGYYAYAHRDNLPGAIAGLKQTVTGLFASKDSTPASAPSSQTGS 442

Query: 256 VDKKNVFSGIRP---------KITRRLLEDGSEVDVGPSTIPVADFANTS--------NI 298
            D     +             K T++L+ DG+EVD G S          S        N 
Sbjct: 443 ADAGKPATVPASTGDAGAAGQKFTQKLMPDGTEVDEGASNAAANSGEGRSVAQQNGGANP 502

Query: 299 AFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKS 356
           A     G           +      P  G+      +  GQ   + + G I+W  ++E  
Sbjct: 503 AAPVSGGAASAPATTTPVQGAPFTVPENGQKAYLYEERLGQTTPTTVQGYIVWEARRETG 562

Query: 357 -QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRR 414
             G     I+G + + +   +A +T K N D SL  +H+MEI+FS P+      +  ++R
Sbjct: 563 DSGKPEPEIQGKLTIPERGLTALITFKRNTDSSLPASHLMEIVFSVPQNFEGGGIDSVQR 622

Query: 415 ISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ 474
           ++M+ ++      I +    I+ ++++I+     E   RN  +L    +IDIP+TYR+G+
Sbjct: 623 VAMKTSEQDRGDPIVAVPAKITDDTFMIAFNDFAEVVARNVDLLRSRDWIDIPVTYRNGR 682

Query: 475 KILFTIDKGKKGADIFKSAIMQWENRSNN 503
           + L T+DKG  G  IF S I +W    NN
Sbjct: 683 RALITLDKGVAGKPIFDSVIKEWAALGNN 711



 Score = 90.5 bits (222), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 77/248 (31%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI+RAVD L  NTPE R  +YE AR +V R+L++M P+  +++L RQ +KL+ A
Sbjct: 1   MADFVAVIRRAVDGLSNNTPEMRVKVYEKARGAVMRQLDNMTPKPSEDMLRRQLDKLDAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE    ++L   ++D     P            EP               +   +  
Sbjct: 61  IAEVEADYAEALPAVEEDVYEPEPVYEPAPAYEPEPEPEPVYHEPAPVEEPAHEPEYVHR 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +          P      +                S  P  A            +    
Sbjct: 121 PEPVHEPEPAYVPAPAPAPVYVPEPDPEPVYEPEPESYKPEPARIPPAIWENEEPVLPAV 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           S    +   +V      K        S L         V        +            
Sbjct: 181 SSAPAAPAPAVKPSAPQKHSMDEWLESHLEPTPAPLAPVHSFEAQPQSRQEEAEKPAVYP 240

Query: 241 SITHFLRR 248
           SI    + 
Sbjct: 241 SIPPARQP 248


>gi|146343109|ref|YP_001208157.1| hypothetical protein BRADO6306 [Bradyrhizobium sp. ORS278]
 gi|146195915|emb|CAL79942.1| hypothetical protein BRADO6306 [Bradyrhizobium sp. ORS278]
          Length = 1738

 Score =  180 bits (457), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 67/494 (13%), Positives = 159/494 (32%), Gaps = 33/494 (6%)

Query: 11   AVDNLPENTPERRSHIYEH-----ARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE 65
                 P+  P+      +      A +++   + ++   L                 Q  
Sbjct: 1269 TRSAEPKVPPQAVVATPKRPASRNATHTLEEEIATVAKYLSMARRSGADVGAIATRDQTR 1328

Query: 66   KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
              ++ +      +      + +   K     +P    +++++      +   +++  G  
Sbjct: 1329 SDSRTAAPKPSPELRLLRRRPAPAPKPMAEPKPEPEVVAALVVPPALPEQPAVVAPVGAD 1388

Query: 126  RTNTNLSPKNFSCRLR-EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
            +             +  E  +       E  S +    A   + S         I +   
Sbjct: 1389 QLAAGPIAPVEVPPIVIEKPAQIAPVGTEEKSVLVAEQADRANASSANAEPAKPIAAMTP 1448

Query: 185  GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
                 +      + +   ++F +A +     +      ++   A G+   +  S    + 
Sbjct: 1449 APSTVAAEEIKIHASLIEMAFKAAETPTLPRRRLPSRRVMTVAAAGLLAIVAVSWERASQ 1508

Query: 245  FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
            +++    D             R     R++ DG  V    +        +          
Sbjct: 1509 WVQVPLSDATAASTLPSEPAPRKVNAERIMPDGKPVASAAADEHATVGMSVPVSTPAQA- 1567

Query: 305  GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ-QEKSQGLKGLV 363
                                         +    +     GK+ WSL+  +  +      
Sbjct: 1568 ------------------------YLYHEDPQDPKGKRFPGKVTWSLEPSKGPRADASAA 1603

Query: 364  IKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNS 423
            IKG+I + +N    ++ L+ N ++ L  +HVME+ F++   S   +  +R I ++  +  
Sbjct: 1604 IKGEIEI-ENGAKVTIALRRNTELELPASHVMELSFNWADPSVTGLSSMRGIGLKGEEAE 1662

Query: 424  PSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKG 483
                + +    ++   ++++L  +E D  RN  +L+  ++ DIPI Y  G + L +I+KG
Sbjct: 1663 RGTALVTQTAKVTPKYFMVALSANEVDAKRNMMLLKGKQWFDIPIVYEGGSRALLSIEKG 1722

Query: 484  KKGADIFKSAIMQW 497
             +G  +FK A   W
Sbjct: 1723 SEGERVFKDAFASW 1736



 Score = 42.3 bits (97), Expect = 0.21,   Method: Composition-based stats.
 Identities = 24/273 (8%), Positives = 62/273 (22%), Gaps = 2/273 (0%)

Query: 109  SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
            +    K  +    +  ++T   L P   S    +     +      +  ++  A      
Sbjct: 1197 AKTPNKAPDKAPNKAHNKTARGLPPALRSLLQPDASLRDLAEILFPERIIALRARPVAGA 1256

Query: 169  SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
            +      +    +                K     +    L E          +     A
Sbjct: 1257 AVSVAAPVLFETTRSAEPKVPPQAVVATPKRPASRNATHTLEEEIATVAKYLSMARRSGA 1316

Query: 229  IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
               + +      S +     +      + ++      +P    +   +     V P  +P
Sbjct: 1317 DVGAIATRDQTRSDSRTAAPKPSPELRLLRRRPAPAPKPMAEPKPEPEVVAALVVPPALP 1376

Query: 289  VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG--EGRVFINKGRGQSSILSGK 346
                      A +   G            E       +G  E  V + +   +++  S  
Sbjct: 1377 EQPAVVAPVGADQLAAGPIAPVEVPPIVIEKPAQIAPVGTEEKSVLVAEQADRANASSAN 1436

Query: 347  ILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASM 379
               +            V   +I +  +    + 
Sbjct: 1437 AEPAKPIAAMTPAPSTVAAEEIKIHASLIEMAF 1469


>gi|148252860|ref|YP_001237445.1| hypothetical protein BBta_1299 [Bradyrhizobium sp. BTAi1]
 gi|146405033|gb|ABQ33539.1| hypothetical protein BBta_1299 [Bradyrhizobium sp. BTAi1]
          Length = 1763

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/486 (14%), Positives = 154/486 (31%), Gaps = 17/486 (3%)

Query: 17   ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
            + + +RR+     A +++   + ++   L    L R+      A+ +           ++
Sbjct: 1288 DISAKRRAAQPATAPHTLEEEIATVAKYLS---LARRSGAELPAVARTRIGAPVPHIRAE 1344

Query: 77   QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
            +  +           +  F +  +   S+         +         +      S    
Sbjct: 1345 RGADDRSF-------DATFAKEPVAKESANAARKPSPDVRIFRRRSAAAVPVEPSSSAAL 1397

Query: 137  SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
               +       V    E      P+       +     + +G  + P  +    V     
Sbjct: 1398 EPSIVVATDPPVPPAPEQLPVPPPLRDETPPVAAAADPEPSGADTQPNAAPPAPVAQAAL 1457

Query: 197  NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
              T        A  +           I   +      +   +        RR  +    V
Sbjct: 1458 ESTIDTPVSTEAAEQPQQHAASSESRIHRSLVEMAFQATESATAPRRRLPRRRVMPIAAV 1517

Query: 257  DKKNVFSGIRPKI--TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                V             L    +   V P+    A       +           +   +
Sbjct: 1518 GLLAVIGAALSWERAVDYLNAPSTVAAVDPAPPAEAPPRTAEVVQAAPDAKPATANEERV 1577

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSI--LSGKILWSLQQEKSQG-LKGLVIKGDIPMI 371
               +               ++          +GK+ WSL+Q K        V+KG+I + 
Sbjct: 1578 TVGQSVAVAAPATAQAFLYHEDPQDPKGKRFAGKVTWSLEQGKGPRVNAAPVLKGEIEI- 1636

Query: 372  DNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSN 431
            +N   A+++L+ N D  L  +HV+++ F++P ++   +  +R I ++  +      + + 
Sbjct: 1637 ENGMKATLSLRRNDDQELPASHVLDLSFAWPDQTTG-LSSMRGIGLKGAEAERGTALATQ 1695

Query: 432  IFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFK 491
               ++   ++++L  +E D  RN  +L+  ++ DIPI Y  G + L +I+KG  G  +F 
Sbjct: 1696 TARVTPRMFMVALSANEVDAKRNVLLLKGKQWFDIPIVYEGGNRALLSIEKGPDGDRVFN 1755

Query: 492  SAIMQW 497
             A   W
Sbjct: 1756 DAFANW 1761



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/269 (4%), Positives = 52/269 (19%), Gaps = 1/269 (0%)

Query: 57   LEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
            L      +E         +K       P S       + +  + R+       +  ++  
Sbjct: 1250 LRAPSRGIEASPVAPQPPAKMAAPVARPSSPAKPVATLDISAKRRAAQPATAPHTLEEEI 1309

Query: 117  NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
              ++        +       +          +  +   D         +   ++      
Sbjct: 1310 ATVAKYLSLARRSGAELPAVARTRIGAPVPHIRAERGADDRSFDATFAKEPVAKESAN-A 1368

Query: 177  AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
            A   S                +     +   ++              L         +  
Sbjct: 1369 ARKPSPDVRIFRRRSAAAVPVEPSSSAALEPSIVVATDPPVPPAPEQLPVPPPLRDETPP 1428

Query: 237  KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
             +  +       ++            + +   I   +  + +E     +    +    + 
Sbjct: 1429 VAAAADPEPSGADTQPNAAPPAPVAQAALESTIDTPVSTEAAEQPQQHAASSESRIHRSL 1488

Query: 297  NIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
                             L ++ +     +
Sbjct: 1489 VEMAFQATESATAPRRRLPRRRVMPIAAV 1517


>gi|114704941|ref|ZP_01437849.1| hypothetical protein FP2506_08391 [Fulvimarina pelagi HTCC2506]
 gi|114539726|gb|EAU42846.1| hypothetical protein FP2506_08391 [Fulvimarina pelagi HTCC2506]
          Length = 661

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 61/478 (12%), Positives = 134/478 (28%), Gaps = 19/478 (3%)

Query: 43  PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
               +   + +    E A          +      + +    + +            +  
Sbjct: 184 APGSESEADDERPHAEDAAADRGGTPAPANSNWGSEADQRYDEPASDGPFVGSGSAPVAG 243

Query: 103 ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                       +            + +            +     +         S   
Sbjct: 244 AGMAQPDYSRDDMHEDERGTDGDDFSLDRQGSAGDADGGSVSIPEADVSAPAYVPKSQER 303

Query: 163 AIEHDKS--------------RLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
             +   +                         S                +        + 
Sbjct: 304 HGQRSGAILGILSLLVIFGGLGAAAYFYGDDISTAILGDEQPAVATLSPEDGDTPEPSAG 363

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                  +         G   G +    +        +     +                
Sbjct: 364 DDAGAGTETAAAGDGAAGETEGTTRDYTQRLLPDGTEVDEGPAERQPNQFGEGTDVAAAT 423

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                + +G+   +        +               D  +T V      E GN  + +
Sbjct: 424 TAEDPVSEGTSPTLSSEIGRDPEIVGGETAEGTPEADADGENTDVAAVDPGENGNVPVAQ 483

Query: 329 GRVFINKGRGQSS--ILSGKILWSLQQEKS--QGLKGLVIKGDIPMIDNAFSASMTLKCN 384
             VF  +          +G ++WS+ +E           I+    + +   + +MT++ N
Sbjct: 484 RTVFYQERTSDQPGTQETGNVVWSVVEEPPIEGQPPEPAIRAVAEIPEEDVTMTMTIRRN 543

Query: 385 ADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLIS 443
           AD +L  +HV+E+MF  P       V  ++R+++++T+ +    +      IS   ++I+
Sbjct: 544 ADPTLPASHVIELMFDTPDSFAGGNVATVQRLALKRTEQARGEPLIGVAGKISDGFFIIA 603

Query: 444 LKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRS 501
           L   ++    N  +LE  ++IDIPI Y SG++ L +I+KG  G   FK AI  W++R+
Sbjct: 604 LNNLDQAVENNLALLEGQQWIDIPIAYASGRRALVSIEKGVPGDRAFKEAIAAWDSRT 661



 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/250 (12%), Positives = 73/250 (29%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D   V+++ +D LP +TP+ RS +Y+ AR ++ R+++   P L  ++   + N LE+A
Sbjct: 1   MADLSGVLRKTIDGLPRSTPDMRSRVYDKARAAIQRQIQVANPPLGDDVAAARLNALEEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I + E+      +     + ++ P ++ T +      P      +    + +        
Sbjct: 61  IERTEQHYLNIENGGASLETANEPAAAQTFQREPESVPDEPPQETTPAEDTNAADGESDE 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
               +      +           L  S  T     + +       +D       +     
Sbjct: 121 HDLTATEEDYQAEVVQDRLEDASLEPSDATTSSQRAEMEHDEGERYDDPDNATHEAVHSS 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                       +   +            +  +              A    +    S  
Sbjct: 181 WGAAPGSESEADDERPHAEDAAADRGGTPAPANSNWGSEADQRYDEPASDGPFVGSGSAP 240

Query: 241 SITHFLRRES 250
                + +  
Sbjct: 241 VAGAGMAQPD 250


>gi|23008316|ref|ZP_00049812.1| hypothetical protein Magn03003422 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 124

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 58/114 (50%), Gaps = 1/114 (0%)

Query: 385 ADISLSITHVMEIMFSFPK-ESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLIS 443
            D +L  +H +E+ F+     ++  V ++  + ++  +++    +      +  N +LI 
Sbjct: 9   LDATLPASHTIELAFTNSDSGAKRIVQNIGLLQLKDEESARGSPVSGLPVRVRDNLFLIG 68

Query: 444 LKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           L   + D  RN+ +L    ++D+ +TY +GQ+ + + +KG  GA   ++A  QW
Sbjct: 69  LSSLKSDIDRNTDLLLHKNWLDLAVTYTNGQRAVISFEKGNAGAQAMQNAFAQW 122


>gi|254504629|ref|ZP_05116780.1| hypothetical protein SADFL11_4668 [Labrenzia alexandrii DFL-11]
 gi|222440700|gb|EEE47379.1| hypothetical protein SADFL11_4668 [Labrenzia alexandrii DFL-11]
          Length = 580

 Score =  162 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 82/579 (14%), Positives = 172/579 (29%), Gaps = 80/579 (13%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++++ + +LPE+    R  +Y  ARN++  +L++ +P L    +  +  +LE+A
Sbjct: 1   MADYYSILKKTIASLPESNGAARRSVYSRARNAIVNQLKAYEPPLSPSEITAEQLRLEEA 60

Query: 61  ILQVEKQNQ------------------------KSLHTSKQDKESDIPKSSVTSKENIFL 96
           I +VE +                               S     +  P  +         
Sbjct: 61  IRKVEAEAARESLGLQPSAPQAPATPAAPPVREPEPAPSVPAAATTSPVETSAPPAPPVT 120

Query: 97  EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
            P   +  +    +     A+  S    S  +                  +         
Sbjct: 121 SPEPSAYPAEEPVSVPSSDASYESQPQASTLSGTAGSSLTEPEGPISSPETHPGYDPVSV 180

Query: 157 SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
              PV+  +  ++              T  +  +      +++R   S     SE     
Sbjct: 181 EPGPVSDDQVSQTEPLFEDEVVQPQTSTAGLTDAPVTPRASRSRSSASAALRSSEEKSRT 240

Query: 217 YFVFL-----------------IILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
             +                             +      +   T      +     V   
Sbjct: 241 VPIAAAAVVAVLVLGAAAYFFLSAPSEETFTDAAPAVSQEPEKTAVTEPAAPVEDTVSAS 300

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD------------ 307
           +  +    K T RLL +     V P    V              +               
Sbjct: 301 SEDADDASKNTDRLLNETDANVVAPDARAVTTTTINPQDTAPGTVAQPSIVTNVESTPPA 360

Query: 308 ----------------------ENSTFVLGKKEIEEGNPLIGEGRVFINKGR---GQSSI 342
                                   S          +      +  +   +G       + 
Sbjct: 361 DVDTPATDGAGVSQGVQPDSLAAVSPEQTEPAPAAQVPASGAQRSILYEEGADASSTGTA 420

Query: 343 LSGKILWSLQQEKS-QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSF 401
             G ++W+L +E    G    V+   + + +      + +K N D SL  +H++EI +  
Sbjct: 421 AQGAVIWTLGEETDLGGEAQSVLSAAVEIPERDIKVDIRIKPNDDTSLPASHLVEIKYEL 480

Query: 402 PKESQDA-VVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEE 460
           P+      +V++  + M+ T+ +    +      +S   + I+L     +  RN  +L E
Sbjct: 481 PEGFSGGDIVNVPGLVMKPTEEARGDALIGASVKVSPGFFWIALSSLPNEQQRNLALLRE 540

Query: 461 YRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWEN 499
             +IDIP+ Y +G++ + T++KG  G D  + A+  W+ 
Sbjct: 541 RGWIDIPMLYENGKRGILTLEKGPIGEDAVEKAVSAWQA 579


>gi|307944596|ref|ZP_07659936.1| putative CheA signal transduction histidine kinase [Roseibium sp.
           TrichSKD4]
 gi|307772345|gb|EFO31566.1| putative CheA signal transduction histidine kinase [Roseibium sp.
           TrichSKD4]
          Length = 588

 Score =  162 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 103/587 (17%), Positives = 195/587 (33%), Gaps = 88/587 (14%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++++ + +LPE+    R  +Y  ARN++  +L++ +P L    +  +  +LE+A
Sbjct: 1   MADYYSILKKTIASLPESNGSARRSVYSRARNAIVSQLKAYEPPLSPSEITAEQLRLEEA 60

Query: 61  ILQVEKQ---------------------NQKSLHTSKQDKESDIPKSSVTSKENIFLE-- 97
           I +VE +                        +    ++  E + P  +VT+ +   +   
Sbjct: 61  IRKVEAEAAREALGLGPSTTIAPEPSPQEAPAELELEKSSEPEAPAPAVTANDVPEVASE 120

Query: 98  --------------PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
                         P    + S + + +    A+  +VQ                     
Sbjct: 121 PTLSADLDSPLTGGPSHSPLKSEIEAAEQLGSASHEAVQSAREAYEEAPEPVEEKADTSK 180

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLL 203
                   +            + D S L   +     S  +  +  +         R   
Sbjct: 181 ERKEPTLGNVASREDDSTGNGDDDASSLFADEEPVAPSATSEVVSKAEARERRRAGREKR 240

Query: 204 SFYSALSEHHLFKYFVFLIILLGMAI---------------------GVSYSIGKSKGSI 242
           S  +ALS++      V  I L  +                         +   G   G+ 
Sbjct: 241 SASAALSKNGGRSSNVMPIALAAVLAVVIAGVSYFVLVPQDNGASLQETAQETGTDTGTE 300

Query: 243 THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEV---------------------- 280
                  +       + +       K T RLL+D  E                       
Sbjct: 301 KIEAPTPAQQAAVEPEASETEEASNKNTDRLLDDNGEPAAAPDARSVTTTLITPGQTETV 360

Query: 281 --DVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR- 337
             +  PS  P+         A     G D  ST                  R  + +   
Sbjct: 361 LVEPQPSATPLPSLPEDGAPADGQASGTDVASTSPTETPPAPSTAATADAQRSILYEEGE 420

Query: 338 ---GQSSILSGKILWSLQQEKS-QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITH 393
              G  S   G ++WSL+ E    G    V+  D+ + +   + ++ +K N D SL  +H
Sbjct: 421 DGSGSGSASQGAVVWSLEDETDLSGKAQKVLVADVTIPERDVNVNLRIKPNDDTSLPASH 480

Query: 394 VMEIMFSFPKE-SQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPF 452
           ++EI + FP+  S   VV++  + M+ T+ +    +      +S   + I+L     +  
Sbjct: 481 LVEIKYEFPENYSAGDVVNVPGLVMKPTEEARGDALLGASVKVSPGYFWIALSSLTSERD 540

Query: 453 RNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWEN 499
           RN  +L E  +IDIP+ Y +G++ + T++KG  G+     AI  W  
Sbjct: 541 RNLGLLRERGWIDIPMLYDNGKRGILTLEKGGVGSQAVDQAISSWTA 587


>gi|220927319|ref|YP_002502621.1| hypothetical protein Mnod_7582 [Methylobacterium nodulans ORS 2060]
 gi|219951926|gb|ACL62318.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 409

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 49/335 (14%), Positives = 107/335 (31%), Gaps = 9/335 (2%)

Query: 172 RRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
                    + P      +           +           L +         G A   
Sbjct: 76  EPEPAVAEAAPPLPEPEPAAEPALPEPGPPVALKLPDPDRSKLAEPAAESPAEDGQATRQ 135

Query: 232 SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD 291
              I   +          +     V    + +      + R      +  +  +      
Sbjct: 136 RPRIDVVRPKGDRSRLLRNGIVAGVLAAVIGAIAFTAWSLRDTPATLQSKISENAAERPP 195

Query: 292 FANTSNIAFKNYIGGDENSTFVLGKKEIEE---GNPLIGEGRVFINKGRG---QSSILSG 345
            +  S  A +        +               +  I +      +  G       + G
Sbjct: 196 ESQDSKFADRVGGERAPAAPAAPAAPSRPSAAGSDIAIAQRATLYEESGGPNNAPRAIQG 255

Query: 346 KILWSLQQEKSQGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK 403
           +++W L    +   +    V++  + + +   S ++ ++ N D +L  +HV+E+ F+ P 
Sbjct: 256 QVVWRLDAINAGQGQPLQTVVRATLEVQEAGLSLALVIRRNTDTTLPASHVIELTFT-PG 314

Query: 404 ESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRF 463
               +V D+  +  +  ++     +      + +N +LI L   + D  RNS +L    +
Sbjct: 315 NPSRSVRDVGLLQFKDDESGRGSPVSGLPVPVRENIFLIGLSSLKSDVERNSDLLMRRNW 374

Query: 464 IDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWE 498
           ID+PI Y SG + + T +KG  G  + + A  QW+
Sbjct: 375 IDLPIRYASGGRAILTFEKGSAGEQVMRDAFAQWQ 409



 Score = 87.4 bits (214), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 54/137 (39%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P+ R  +YE AR ++  +L S+ P L +E ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPDMRKAVYERARAALTGQLRSLDPPLSEEDIDAERRSLDAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E +   +    + +         +   E             +         + +  
Sbjct: 61  IDRLEVEYGGAPRVREPEPAVAEAAPPLPEPEPAAEPALPEPGPPVALKLPDPDRSKLAE 120

Query: 121 VQGKSRTNTNLSPKNFS 137
              +S      + +   
Sbjct: 121 PAAESPAEDGQATRQRP 137


>gi|218459713|ref|ZP_03499804.1| putative transmembrane protein [Rhizobium etli Kim 5]
          Length = 103

 Score =  161 bits (406), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 54/97 (55%)

Query: 406 QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFID 465
             ++  ++RISM++T+      + +    I+ + ++I+L    +    N  ++    +ID
Sbjct: 2   GGSIESVQRISMKRTEQDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWID 61

Query: 466 IPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           IPITYR+G++ L T++KG  G D F +AI +W    +
Sbjct: 62  IPITYRNGRRALLTMEKGGTGTDAFNTAIKEWTALGD 98


>gi|118588313|ref|ZP_01545722.1| hypothetical protein SIAM614_23567 [Stappia aggregata IAM 12614]
 gi|118439019|gb|EAV45651.1| hypothetical protein SIAM614_23567 [Stappia aggregata IAM 12614]
          Length = 583

 Score =  160 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 79/582 (13%), Positives = 169/582 (29%), Gaps = 83/582 (14%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++++ + +LPEN    R  +Y  ARN++  +L++ +P L    +  +  +LE+A
Sbjct: 1   MADYYSILKKTIASLPENNGAARRSVYSRARNAIVNQLKAYEPPLAPSEITAEQLRLEEA 60

Query: 61  ILQVEKQNQ----------KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
           I +VE +              + T     +   P  +    E                + 
Sbjct: 61  IRKVEAEAARESLGLSPTVPKVETPAPAPQVSAPPVTPPQAEPAAEATTDVPAPQEPEAA 120

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
               +        K   +   +    + +       + +                  +  
Sbjct: 121 PAPTVETPDPSPLKETLSQAEALGTAASQAVHNAKEASDPSAAPVRQEPSFGGPAQAEPA 180

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM--- 227
                     +  + S+    H     K +   +   +  +    K    L         
Sbjct: 181 DDSLFEPTNGAAASVSVDQPYHGEETRKPKDEPAPKKSRDKRSKPKASDALRGDTSGSRT 240

Query: 228 -----------------------AIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSG 264
                                    G       +  + +        +     +  V + 
Sbjct: 241 VPIALAAAVLVLVLLGAGAYFLMPAGEQSVDSGNVPAASSSQTASDTEPVTDPEPPVSTA 300

Query: 265 IRPKITRRLLEDG-----------------------SEVDVGPSTIPVADFANTSNIAFK 301
                      D                         + D   +  P       S  +  
Sbjct: 301 AGEGEEPSKNTDRLLNEGETDVVAPDARTVTTTTITGQSDNSQADTPPETAPEPSQPSIV 360

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSG---------------- 345
                D           + E N                ++                    
Sbjct: 361 TSADSDPAPAATENPVAVPEDNLSAISPDDSAPAPSAAAAADPSVQRSILYEEGEESGGA 420

Query: 346 ------KILWSLQQEKSQGLKGLVI-KGDIPMIDNAFSASMTLKCNADISLSITHVMEIM 398
                  ++WS+++E +   K L +    + + +      + +K N D SL  +H++EI 
Sbjct: 421 GTAAQGAVVWSVEEETNLDGKALAVLSASVEIPERDVKVDIRIKPNDDTSLPASHLVEIK 480

Query: 399 FSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKI 457
           + FP+      VV++  + M+ T+ +    +      +S   + I+L     +  RN  +
Sbjct: 481 YEFPENFAPGDVVNVPGLVMKPTEEARGDALIGASVKVSPGFFWIALSSLPNEQQRNLAL 540

Query: 458 LEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWEN 499
           L E  +IDIP+ Y +G++ + T++KG  GAD  + AI  W+ 
Sbjct: 541 LRERGWIDIPMLYENGKRGILTLEKGTVGADAVEKAITAWQA 582


>gi|190893169|ref|YP_001979711.1| hypothetical protein RHECIAT_CH0003587 [Rhizobium etli CIAT 652]
 gi|190698448|gb|ACE92533.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 837

 Score =  154 bits (389), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 74/321 (23%), Positives = 131/321 (40%), Gaps = 18/321 (5%)

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
               S  +                          +                 +       
Sbjct: 512 SSAPSQATKNEAAMTPANSETPASPSTPPPAQPATPEAQNTPAAPAPAPAQPNQQVASLN 571

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK------------NYIGGD 307
           N  +    K T+RLL DG+EVD GP+ +P    A   ++A +                  
Sbjct: 572 NDGAAANSKFTQRLLSDGTEVDSGPAAVPGTPTAEGKSVAEQNVAAADTPAASAQGDAAR 631

Query: 308 ENSTFVLGKKEIEEGNPLIG--EGRVFINKGRGQ--SSILSGKILWSLQQEKSQGL-KGL 362
             +    G     +    +G  E      +  GQ   + + G ++WS+Q E  QG  +  
Sbjct: 632 PETLTPNGPAASPQQTAPVGSSEKMFLYEERIGQSSPTAIEGTVVWSVQHEAGQGGRQEA 691

Query: 363 VIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTD 421
            ++G+I + +   SA +T K N+D SL  +H++EI+FS P      ++  ++RISM++T+
Sbjct: 692 TVQGNITVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPPNFEGGSIDSVQRISMKRTE 751

Query: 422 NSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTID 481
                 + +    I+ + ++I+L    +    N  ++    +IDIPITYR+G++ L T+D
Sbjct: 752 QDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWIDIPITYRNGRRALLTMD 811

Query: 482 KGKKGADIFKSAIMQWENRSN 502
           KG  G D F +AI +W    +
Sbjct: 812 KGGTGTDAFNTAIKEWTALGD 832



 Score = 95.5 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/365 (14%), Positives = 108/365 (29%), Gaps = 1/365 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L   +       P+       +   EP   +  ++             +
Sbjct: 61  IREVEGEHSEALSLDEAAVAIAAPEPVEEHAAHAESEPAPVAQPAVDEPVDQADAEPAAA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS-VSPVAAIEHDKSRLRRGKLAGI 179
                      +    +                 + + V    + E +         +  
Sbjct: 121 EVVDEPDRVEPAAPQGAAEEVVAEDVEPAEPQPAEPALVEIPVSTETEAPPEPYWHPSHE 180

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
              P              +           S                     +  +    
Sbjct: 181 EEAPAEEWHAGEVREVAAEEVVSEHGGFEPSPAGHGYEQADEERADDQHPAEAEEVAAEP 240

Query: 240 GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
            ++      +      ++     +      + RL+E  ++ +     +  +  A     A
Sbjct: 241 ATVESHEPEDEAAYEPIESFQPVTRGIEHASNRLVEPVADFNRAQEFVEHSQEAPLQADA 300

Query: 300 FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
             ++                ++      +  +         +  +    +       + +
Sbjct: 301 AAHFDPVWTEPAAEAPAPAPKDAETEWADEELRQYSETAPVAADTSARAFEEVISSLEKI 360

Query: 360 KGLVI 364
               +
Sbjct: 361 APAAV 365


>gi|218671440|ref|ZP_03521110.1| hypothetical protein RetlG_07163 [Rhizobium etli GR56]
          Length = 400

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/283 (21%), Positives = 114/283 (40%), Gaps = 18/283 (6%)

Query: 204 SFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFS 263
           S   + S  +                  + +   +  +          +       N  +
Sbjct: 118 SSAPSQSTRNEAATTPAEPETPAQPSTPTPAEPATPEAQNTPPASAEPNQQVASLNNDGA 177

Query: 264 GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK------------NYIGGDENST 311
               K T+RLL DGSEVD GP+ +P    A   ++A +                    + 
Sbjct: 178 AANSKFTQRLLSDGSEVDSGPAAVPGTPTAEGKSVAEQNVAAADTPAASAQGDTARPETL 237

Query: 312 FVLGKKEIEEGNPLIG--EGRVFINKGRGQ--SSILSGKILWSLQQEKSQGL-KGLVIKG 366
              G     +    +G  E      +  GQ   + + G ++WS+Q E  QG  +   ++G
Sbjct: 238 TPNGSAASPQQAAPVGSSEKMFLYEERIGQSSPTAIEGTVVWSVQHEAGQGGRQEATVQG 297

Query: 367 DIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPS 425
           +I + +   SA +T K N+D SL  +H++EI+FS P      ++  ++RISM++T+    
Sbjct: 298 NITVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPPNFEGGSIDSVQRISMKRTEQDRG 357

Query: 426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPI 468
             + +    I+ + ++I+L    +    N  ++    +IDIPI
Sbjct: 358 DALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWIDIPI 400


>gi|170744870|ref|YP_001773525.1| hypothetical protein M446_6846 [Methylobacterium sp. 4-46]
 gi|168199144|gb|ACA21091.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 414

 Score =  154 bits (387), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 100/307 (32%), Gaps = 10/307 (3%)

Query: 201 GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
             ++      E          +            I   +          +          
Sbjct: 109 PPVALKLPEPERPRPVETAADLAPDDSPARQRPRIDVVRPKGDRSRLLRNGIVAAALAAV 168

Query: 261 VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN----IAFKNYIGGDENSTFVLGK 316
           + +      + R      +  +  +          S     +  +        +      
Sbjct: 169 IGAIAAAAWSLRDTPATVQSKISENAAERPPEPQDSKFADRVGGERAPAAPPVAAAAPPP 228

Query: 317 KEIEEGNPLIGEGRVFINKGRG---QSSILSGKILWSLQQEKSQGLKG--LVIKGDIPMI 371
                 +  I +      +  G        +G+++W L    +   +    V++      
Sbjct: 229 TRAGAPDITIAQRATLYEEAGGPNNGPRAAAGQVVWRLDAVNAGQGQPLQTVVRATAEAQ 288

Query: 372 DNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSN 431
           +   + +M ++ N D +L  +HV+E+ F+ P +    V D+  +  +  +++    +   
Sbjct: 289 EAGLTVAMVIRRNTDATLPASHVIELTFT-PTDPSRNVRDVGLLQFKDDESARGSPVSGL 347

Query: 432 IFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFK 491
              + +N +LI L   + D  RN+ ++    +ID+PI Y SG + + T +KG  G  + +
Sbjct: 348 PVPVRENIFLIGLSNLKGDIERNTDLMLRRNWIDLPIRYASGGRAILTFEKGSAGDRVMR 407

Query: 492 SAIMQWE 498
            A  QW+
Sbjct: 408 EAFEQWK 414



 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/261 (13%), Positives = 66/261 (25%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P+ R  +YE AR ++  +L S+ P L +E ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPDMREAVYERARAALTGQLRSLDPPLSEEDIDAERRSLDAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E +    +              +          P               KL     
Sbjct: 61  IGRLEDEFGAKVPEPAAAAAVPGEAPAAAVAPAAEPPPPSEPDLPEPGPPVALKLPEPER 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +            + + +   I                 VAA               + 
Sbjct: 121 PRPVETAADLAPDDSPARQRPRIDVVRPKGDRSRLLRNGIVAAALAAVIGAIAAAAWSLR 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P         N          S ++             +                   
Sbjct: 181 DTPATVQSKISENAAERPPEPQDSKFADRVGGERAPAAPPVAAAAPPPTRAGAPDITIAQ 240

Query: 241 SITHFLRRESLDGGNVDKKNV 261
             T +      + G       
Sbjct: 241 RATLYEEAGGPNNGPRAAAGQ 261


>gi|327190965|gb|EGE58019.1| hypothetical protein RHECNPAF_3500073 [Rhizobium etli CNPAF512]
          Length = 837

 Score =  152 bits (384), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/321 (22%), Positives = 131/321 (40%), Gaps = 18/321 (5%)

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
               S  +                          +                 +       
Sbjct: 512 SSAPSQATKNEAAMTPASSETPDSPSTPPPAQPATPEAQNTPAAPAPAPAQPNQQVASLN 571

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK------------NYIGGD 307
           N  +    K T+RLL DG+EVD GP+ +P    A   ++A +                  
Sbjct: 572 NDGAAANSKFTQRLLSDGTEVDSGPAAVPGTPTAEGKSVAEQNVAAADAPAASAQGDAAR 631

Query: 308 ENSTFVLGKKEIEEGNPLIG--EGRVFINKGRGQ--SSILSGKILWSLQQEKSQGL-KGL 362
             +    G     +    +G  E      +  GQ   + + G ++WS+Q E  QG  +  
Sbjct: 632 PETLTPNGPAASPQQTAPVGSSEKMFLYEERIGQSSPTAIEGTVVWSVQHEAGQGGRQEA 691

Query: 363 VIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTD 421
            ++G+I + +   SA +T K N+D SL  +H++EI+FS P      ++  ++RISM++T+
Sbjct: 692 TVQGNITVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPPNFEGGSIDSVQRISMKRTE 751

Query: 422 NSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTID 481
                 + +    I+ + ++I+L    +    N  ++    +IDIP+TYR+G++ L T+D
Sbjct: 752 QDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWIDIPVTYRNGRRALLTMD 811

Query: 482 KGKKGADIFKSAIMQWENRSN 502
           KG  G D F +AI +W    +
Sbjct: 812 KGGTGTDAFNTAIKEWTALGD 832



 Score = 97.0 bits (239), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 59/365 (16%), Positives = 114/365 (31%), Gaps = 1/365 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSI-LRSNKHKKLANIL 119
           I +VE ++ ++L   +       P+       +   EP   +  ++    ++        
Sbjct: 61  IREVEGEHSEALSLDEAAVAIAAPEPVEEHAAHGESEPAPVAQPAVDEPVDQADTEPPAA 120

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
            V  +       +P+  +  +      S   Q    + V    + E +         +  
Sbjct: 121 EVVDEPDRVEPAAPQEAAEEVVAEDVESAEPQPAEPAFVEIPVSTETEAPPEPYWHPSHE 180

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
              P              +           S                     +  +    
Sbjct: 181 EEAPAEEWHAGEVREVAAEELASEHGGFEPSPARHGYEQADEDRADEQHPAEAEEVAAEP 240

Query: 240 GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
            +I     +       ++     +      + RL+E  ++       +  +  A     A
Sbjct: 241 ATIESHEPKAEAAYEPIESFQPVTRGIEHASNRLVEPVADFSRAQEFVEHSQEAPLQADA 300

Query: 300 FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
             ++                ++      E  +         +  +    +       + +
Sbjct: 301 AAHFDPVWTEPAAEAPAPAPKDAETEWAEEELRQYSETAPVAADTSARAFEEVISSLEKI 360

Query: 360 KGLVI 364
               +
Sbjct: 361 APAAV 365


>gi|218462972|ref|ZP_03503063.1| hypothetical protein RetlK5_27598 [Rhizobium etli Kim 5]
          Length = 103

 Score =  152 bits (382), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 51/90 (56%)

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
           +RISM++T+      + +    I+ + ++I+L    +    N  ++    +IDIPITYR+
Sbjct: 9   QRISMKRTEQDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWIDIPITYRN 68

Query: 473 GQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           G++ L T++KG  G D F +AI +W    +
Sbjct: 69  GRRALLTMEKGGTGTDAFNTAIKEWTALGD 98


>gi|15889717|ref|NP_355398.1| hypothetical protein Atu2446 [Agrobacterium tumefaciens str. C58]
 gi|15157629|gb|AAK88183.1| conserved hypothetical Protein [Agrobacterium tumefaciens str. C58]
          Length = 778

 Score =  150 bits (377), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 78/451 (17%), Positives = 148/451 (32%), Gaps = 7/451 (1%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
           +      EQA  +       S +    D       +    + +  L     +        
Sbjct: 321 DEHRQVEEQAPKKAAVVEDFSSYFQDADIAIPPKDAPALPRADDDLFGEKAAAKDNKERT 380

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
               L  ++   G S +N   S +             +  +    +  S V A+      
Sbjct: 381 PWDDLDELIGYDGASSSNRQASDETPGIGAAAATPAYMVKKKPRRNYASVVLAVVGVALL 440

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
              G    +       +   + +   N   G                            G
Sbjct: 441 AGGGYAVWMNRDALNDMVGGLVSSAQNGGNGQTPPADTAQTQPST---PPATQQPPATNG 497

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
              S   +           S+ G    ++ +  G           +G  V     ++   
Sbjct: 498 QQQSTAPNNHQAQSHGDDGSVTGTKFTQRLMADGTERDEGPAAGANGQPVTAEGQSVYEQ 557

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKIL 348
           + A            G    T        +      G+      +  GQ   + + G + 
Sbjct: 558 NVAPPPAGTAPANNAGAPAGTPAGTPAAQQPAAAATGDRMFLYEEVLGQTVPTAIQGSVS 617

Query: 349 WSLQQEK-SQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-Q 406
           WSLQQE  ++G     ++G I +     SA +T K N D SL  +H++EI+FS       
Sbjct: 618 WSLQQENDAEGKPSPTVQGQITVPGRGLSALITFKRNTDPSLPASHLIEIVFSVSPGFEG 677

Query: 407 DAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDI 466
            A+  ++RI+M+ T+      + +    I+ + ++I+L    +    N ++L+   +IDI
Sbjct: 678 GAIDSVQRIAMKSTEQDRGNALIAVPAKITDDFHMIALNDFPDAMKTNLELLKSRNWIDI 737

Query: 467 PITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           P++YR+G++ L T+ KG  G   F  A+ +W
Sbjct: 738 PVSYRNGRRALLTLQKGNDGIAAFDKALSEW 768



 Score = 92.8 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 49/353 (13%), Positives = 101/353 (28%), Gaps = 7/353 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI++AVD L  NTPE R+ +Y+ AR++V R+LE+MKPR P+E+L RQ  KL+ A
Sbjct: 3   MADFVAVIRKAVDGLANNTPENRAKVYDKARSAVVRQLENMKPRPPEELLRRQIAKLDAA 62

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTS------KENIFLEPRLRSISSILRSNKHKK 114
           I +V+ +  ++L    +D           +        +        +   +       +
Sbjct: 63  IAEVDSEYAEALPALTEDDAFSPVAEETAASYEHQDAVDEPAAHAAEAEHDVEPEQPAHR 122

Query: 115 LANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
                    +   +    P        +      +   E            +D       
Sbjct: 123 EEAQHEPVYEEPASAEPEPVYEEPAHHDEPRHDAHASEEERHQGEREPEELYDAPEPAPV 182

Query: 175 KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS 234
               +         +    +     +    +    +        V       +       
Sbjct: 183 APVRVTPSHEEVGTYFTRTHEEPAHQPQDDYAEPETAPAPADDSVPSHWAQPVDEDDWRK 242

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
           + +++            + GN + +                + +            +  N
Sbjct: 243 LEEAQNHDARPAGEAHEETGNENGERPLVAGYA-AQHYQEPEVNFEPAPYEEHERREADN 301

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKI 347
               A   +             +++EE  P         +     + I     
Sbjct: 302 RFGPAAVEHAPAFGGRHDFDEHRQVEEQAPKKAAVVEDFSSYFQDADIAIPPK 354


>gi|328542555|ref|YP_004302664.1| hypothetical protein SL003B_0935 [polymorphum gilvum SL003B-26A1]
 gi|326412301|gb|ADZ69364.1| hypothetical protein SL003B_0935 [Polymorphum gilvum SL003B-26A1]
          Length = 588

 Score =  149 bits (376), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 67/452 (14%), Positives = 142/452 (31%), Gaps = 10/452 (2%)

Query: 56  KLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKL 115
            L  A+   EK    S    +  K++  P +          EP   + +      + +  
Sbjct: 133 PLGTAVRDAEKLGAASSRAVQSAKDAFSPDAEAGEASPPRREPTFGASTGPRAPVQPEPG 192

Query: 116 ANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGK 175
                   +  +         +   +    F      E              + R     
Sbjct: 193 PLSALTGPRDFSGDTRIRTADAGERKRSGDFGATAAPEEAPVAEEAKRPRRPQPRASDRG 252

Query: 176 LAGIFS-----FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
            A   +          I   +    +++   L   ++  S                    
Sbjct: 253 KASTLTSYVLLAGLVLIVIGIGAVVYSQRDTLSDLFAGDSSPPEVAVAPQAPEPAQAPAP 312

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
           V  +  +S+ S    L           +    + I P             DV  +  P  
Sbjct: 313 VEENGARSEKSTDRLLDDNGQPAAPDARSVTTTLITPTQPAGGTIVTPSGDVEATPAPTQ 372

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKG---RGQSSILSGKI 347
                + +                          ++ +  +   +G    G  +   G++
Sbjct: 373 PAPAPAPLEPPPAAEAPAVVPAPAAPTAEVAPETIVAQRSILYEEGEDASGSGTASQGRV 432

Query: 348 LWSLQQEK-SQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ 406
            WS+ +E  + G K  V+  +  + D   S ++ +K N D SL  +H++E+ F  P+   
Sbjct: 433 AWSVTEETDASGRKETVLAANAEIPDRNVSVTIRIKPNTDSSLPASHLVEVQFQLPEGFS 492

Query: 407 D-AVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFID 465
              V ++  + M+ T+ +    +      ++   + I+L   E +  RN  ++ E  +ID
Sbjct: 493 GRDVANVPGLVMKPTEEARGDALLGASVKVAPGYFWIALSSIESERERNIALMRERGWID 552

Query: 466 IPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           IPI Y +G++ + T++KG  G+   + A+  W
Sbjct: 553 IPILYDTGKRAILTLEKGTPGSRALEQAMTVW 584


>gi|304393310|ref|ZP_07375238.1| putative CheA signal transduction histidine kinase [Ahrensia sp.
           R2A130]
 gi|303294317|gb|EFL88689.1| putative CheA signal transduction histidine kinase [Ahrensia sp.
           R2A130]
          Length = 613

 Score =  149 bits (375), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 73/492 (14%), Positives = 164/492 (33%), Gaps = 11/492 (2%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P         +++ A+ + +  L  +     +            AI +   +       +
Sbjct: 120 PLPAEAAEQAVFDAAQEADSALLAPLDQVPEEVAAAFHEQV--DAIPEPADELPTVGRDA 177

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             D+   + ++     E +     + +       +     A+      ++   +  +P  
Sbjct: 178 AYDEIDTLSEAPHIPNEIVEAAEPVPAPQQPAERDALDDWASEFLSSQETAAASTETPPI 237

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                 E+   S  T    D      A             +A +          +     
Sbjct: 238 AGTPRPEVDVSSATTAAVVDPYDDATADFTPVYENDPAADIAPVVEAANIDFPDADTEEV 297

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
                  L   +A  +       +  ++++G+ IG       +K S+      +++    
Sbjct: 298 TIPPAAGLRPATAKRKSGGALKALIWLLMIGVLIGGGILAWLNKDSLMEVTGLDAMLSDT 357

Query: 256 VDKKNV------FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
           V    V                 +     E     + +      +  +            
Sbjct: 358 VTPTPVKTIPIAPDPEPVAEAEPVAPPVEEPVKSETRLTENGEVSGPDPVLPPTAEEAAE 417

Query: 310 STFVLGKKEIEEGNPLIGEGRVFINKG--RGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
           +T            P + +  +   +G     +S+  G+++WS+ QE   G +   I+  
Sbjct: 418 TTPEAPAATEPPATPAVSQSAILYEEGGSPADNSLDQGRVIWSVVQEDVNGKQEPAIRAR 477

Query: 368 IPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSV 426
             + D      MTLK NAD +L  +H++E++F+ P +    A+ ++ R  ++ ++     
Sbjct: 478 AEVPDRNLVLIMTLKRNADEALPASHLIELIFAVPDDFSGGAIEEINRFVLKDSEQGRGE 537

Query: 427 LIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKG 486
            +      I+   +LI+L   E    +N  +L++  +IDIP+ YR+G++ L T++KG  G
Sbjct: 538 GLVGVPAKIADGIFLIALNNLEAAVAQNETLLQQRGWIDIPMQYRTGRRALITLEKGIPG 597

Query: 487 ADIFKSAIMQWE 498
             +FK     W 
Sbjct: 598 DKVFKDVFAAWA 609



 Score = 70.8 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 37/311 (11%), Positives = 85/311 (27%), Gaps = 2/311 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  V+QR +    +  P+ R  +YE AR+++ R+L++  P +    L+ + +KLE+A
Sbjct: 1   MADYHAVLQRTLSGFSDPKPQLREKLYERARSTIERQLKARTPAVDDATLKGELDKLEEA 60

Query: 61  ILQVEKQNQ--KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
           I  +E   +   +   +    E         + E   L+P    I++     +       
Sbjct: 61  ITSIEGGYETNAAAEPAAPIVEEHAAGQVYAATEEPTLQPADAVIAAPFAEPEVDVPLAP 120

Query: 119 LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAG 178
           L  +   +   + + +  S  L  +          +   V  +     +   + R     
Sbjct: 121 LPAEAAEQAVFDAAQEADSALLAPLDQVPEEVAAAFHEQVDAIPEPADELPTVGRDAAYD 180

Query: 179 IFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKS 238
                + +           +        +       +            A   +  I  +
Sbjct: 181 EIDTLSEAPHIPNEIVEAAEPVPAPQQPAERDALDDWASEFLSSQETAAASTETPPIAGT 240

Query: 239 KGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
                      +    +                   +    V+      P AD    +  
Sbjct: 241 PRPEVDVSSATTAAVVDPYDDATADFTPVYENDPAADIAPVVEAANIDFPDADTEEVTIP 300

Query: 299 AFKNYIGGDEN 309
                      
Sbjct: 301 PAAGLRPATAK 311


>gi|86358941|ref|YP_470833.1| hypothetical protein RHE_CH03343 [Rhizobium etli CFN 42]
 gi|86283043|gb|ABC92106.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 828

 Score =  146 bits (368), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 90/520 (17%), Positives = 176/520 (33%), Gaps = 33/520 (6%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
            E   E  +   + A    A +             +      E  I  +EK    ++   
Sbjct: 304 AEPAVETPAPAPKDAETEWAEQELRQYSETAPVTADASARAFEDVISSLEKMTPAAVMPV 363

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISS--------ILRSNKHKKLANILSVQGKSRT 127
            ++  S    +            +   +SS            +           +G    
Sbjct: 364 AKEAFSWEKAAFDDLPPIEAGTDKKTPVSSHFDDVDIFAEVHDGKPTPPAGAPSEGWREA 423

Query: 128 NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                         +    +     +   +          + + RR  +  I +     I
Sbjct: 424 KALRGYDRRGPIATDDDDANPAMDIDQIVASKLQGKNFRMEPKRRRFGIGTIITLLFALI 483

Query: 188 FWSVHN-------YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                                 L   +                        + +   +  
Sbjct: 484 LIGGGAYAGWMNREALVAMVDGLVSSAPSQATRNEAAMTPAGSETPAQTTPTPAQPAAPE 543

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           +          +       N  +    K T+RLL DG+EVD GP+T+P    A   ++A 
Sbjct: 544 AQNTPPAPAQPNQQVASLNNDGAAANSKFTQRLLSDGTEVDSGPATVPGTPTAEGKSVAE 603

Query: 301 KN-------------YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR---GQSSILS 344
           +N                  E  T        ++  P+    ++F+ + R      + + 
Sbjct: 604 QNVAAADTPAASAQGDAAPPETLTPNGPAASPQQAAPVGSSEKMFLYEERIGQSSPTAIE 663

Query: 345 GKILWSLQQEKSQGL-KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK 403
           G ++WS+Q E  Q   +   I+G++ + +   SA +T K N+D SL  +H++EI+FS P 
Sbjct: 664 GTVVWSVQHEAGQNGRQEATIQGNVTVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPP 723

Query: 404 ES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYR 462
                ++  ++RISM++T+      + +    I+ + ++I+L    +    N  +L    
Sbjct: 724 NFEGGSIESVQRISMKRTEQDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLLSTRN 783

Query: 463 FIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           +IDIPITYR+G++ L T++KG  G + F +AI +W    +
Sbjct: 784 WIDIPITYRNGRRALLTMEKGGTGTNAFNTAIKEWTALGD 823



 Score = 84.7 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 52/364 (14%), Positives = 105/364 (28%), Gaps = 4/364 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L   +       P++                 +++        + +  +
Sbjct: 61  IREVEAEHSEALPLDEATDAGAAPETLEEQAVADESTSPPAPQTTVDEPAGEADVGSPTA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +   +        + +  E    +               + E           +   
Sbjct: 121 EATREPDHLEAD----ARQETEEEVAAEEPLSAEPEPEQTPVSAETAAPVETYWHPSHEE 176

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P              +                                 +  I     
Sbjct: 177 EAPAEEWHAGEARDVAAEEMQPEHHGFETPPADHSYEEADEHRADEQHPVAAEEIAAEPA 236

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                  +      +++     +      + RL+E  ++ D     +  +        A 
Sbjct: 237 MAESHEPKAEAAYESIESFQPITRGMEHASNRLVEPVADFDRAQEFVEHSREEPLQADAA 296

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
            ++                ++      E  +         +  +    +       + + 
Sbjct: 297 GHFDPVWAEPAVETPAPAPKDAETEWAEQELRQYSETAPVTADASARAFEDVISSLEKMT 356

Query: 361 GLVI 364
              +
Sbjct: 357 PAAV 360


>gi|325293797|ref|YP_004279661.1| hypothetical protein AGROH133_08313 [Agrobacterium sp. H13-3]
 gi|325061650|gb|ADY65341.1| hypothetical protein AGROH133_08313 [Agrobacterium sp. H13-3]
          Length = 767

 Score =  146 bits (367), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/447 (16%), Positives = 146/447 (32%), Gaps = 17/447 (3%)

Query: 69  QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
           +         K++ + +   +  E+  L    ++  ++ R++             +    
Sbjct: 315 EPRQTEDTAPKKAAVVEDFSSYFEDTDLAIPPKATPALPRADNDPFDDRASKDNKERTPW 374

Query: 129 TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            +L               + N      +  +  A +   K R     L            
Sbjct: 375 DDLDELIGYDGASSSSRATTNEMPALGAGAATPAYMVKKKPRRNYASLVLALVGAGLLAG 434

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +        +      S                       +  +   S       
Sbjct: 435 GGYALWLNRDALNDMVGGLVQSAQKDGGTQTPPANTAQTPTSTPPAAQQPPASGQQPTTS 494

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA--------- 299
            + +       +  S    K T+RLL DG+E D GP+             +         
Sbjct: 495 PT-NHQAQPHADDGSVTGTKFTQRLLADGTERDEGPAPGANGQPVTAEGQSVYEQNVAPP 553

Query: 300 ---FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQE 354
                               +         G+      +  GQ   + + G + WSLQQE
Sbjct: 554 PAGEAPANTAAGTPAGTPPAQPPAAAAAATGDRMFLYEEVLGQTVPTAIQGSVSWSLQQE 613

Query: 355 KSQGLKGLV-IKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDL 412
                +    ++G I +     SA +T K N D SL  +H++EI+FS        A+  +
Sbjct: 614 NDNEGRPSATVQGQITVPGRGLSALITFKRNTDPSLPASHLIEIVFSVSPGFEGGAIDSV 673

Query: 413 RRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS 472
           +RI+M+ T+      + +    I+ + ++I+L    +    N ++L+   +IDIP++YR+
Sbjct: 674 QRIAMKSTEQDRGNALIAVPAKITDDFHMIALNDFPDAMKTNLELLKSRNWIDIPVSYRN 733

Query: 473 GQKILFTIDKGKKGADIFKSAIMQWEN 499
           G++ L T+ KG  G   F +A+ +W  
Sbjct: 734 GRRALLTLQKGNDGIAAFDTALREWAA 760



 Score = 88.9 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 50/310 (16%), Positives = 90/310 (29%), Gaps = 5/310 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI++AVD L  NTPE R+ +Y+ AR++V R+LE+MKPR P+E+L RQ  KL+ A
Sbjct: 1   MADFVAVIRKAVDGLANNTPENRAKVYDKARSAVVRQLENMKPRPPEELLRRQIAKLDAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +V+ +  ++L   ++D         V +  +                   +       
Sbjct: 61  IAEVDSEYAEALPALEEDDAFSPVAEEVDAVYHP-----QDVAEEPAVHAAERYEPVEEE 115

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                  ++          + E  +       E   +       +H  +R          
Sbjct: 116 PAPVVPAHSEPVYPVQPEPVYEEPAREEEPLPEEPVAALIPHEEQHYGAREPEELYDAPE 175

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                 +  +                 A          V        A            
Sbjct: 176 PARVAPVHEAGPYEEAGTYFTRAHEEPAYQPEDERVDDVAPEAAAPHADDSVPPHWAQPV 235

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
               + + E     +V           +    ++   S        +         N   
Sbjct: 236 DEDDWRKLEEAQDEDVRPAAEAEVGHERDDHSVVAGYSAQHYQAPDVSFEPERRDGNEHA 295

Query: 301 KNYIGGDENS 310
                 D + 
Sbjct: 296 GYRAAADHDP 305


>gi|116253508|ref|YP_769346.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258156|emb|CAK09257.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 851

 Score =  144 bits (362), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 71/324 (21%), Positives = 134/324 (41%), Gaps = 18/324 (5%)

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
           +      +   A +              +  A   +     +  +        + +    
Sbjct: 523 SSAPSQATRNEAATAPDGSTTTPAQPSAVTPAQPTTPGAQNTPAAPAQPNSNPNPNPQVA 582

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN--------------TSNIAFKN 302
              N  +    K T+RLL DG+EVD GP+T+P    A                   A  +
Sbjct: 583 SMNNDGAAANSKFTQRLLTDGTEVDSGPATVPGTPTAEGKSVAEQNVAAADTPPASAQGD 642

Query: 303 YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQGL- 359
               D  +         +       +      +  GQ   + + G ++WS+Q E  Q   
Sbjct: 643 AAPADARTPNGPVASPPQTAPVGSSQKMFLYEERIGQSSPTAIEGSVVWSVQHEAGQDGR 702

Query: 360 KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMR 418
           +   ++G++ + +   SA +T K N+D SL  +H++EI+FS P      ++  ++RISM+
Sbjct: 703 QEATVQGNVTVPERNLSALVTFKRNSDPSLPASHLVEIVFSVPPNFEGGSIDSVQRISMK 762

Query: 419 KTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILF 478
           +T+      + +    I+ + ++I+L    +    N  ++    +IDIPITYR+G++ L 
Sbjct: 763 RTEQDRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRNWIDIPITYRNGRRALL 822

Query: 479 TIDKGKKGADIFKSAIMQWENRSN 502
           T++KG  G D F +AI +W    +
Sbjct: 823 TMEKGGTGTDAFNTAIKEWTALGD 846



 Score = 85.4 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 60/369 (16%), Positives = 110/369 (29%), Gaps = 9/369 (2%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ +++   +        +S          EP     +++             +
Sbjct: 61  IREVEGEHSEAMPLDESVVAVAAAESFEEQAVPDESEPAPAPETAVEEPAYEAYAEPQAA 120

Query: 121 VQGKSRTN---------TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL 171
                  +                       ++S   +   E   S     ++E      
Sbjct: 121 EVADEPDHVEAAAPEEAEEEVGSEEPLSQETLVSPEASVPAETPVSAETPVSLETSGPAE 180

Query: 172 RRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
                +     P      S       +                              +  
Sbjct: 181 TYWHPSQEEEAPAEEWHASEARDVAAEDVPAEHDGWEAPASEHRDEQADEDRADEQHLLE 240

Query: 232 SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD 291
           +  I     ++             V+     +      + RL+E  ++ D     +  + 
Sbjct: 241 ADEIADEPAAVGSEEPEAEEAYEPVEPLPPITRGIDHASNRLVEPVADFDRPQEFVEHSR 300

Query: 292 FANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL 351
                  A  ++                ++      E  +        + I +     + 
Sbjct: 301 EEPLQAEAAAHFDPVWTEPVAETPAPAPKDAETEWAEEELRQYSETAPAPITADASARAF 360

Query: 352 QQEKSQGLK 360
           ++  S   K
Sbjct: 361 EEVISSLEK 369


>gi|209550664|ref|YP_002282581.1| hypothetical protein Rleg2_3088 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536420|gb|ACI56355.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 836

 Score =  142 bits (356), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 134/320 (41%), Gaps = 19/320 (5%)

Query: 202 LLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNV 261
             +   A                   A   +        +      + + +       N 
Sbjct: 512 SSAPSQATRNEAATPPAGSATPAEPNAATPAQPATPGAQNTPAAPAQPNQNPQVASMNND 571

Query: 262 FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY---------------IGG 306
            +    K T+RLL DG+EVD GP+T+P    A   ++A +N                   
Sbjct: 572 GAAANSKFTQRLLTDGTEVDSGPATVPGTPTAEGKSVAEQNVAAADTPPAATAQGDVAPA 631

Query: 307 DENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQGL-KGLV 363
           +  +         +       +      +  GQ   + + G ++WS+Q E  Q   +   
Sbjct: 632 ETPTPNGPAASPQQTALVGSSQKMFLYEERIGQSSPTAIEGSVVWSVQHEAGQDGRQEAT 691

Query: 364 IKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDN 422
           ++G++ + +   SA +T K N+D SL  +H++EI+FS P      ++  ++RISM++T+ 
Sbjct: 692 VQGNVTVPERNLSALVTFKRNSDPSLPASHLVEIVFSLPPNFEGGSIDSVQRISMKRTEQ 751

Query: 423 SPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDK 482
                + +    I+ + ++I+L    +    N  ++    +IDIP+TYR+G++ L T++K
Sbjct: 752 DRGDALIAVPAKITDDFHMIALNDYPDARKANLDLMSTRSWIDIPVTYRNGRRALLTMEK 811

Query: 483 GKKGADIFKSAIMQWENRSN 502
           G  G D F +AI +W    +
Sbjct: 812 GNTGTDAFNTAIKEWTALGD 831



 Score = 89.3 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/338 (16%), Positives = 95/338 (28%), Gaps = 1/338 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L   +    +  P+ +     +   EP     + +              
Sbjct: 61  IREVEGEHAEALPLDEPVAAAVAPEFAEEQAVHDEGEPAPTPETIVEEPVYEASAEPQAV 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                  +   +       L +    S        S     A  + +             
Sbjct: 121 EAAAEPDHVEAAAPQEPQELADEEPLSEEAPSLPTSMAEATAPAQAETPAPAE-TYWHPS 179

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
               G                         E                    +        
Sbjct: 180 HEEEGPAEEWHSGERRGIAAEAWPADDERWETPAGHRNEEADEYHADEQHPAEETAPEPA 239

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           ++                    +      + RL+E  ++       +  +        A 
Sbjct: 240 AVESAEPEAVEAYEPAAPLEPITRGIEHASNRLVEPVADFARPQEFVEHSREEPLQADAA 299

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
            ++                ++      E  +       
Sbjct: 300 AHFDPVWTEPAAETPAPAPKDAETEWAEEELRQYSQTA 337



 Score = 41.5 bits (95), Expect = 0.37,   Method: Composition-based stats.
 Identities = 22/276 (7%), Positives = 61/276 (22%), Gaps = 6/276 (2%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRL------PKEILERQFNKLEQAILQVEK 66
           + LP + P   +   E A            P        P      +   +E A      
Sbjct: 70  EALPLDEPVAAAVAPEFAEEQAVHDEGEPAPTPETIVEEPVYEASAEPQAVEAAAEPDHV 129

Query: 67  QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
           +        +   E  + + + +   ++          +   +  +   ++      +  
Sbjct: 130 EAAAPQEPQELADEEPLSEEAPSLPTSMAEATAPAQAETPAPAETYWHPSHEEEGPAEEW 189

Query: 127 TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
            +             +   +     H  + +    A  +H          A   + P   
Sbjct: 190 HSGERRGIAAEAWPADDERWETPAGHRNEEADEYHADEQHPAEETAPEPAAVESAEPEAV 249

Query: 187 IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
             +         TRG+    + L E           +       +          +    
Sbjct: 250 EAYEPAAPLEPITRGIEHASNRLVEPVADFARPQEFVEHSREEPLQADAAAHFDPVWTEP 309

Query: 247 RRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
             E+      D +  ++    +   +      +   
Sbjct: 310 AAETPAPAPKDAETEWAEEELRQYSQTAPVTPDTSA 345


>gi|90418988|ref|ZP_01226899.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337068|gb|EAS50773.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 661

 Score =  140 bits (352), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/448 (12%), Positives = 142/448 (31%), Gaps = 12/448 (2%)

Query: 66  KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
           ++ +     +       +P                            +   +++     +
Sbjct: 214 EEPEGGARPAAVGAPFIVPSQESGRDGPAVAGTDDAHDDEDRLPAGIRSDDDLIPAADLT 273

Query: 126 RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
               +   +  S       + +          +     +  +  +      AG+ +  T 
Sbjct: 274 APRYSARQRRKSGGAGNRGAITAVAAVLILGGLGTAGWMYREDIQAMLVDPAGLETIATN 333

Query: 186 SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
           +   +      ++    ++     +E    +                    +     T  
Sbjct: 334 NADGTPAPTPTDEAGTGVAAVDPAAETPDAEGETAPETTTPARESTRQFTQRLLPDGTEV 393

Query: 246 LRRESLDGGNV-------DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
               +    N           +         +  +  +  E                +  
Sbjct: 394 DEGPAEVAPNAFDEGTNIAAASPVETPDLSGSPTVASEIGENPEVVGAPAETPAETAAET 453

Query: 299 AFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKS 356
                          +   +  E    + +  VF  +       +  SG ++WS+  E  
Sbjct: 454 PDAAPAEDAAAGETEVAAVDPSEDGVGVAQDAVFYQERTETVPGTQESGDVVWSVVNESP 513

Query: 357 --QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLR 413
                    I+ +  + D     +MT++ NAD +L  +HV+E++F+ P+     +V +++
Sbjct: 514 TEGQPPEPAIRAEAEIPDENLKMTMTIRRNADPTLPASHVIELLFTTPENFAGGSVANVQ 573

Query: 414 RISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSG 473
           R++++ ++ +    +      IS   ++I+L   E+    N  +L+  ++IDIPI Y SG
Sbjct: 574 RLALKPSEQARGEPLIGVAGKISDGFFIIALNNLEQAMQNNMALLQNEQWIDIPIAYASG 633

Query: 474 QKILFTIDKGKKGADIFKSAIMQWENRS 501
           ++ L +I+KG  G  +FK AI  W+ ++
Sbjct: 634 RRALMSIEKGVPGDRVFKEAIEAWKAKT 661



 Score = 70.0 bits (169), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 80/299 (26%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D   V+++ +D LP  TP+ R+ +YE AR ++ R++++  P L +E++  + + LE A
Sbjct: 1   MADLSGVLRKTIDGLPRATPQMRAKVYEKARAAIQRQIQAANPPLAEEVVAARQSALEDA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I + E+        +  D       ++  +           + +    S +    +++  
Sbjct: 61  IARTEQHYLDQGAEADGDAGEPAAAAAPLAAPVAAPPASAPADAPAAASKEMSPRSDLRP 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +                    I       +   D++         ++        +   
Sbjct: 121 SEPPRPQTPPAERPRAPQPDSRIEPSFDGGRPTADAAGGANTHSAWERETPATPTPSATK 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
               G+   S       K  G                       +G    V        G
Sbjct: 181 PQGAGAGAASPARPGPAKDAGRSDPPPFFPVSAEEPEGGARPAAVGAPFIVPSQESGRDG 240

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
                      D   +                     S      S       A T+  A
Sbjct: 241 PAVAGTDDAHDDEDRLPAGIRSDDDLIPAADLTAPRYSARQRRKSGGAGNRGAITAVAA 299


>gi|222086842|ref|YP_002545376.1| hypothetical protein Arad_3514 [Agrobacterium radiobacter K84]
 gi|221724290|gb|ACM27446.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 718

 Score =  140 bits (351), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 53/339 (15%), Positives = 111/339 (32%), Gaps = 7/339 (2%)

Query: 170 RLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAI 229
                      S  T S   +        +       +  +           +  L    
Sbjct: 373 SSAPKTATSTPSSDTASNNTAPATTPPAASPATTPAQNGNAAATPPAAGNTNVASLDNDP 432

Query: 230 GVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPV 289
               +    +         E    G          +  +                +    
Sbjct: 433 NTVNTKFTQRLLANGTEEDEGPAAGGQPGVAEGKSVAEQNVASAAPATGAAAAPATAPAG 492

Query: 290 ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI---GEGRVFINKGRGQ--SSILS 344
              A  +  +                +             G+      +  GQ   +   
Sbjct: 493 NADAAQATQSPAATAPAAPPPAAADQQASATPQQTAPVADGQKVFLYEERLGQTSPTAFE 552

Query: 345 GKILWSLQQEKSQGL-KGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPK 403
           G + WSLQ+ K         ++G I +     +A++T+  N D SL  +H++E+ F  P 
Sbjct: 553 GTVTWSLQEGKGADGRPEPSVQGLINVPQRGLTATITVSRNTDSSLPASHLVELAFQVPP 612

Query: 404 ES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYR 462
                A+ +++RI+++ T+      + +    ++ + Y+++L    +    N  +L+   
Sbjct: 613 NFEGGAIDNVQRIALKSTEQDRGDALIAVPAKVTDDVYMVALNDFPDARKTNLDLLKTRN 672

Query: 463 FIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRS 501
           +IDIP+ YR+G++ L T++KG  G+D F  AI +W+   
Sbjct: 673 WIDIPVVYRNGRRALLTMEKGPTGSDAFNKAIAEWQALG 711



 Score = 50.8 bits (119), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/258 (8%), Positives = 53/258 (20%), Gaps = 2/258 (0%)

Query: 49  ILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI--PKSSVTSKENIFLEPRLRSISSI 106
           +L RQ +KLE AI++VE ++ ++L  +++         +    +            +   
Sbjct: 1   MLRRQLDKLETAIVEVEAEHAEALPAAEEPVAEVPVVHEEPQAALPEEHHVEDEHVVEEP 60

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
             +         +     +        +         +   V  + E   +         
Sbjct: 61  EPAPAEVHAQEEVVAYVPAHEEPVHEEEPIHQEEPVHVQHEVVDEREPVEAWHDAPQEPE 120

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
             +                       +Y   +         A    H+       +I   
Sbjct: 121 PVAAHHAEAHVEPVEDYVEPAHEEPQHYAEEQPAVAAEPEPAPQRPHVIHSSADDVISQV 180

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST 286
             I         + +    +   +              +    T            G   
Sbjct: 181 EEIWAEVGTPSKQAAPEPVMPAAAFTPAPFGHPVEEPVVAKTPTADNGFAWDADVFGELQ 240

Query: 287 IPVADFANTSNIAFKNYI 304
              A           +  
Sbjct: 241 SAPAAKPVQPARQVPDNA 258


>gi|241206035|ref|YP_002977131.1| hypothetical protein Rleg_3345 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859925|gb|ACS57592.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 841

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 98/530 (18%), Positives = 179/530 (33%), Gaps = 29/530 (5%)

Query: 2   VDFILVIQRAVDNLPENTPERRSH--IYEHARNSVARRLESMKPRLPKEILERQFNKLEQ 59
             F  V    V   P   P+        E  R         +         E   + LE+
Sbjct: 307 AHFDPVWTEPVAETPAPAPKDAETEWAEEELRQYSETAPAPITADASARAFEEVISSLEK 366

Query: 60  AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
                     K   + +     D+P     S +   +      +      +  K      
Sbjct: 367 VAPAAIMPAAKESFSWETAAFDDLPPIEADSGKKTPVASHFDDVDIFAEVHNGKPAPASG 426

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE---HDKSRLRRGKL 176
           +     R    L   +    +      +  +        S +         K R      
Sbjct: 427 APSEDWREAKALRGYDRRGSVAADDDDANPSMDIDQIVASKLQGKSFRMEPKRRRFGIGT 486

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                F    I    +  + N+   +      +S                 +   +    
Sbjct: 487 VITLIFALILIGGGAYAGWTNREALVAMVDGLVSSAPSQATRNEAATPPDGSSTPAQPGA 546

Query: 237 KSKGSITHFLRRESLDGGNVDKKNVF------SGIRPKITRRLLEDGSEVDVGPSTIPVA 290
            +    T    + +          V       +    K T+RLL DG+EVD GP+T+P  
Sbjct: 547 VTPAQPTAPGAQNTPATPAQPNPQVASMNNDGAAANSKFTQRLLTDGTEVDSGPATVPGT 606

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG--------------EGRVFINKG 336
             A   ++A +N    D       G           G              +      + 
Sbjct: 607 PTAEGKSVAEQNVAAADTPPASAQGDAAPAATPTPNGAAASPPQAAPVGSSQKMFLYEER 666

Query: 337 RGQ--SSILSGKILWSLQQEKSQGL-KGLVIKGDIPMIDNAFSASMTLKCNADISLSITH 393
            GQ   + + G ++WS+Q E  QG  +   ++G++ + +   SA +T K N+D SL  +H
Sbjct: 667 IGQSSPTAIEGSVVWSVQHEAGQGGRQEATVQGNVTVPERNLSALVTFKRNSDPSLPASH 726

Query: 394 VMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPF 452
           ++EI+FS P      ++  ++RISM++T+      + +    I+ + ++I+L    +   
Sbjct: 727 LVEIVFSVPPNFEGGSIDSVQRISMKRTEQDRGDALIAVPAKITDDFHMIALNDYPDARK 786

Query: 453 RNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
            N  ++    +IDIPITYR+G++ L T++KG  G D F +AI +W    +
Sbjct: 787 ANLDLMSTRNWIDIPITYRNGRRALLTMEKGGTGTDAFNTAIKEWTALGD 836



 Score = 85.4 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/348 (15%), Positives = 99/348 (28%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ +++   +        +S      +   EP   +         + +     +
Sbjct: 61  IREVEGEHSEAMPLDEPVAAVTASESFEEQAVHDESEPAPETAVEEPAYEAYAEPQAAEA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
                        +       E             ++ +                 A  +
Sbjct: 121 ADEPDHVEAAAPQQAEEEVAAEEPLSQETLVSPETAAPAETPVSAETPVSPETSGPAETY 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P+         +  ++ R + +                                ++  
Sbjct: 181 WHPSHEEEAPAEEWHASEARDVAAEDVPAEHGGWEPPAAHRSEQADEDRADGQHALEADE 240

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                   ES +    +       ++P            V+         +F   S    
Sbjct: 241 IAAEPAAVESEEPEAEEAYEPVEPLQPITRGIDHASNRLVEPVADFDRPQEFVEHSREEP 300

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                                          +  +   Q S  +   +
Sbjct: 301 LQAEAAAHFDPVWTEPVAETPAPAPKDAETEWAEEELRQYSETAPAPI 348


>gi|150397813|ref|YP_001328280.1| hypothetical protein Smed_2615 [Sinorhizobium medicae WSM419]
 gi|150029328|gb|ABR61445.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 766

 Score =  138 bits (347), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 87/498 (17%), Positives = 174/498 (34%), Gaps = 26/498 (5%)

Query: 28  EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
           E A  S      + +P  P++            I  VE +  ++   S +   +      
Sbjct: 266 EDATPSARPSEVTAEPEAPRQDDVSPVEPERLGIHPVEPERAETEQQSGEADTARSWSFD 325

Query: 88  VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
            +       E +    +  +  ++                +   +  +    L      +
Sbjct: 326 DSDPFAQGTEVKKERPADEVEISEWSWPVEKSPAAAGQEEHAGTAWDHVGDLLGLDDGRT 385

Query: 148 VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
            N       + S +AA     +R    +     S  +                G  +++ 
Sbjct: 386 ANGSASQKDNDSSLAAPPAIPARPASYRTTPKPSRFSIKRLSIGVAVVLLLGAGGYAYWE 445

Query: 208 ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
                + +   +   I+ G       +             + +   G  D          
Sbjct: 446 NREAGNAWLSDMVAKIMPGEPAEAPATTAPG---QDDPADQPAGQSGAQDNAAQSDVNST 502

Query: 268 KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
           K T+RLL +G+E D GP+       +            G+  +T    ++          
Sbjct: 503 KFTQRLLANGTERDEGPAVANDTAASQEGKSVAARTHAGEPENTDAGLQQAAAGETASPA 562

Query: 328 EGRVFINK--------------------GRGQSSILSGKILWSLQQEKSQG--LKGLVIK 365
            G+                         G+   + + G + WS+++E   G       I+
Sbjct: 563 AGQAPSETAQPEVSVADGEKMFLYEERLGQSSPTAIPGAVAWSVKEESPGGDAKPEPAIQ 622

Query: 366 GDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSP 424
             I + D   +A +T+K NAD SL  +HV+E +FS P+     A+  ++R+SM++T+   
Sbjct: 623 AQITVPDRGLTALLTIKRNADPSLPASHVIEFVFSLPENFEGGAIDGVQRVSMKRTEQDR 682

Query: 425 SVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGK 484
              + +    I+ + ++I+L    E    N+++L    +IDIPITYR+G++ L T++KG+
Sbjct: 683 GDPLIAVPAKITDDFHMIALNDFAEAVSNNTELLRSRSWIDIPITYRNGRRALLTLEKGQ 742

Query: 485 KGADIFKSAIMQWENRSN 502
            GA+ F  A+  W    +
Sbjct: 743 SGAEAFNKALQAWSALGS 760



 Score = 89.7 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/364 (15%), Positives = 111/364 (30%), Gaps = 3/364 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI+R VD L ENTPE R  +YE AR +V R+LESM PR   +++ RQ NKLEQA
Sbjct: 1   MADFVAVIRRTVDGLSENTPEMRGRVYEKARGAVRRQLESMNPRPSDDMIGRQLNKLEQA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE +  ++L    + +  +   +     +          +     +   +      +
Sbjct: 61  ISEVEGEYAEALPPIDEAETLEPISAEELPTDEDSTPLPQEPVPDSAPAEAAEAEQPATA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +  ++   + +            +     E  ++     A   ++  +     A  +
Sbjct: 121 QLEEPSSDGGSAEEPEDRVEAVPDEETPAPGAETATADMREEAPVREEEPVEAAPAAPQW 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
             P      +       +         A     +              +     I  +  
Sbjct: 181 DAPIEEQAPAGEAETHAEYPAEEETAIAPGPQDISGDAAATHPSEPTPVEARTDIAGADD 240

Query: 241 SITHFLRRESLDGGNVDKK---NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
              H +  +   G     +     +    P      +    E        PV       +
Sbjct: 241 VPAHDVPTDDPLGKREPSEWALPEWEDATPSARPSEVTAEPEAPRQDDVSPVEPERLGIH 300

Query: 298 IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
                    ++ S      +     +         + K R    +   +  W +++  + 
Sbjct: 301 PVEPERAETEQQSGEADTARSWSFDDSDPFAQGTEVKKERPADEVEISEWSWPVEKSPAA 360

Query: 358 GLKG 361
             + 
Sbjct: 361 AGQE 364


>gi|227823296|ref|YP_002827268.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227342297|gb|ACP26515.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 787

 Score =  138 bits (347), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 87/490 (17%), Positives = 162/490 (33%), Gaps = 25/490 (5%)

Query: 38  LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTS----KEN 93
           L   +   P +       + ++A+ + E+     +            + +  +      +
Sbjct: 291 LPEWEDAPPSDPSPAPDARRDEAVPEPERLGLHPVEPETSQPAHRAGEETAQAWSFDDSD 350

Query: 94  IFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHE 153
            F  P           +  +    +      S                  L  +   ++ 
Sbjct: 351 PFAAPTEAKKDKAAEPDVSEWAWPVEKAPAASSEEERAGTAWNHIDDLLGLDDAGRRENG 410

Query: 154 YDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH 213
             +                  + A     P  S F +           LL         +
Sbjct: 411 TAAVAKDEDQSSDLAPAPVSPRPASYRVAPKPSRFNAKSLAIGALILLLLGGGGFAYWVN 470

Query: 214 LFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRL 273
                 +L  +L   I                  +     G  +   +      K T+RL
Sbjct: 471 REAGNAWLSAVLAKIIPAGSETQTPPTGEGAPADQPGEQPGTPEGTALPEDTSSKFTQRL 530

Query: 274 LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKK---------------- 317
           L DGSE D GP+     + A                S     ++                
Sbjct: 531 LADGSERDEGPAGANGTEIAQEGKSVAPQTEAAQPQSDAAGSQQAAAQTAQPPANQDGGA 590

Query: 318 EIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG--LKGLVIKGDIPMIDN 373
              E +   GE      +  GQ   + + G   WS+++E   G       I+  I + D 
Sbjct: 591 PQTEVSIADGEKMFLYEERLGQSSPTAVPGAAAWSIKEESPGGDAKPEPAIQAQITVPDR 650

Query: 374 AFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNI 432
             +A MT+K N D SL  +HV+E +FS P+     A+  ++R+SM++T+      + +  
Sbjct: 651 GLTALMTIKRNVDPSLPASHVIEFVFSLPENFEGGAIEGVQRVSMKRTEQDRGDPLIAVP 710

Query: 433 FVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKS 492
             I+ + ++I+L    E    N+++L    +IDIPITYR+G++ L T++KG  G + F  
Sbjct: 711 AKITDDFHMIALNDFAEAVGSNTELLRSRSWIDIPITYRNGRRALLTLEKGASGTEAFSK 770

Query: 493 AIMQWENRSN 502
           A+  W +  +
Sbjct: 771 AMQAWGSLGS 780



 Score = 87.8 bits (215), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 58/338 (17%), Positives = 99/338 (29%), Gaps = 3/338 (0%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI+R VD L ENTPE R  +YE AR++V R+LE+M PR   +++ RQ NKLE A
Sbjct: 6   MADFVAVIRRTVDGLSENTPEMRGRVYEKARSAVRRQLENMTPRPSDDMINRQLNKLELA 65

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKS---SVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
           I +VE ++ ++L   ++ +  +  ++   +   +    LEP      +   S        
Sbjct: 66  ITEVESEHAEALPAIEETEAPETAQALGKTEVLETTEVLEPEAVEAPAEPESAAPVSPEP 125

Query: 118 ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
           + +   +            +               E   +   V   + +          
Sbjct: 126 VPAEAAEVEQTAAEEHVEEAAPESRQTFEEPAPADEIAPAAEHVVPEQLEAEPTLEAASD 185

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                P   +          +            E                A+        
Sbjct: 186 EHPQEPPAVVEEPETIPAAPQWGAPAEPAPEEVETWQQAPVEETTAPEQHAVEAEEYERG 245

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
              +    +   S D     ++ V     P       +  S     P          +  
Sbjct: 246 EPAAEPEAVEPASPDVQGTLEEPVSEEAAPVEEAAPAKQDSSEWALPEWEDAPPSDPSPA 305

Query: 298 IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
              +      E     L   E E   P    G      
Sbjct: 306 PDARRDEAVPEPERLGLHPVEPETSQPAHRAGEETAQA 343


>gi|15966480|ref|NP_386833.1| hypothetical protein SMc00644 [Sinorhizobium meliloti 1021]
 gi|307300483|ref|ZP_07580263.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307318348|ref|ZP_07597783.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|15075751|emb|CAC47306.1| Hypothetical protein SMc00644 [Sinorhizobium meliloti 1021]
 gi|306896030|gb|EFN26781.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306904649|gb|EFN35233.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 753

 Score =  135 bits (338), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 80/494 (16%), Positives = 155/494 (31%), Gaps = 16/494 (3%)

Query: 20  PERRSHIYEHARNSVARRLESMKPRLPKEILER------QFNKLEQAILQVEKQNQKSLH 73
           PE           + A   +  +        ER      +  K E      E    +S  
Sbjct: 249 PEWEDTTPARPSETPAEPEDHRQDETSPAEPERLGIHPVEPEKAETQQQGGEADAARSWS 308

Query: 74  TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
               D  +   +       +               +  +++     +             
Sbjct: 309 FDDSDPFAQGTEGKKDRPADEPEISEWSWPVEKAPAAANQEERAGTAWDHVDDLLGFDDD 368

Query: 134 KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
              +           +          P +     K      K   I +     +    + 
Sbjct: 369 GRTANGPTSNKDKDSSLAAPPAVPARPTSYRTTPKPSRFSIKRLSIGAAVVLLLGAGGYA 428

Query: 194 YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
           Y+ N+  G       +++                +     +    +  I           
Sbjct: 429 YWQNREAGNAWLTGMVAKLMPGDPAEAPAPATPGSEAEPANRPAEQSGIEENAALSDAAS 488

Query: 254 GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI-----AFKNYIGGDE 308
               ++ +  G        +  + +    G S           N                
Sbjct: 489 TKFTQRLLADGTEMDEGPAVANETAASQEGKSVAARTHAVEPPNANAGVQQAAADQTASP 548

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ--SSILSGKILWSLQQEKSQG--LKGLVI 364
                  +    E +   GE      +  GQ   + + G + WS+++E   G       I
Sbjct: 549 GPGQAASEAAQPEVSVADGEKMFLYEERLGQSSPTAIPGTVAWSIKEESPGGDAKPEPAI 608

Query: 365 KGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNS 423
           +  I + D   +A MT+K NAD SL  +HV+E +FS P+     A+  ++R+SM++T+  
Sbjct: 609 QAQITVPDRGLTALMTIKRNADPSLPASHVIEFVFSLPESFEGGAIDGVQRVSMKRTEQD 668

Query: 424 PSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKG 483
               + +    I+ + ++I+L    E    N+++L    +IDIPITYR+G++ L T++KG
Sbjct: 669 RGDPLIAVPAKITDDFHMIALNDFAEAVSNNTELLRSRSWIDIPITYRNGRRALLTLEKG 728

Query: 484 KKGADIFKSAIMQW 497
           + GAD F  A+  W
Sbjct: 729 QGGADAFNKALQAW 742



 Score = 90.5 bits (222), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 44/350 (12%), Positives = 90/350 (25%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ VI+R VD L ENT E R  +YE AR +V R+LESM PR   +++ RQ NKLEQA
Sbjct: 1   MADFVAVIRRTVDGLSENTLEMRGRVYEKARGAVRRQLESMNPRPSDDMINRQLNKLEQA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L   ++ +  +         +         +    L +   +      +
Sbjct: 61  ISEVESEHAEALPPVEETEAIEPDTLEAPPSDEAATPVTQEAEPEALPAASVEAEQTAPT 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +  ++          +                      A +  ++       +    
Sbjct: 121 PVEEPASDAAPEEPEDLVQAAPYEEPPAPVAEAPTVDTREGAPLHDEEPVDAAPAVPQRD 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                    +  +         ++     S+                A     +      
Sbjct: 181 EPAEEQQPVAEADAQQEHPAEDVTAAGPDSQDVSRDEAEIETHPAEPAPMEVQAEDVPDR 240

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                      +     + +          +          +G   +             
Sbjct: 241 PGPSEWALPEWEDTTPARPSETPAEPEDHRQDETSPAEPERLGIHPVEPEKAETQQQGGE 300

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
            +              +  E       +               +      
Sbjct: 301 ADAARSWSFDDSDPFAQGTEGKKDRPADEPEISEWSWPVEKAPAAANQEE 350



 Score = 36.9 bits (83), Expect = 8.9,   Method: Composition-based stats.
 Identities = 8/205 (3%), Positives = 30/205 (14%)

Query: 169 SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
            +L               +          ++    +         +    +        A
Sbjct: 36  RQLESMNPRPSDDMINRQLNKLEQAISEVESEHAEALPPVEETEAIEPDTLEAPPSDEAA 95

Query: 229 IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
             V+                ++      +  +  +   P+   +                
Sbjct: 96  TPVTQEAEPEALPAASVEAEQTAPTPVEEPASDAAPEEPEDLVQAAPYEEPPAPVAEAPT 155

Query: 289 VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
           V           +               +E +       +                    
Sbjct: 156 VDTREGAPLHDEEPVDAAPAVPQRDEPAEEQQPVAEADAQQEHPAEDVTAAGPDSQDVSR 215

Query: 349 WSLQQEKSQGLKGLVIKGDIPMIDN 373
              + E        +      + D 
Sbjct: 216 DEAEIETHPAEPAPMEVQAEDVPDR 240


>gi|254473130|ref|ZP_05086528.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211957851|gb|EEA93053.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 592

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 66/483 (13%), Positives = 139/483 (28%), Gaps = 10/483 (2%)

Query: 20  PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDK 79
           P R       A+  V +        L     +      +Q     +++ +  L +  + +
Sbjct: 116 PAREEPKAPAAKADVFKEAVRAAQDLGNAAHQANQMARDQLPEASKERKEPDLGSMGESE 175

Query: 80  ESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCR 139
             +   S  T             +    R +K +        +                 
Sbjct: 176 PKEPAASLPTKGAVETSAEERAWVPGEARRSKLETKDKTARREIDEPAKVKPKTSRKPAS 235

Query: 140 LREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT 199
            R+ +                 +        +    +    +    S   ++ +      
Sbjct: 236 SRKPVVAQRVGDAIEQEEGLKPSNTSGIVGMIVIILIILGVTAGVYSQREAILSLILPAE 295

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
                     S        + +             +   +G+                  
Sbjct: 296 TSDTGEPE--SAPTGEDEPLRVQPERAPKKNTDRLLPSDEGAKVSPDATPVTTTRITRNS 353

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEI 319
           +  +         ++          S          +        G + NS         
Sbjct: 354 SSAAPTESAPAPTVVRSVDPAPATSSDDSSTPQVLPAKEPEPQTAGVETNSVPPAETIGT 413

Query: 320 EEGNPLIGEGRVFINKG---RGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFS 376
           E     + +  +   +        S   G ++W+L +         VIK    +     S
Sbjct: 414 ESEISPVAQQSILYEEALTPGAAGSASRGNVVWTLDEVNGT----SVIKAVATLPSRNLS 469

Query: 377 ASMTLKCNADISLSITHVMEIMFSFPKES-QDAVVDLRRISMRKTDNSPSVLIDSNIFVI 435
             MTLK N+D SL  +H++E+ F FP+      V  +  + ++KT++     +D     +
Sbjct: 470 VEMTLKPNSDQSLPASHLLELNFIFPEGFDGKGVEKVPGLILKKTESEAGDPLDGAAVKV 529

Query: 436 SKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIM 495
           S   + I+L  S E+  +N + L E  +ID+P+ Y SG++ + T +KG  G  +   AI 
Sbjct: 530 SDTLFWIALSDSNEEKAKNLQRLAEREWIDVPLLYNSGRRAMLTFEKGTTGNKVVAQAIK 589

Query: 496 QWE 498
            W+
Sbjct: 590 SWK 592



 Score = 84.7 bits (207), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/375 (11%), Positives = 99/375 (26%), Gaps = 4/375 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  V+++AV  L ENT   R  +Y+ ARN++ ++L+S  P L    +  +  KLE+A
Sbjct: 1   MADYNSVLKKAVAGLQENTGSARRAVYQRARNAIVKQLKSYDPPLSPSQITEEQLKLEEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE +  +      + K +  P +   +   +   P         +++   +      
Sbjct: 61  IRKVEAEAARESLGLGRSKTTPAPSAPQPTAPPVSAAPTPPPADDKPKADAKSEEPAREE 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +  +           + +     +   N         +     E D   +   +     
Sbjct: 121 PKAPAAKADVFKEAVRAAQDLGNAAHQANQMARDQLPEASKERKEPDLGSMGESEPKEPA 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +                   G        ++    +  +     +        +  +   
Sbjct: 181 ASLPTKGAVETSAEERAWVPGEARRSKLETKDKTARREIDEPAKVKPKTSRKPASSRKPV 240

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST----IPVADFANTS 296
                      + G              I   +L   + V          I  A+ ++T 
Sbjct: 241 VAQRVGDAIEQEEGLKPSNTSGIVGMIVIILIILGVTAGVYSQREAILSLILPAETSDTG 300

Query: 297 NIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
                     +          +      L  +    ++      +        S      
Sbjct: 301 EPESAPTGEDEPLRVQPERAPKKNTDRLLPSDEGAKVSPDATPVTTTRITRNSSSAAPTE 360

Query: 357 QGLKGLVIKGDIPMI 371
                 V++   P  
Sbjct: 361 SAPAPTVVRSVDPAP 375


>gi|217977190|ref|YP_002361337.1| hypothetical protein Msil_1006 [Methylocella silvestris BL2]
 gi|217502566|gb|ACK49975.1| hypothetical protein Msil_1006 [Methylocella silvestris BL2]
          Length = 634

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/435 (12%), Positives = 107/435 (24%), Gaps = 20/435 (4%)

Query: 85  KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREIL 144
                +         L     +  S          +            P   +    E L
Sbjct: 201 ARRDKTTPEPAPGAILPPRRPLGTSLLRMPPRVPAAPVAAPAPGFTPEPPPKAEPAPEPL 260

Query: 145 SFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLS 204
                   E           E +  R          +     +  +  + +        +
Sbjct: 261 PDQPAHGDENGWREPVFEPREAELRRWEMEGEPRWDAPAPAPLGEAPADEWARSDFAPPA 320

Query: 205 FYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG--------NV 256
             +                 +                     RR  L G           
Sbjct: 321 PEADAPARDEGGSDPASAAPIRPRAEAQRPFAPQPRREDAAPRRLWLVGFILGLLVFLVA 380

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPST--------IPVADFANTSNIAFKNYIGGDE 308
                      ++ +R        +  PS                + +            
Sbjct: 381 IAAYQLRDRPEELRQRAAAPLIIPEPAPSGKIVDRIGGGQNQPQDSAAGSPPATSPAPSS 440

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL--QQEKSQGLKGLVIKG 366
            +       E E  +       V   +   +     G + W +            + +  
Sbjct: 441 AARGAPTAVEPETQSARRAALLVEAPEEPNKVRTFLGAVNWKVDNVTSGPNDPLSMAVHA 500

Query: 367 DIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQ-DAVVDLRRISMRKTDNSPS 425
            + + +      MTL+ N D SL  +H M+I F    +S   +V  +    MR  D +  
Sbjct: 501 TVEIPEEKLEIVMTLQKNFDSSLPASHTMKIQFIEGADSPLGSVQQISVPQMRLEDTATG 560

Query: 426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKK 485
             ++     I+ N++L+ L     +   N  +L+   +ID+PI   +G+    T +KG  
Sbjct: 561 DALNGVPVQITDNTFLVGLTSGSPEAG-NLDLLKSRGWIDVPILLSNGKIAKLTFEKGPA 619

Query: 486 GADIFKSAIMQWENR 500
           G      AI  W+ +
Sbjct: 620 GDRAIDDAIAAWKGQ 634



 Score = 71.6 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 40/362 (11%), Positives = 75/362 (20%), Gaps = 18/362 (4%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RAV  L + TP+ RS IY+ ARN++  +L  + P +  E ++R+   LE A
Sbjct: 1   MADYYPLLARAVAGLADPTPQARSAIYDRARNALLGQLRRLDPPIADEEIDRESVALEDA 60

Query: 61  ILQVEKQNQK------------------SLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
           + ++E                            + D  +   + +V  + N    P   +
Sbjct: 61  VARLEADFTPKPPEAASPEPPPPEFHPPQPQPERADIAAAPIEPTVAERPNEPSAPHEIA 120

Query: 103 ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                        A     Q + +     +                +             
Sbjct: 121 GEPSFAGTPDAPHAPEAEPQAEPQERPPAAAAETPAPAASPPGEGADDNAAQKIKDDSAK 180

Query: 163 AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI 222
                           +F                          S L             
Sbjct: 181 PDFRAGRPSSLQTRPPMFFKARRDKTTPEPAPGAILPPRRPLGTSLLRMPPRVPAAPVAA 240

Query: 223 ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
              G           +   +         +G              +              
Sbjct: 241 PAPGFTPEPPPKAEPAPEPLPDQPAHGDENGWREPVFEPREAELRRWEMEGEPRWDAPAP 300

Query: 283 GPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
            P     AD    S+ A                            E +        +   
Sbjct: 301 APLGEAPADEWARSDFAPPAPEADAPARDEGGSDPASAAPIRPRAEAQRPFAPQPRREDA 360

Query: 343 LS 344
             
Sbjct: 361 AP 362


>gi|331265725|ref|YP_004325355.1| cell wall surface anchor family protein [Streptococcus oralis Uo5]
 gi|326682397|emb|CBZ00014.1| cell wall surface anchor family protein [Streptococcus oralis Uo5]
          Length = 2064

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/418 (8%), Positives = 93/418 (22%), Gaps = 33/418 (7%)

Query: 8    IQRAVD---NLPENTPERRSHIYEHARNSVARRLESMKPRL---PKEILERQFNKLEQAI 61
            + +A++       +  E +  + E A  ++A   E+          E    Q NKLE A 
Sbjct: 1618 LTKAIEKKVAELGSNKEAKKKLLEIADQAIAAIQEAKTQEAVNKALETALEQINKLEAAQ 1677

Query: 62   LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
             +   + +K +      +  +  +     +     +P   +        +        + 
Sbjct: 1678 PEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPEKPAQ 1737

Query: 122  QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
              K       +      +  +       TQ E  +        E      +  +      
Sbjct: 1738 PEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKPAE 1797

Query: 182  FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                +                 +     ++                A        ++   
Sbjct: 1798 PEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKPAQPEKPVQPETPAQ 1857

Query: 242  ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
                ++ E+        +        K  +      S          V    +   +   
Sbjct: 1858 PEKPVQPETPAQPEKPAQPETPAQPEKPAQPEKPITSSSPEEGVKDLVFTLPSLEIVNKV 1917

Query: 302  NYIGGDENSTFVLGKKEIE------------------------EGNPLIGEGRVFINKGR 337
                        L K + +                        +      + RV     +
Sbjct: 1918 VPFKTIRRENPQLDKGKEQVLSEGKDGLLVEYVEVDGDNRKILQTEATPAQDRVIEVGSK 1977

Query: 338  GQSSILSGKILWSLQQ---EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
              S       + +L +    +       V+  +    D     + T+K + +  L  T
Sbjct: 1978 QSSVGTEAPPVVTLPEYVLPRETEKPAPVVTNNSSSKDEKAPVTATIKEDKERRLPAT 2035


>gi|323450255|gb|EGB06137.1| hypothetical protein AURANDRAFT_65843 [Aureococcus anophagefferens]
          Length = 3712

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/349 (6%), Positives = 68/349 (19%), Gaps = 14/349 (4%)

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                T+ +  ++  P +           P     ++ + +               +  + 
Sbjct: 3067 APAPTAGEFVDAPAPTAGFVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVDA 3126

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                                T    D+     A ++               +    +   
Sbjct: 3127 PAPTAATVDAP-------APTAATVDAPAPTAATVDAPAPTAATVDAPSPTAATVDAPAP 3179

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
            +                 A +   +         +   A   +     +  + T      
Sbjct: 3180 TAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATIDAPAPTAATVDAPAP 3239

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +    +       +   P  T   ++  +                 +  A          
Sbjct: 3240 TAATVDAPAPTTATVDAPAPTAATVDAPAPTAATVDAPAPTASPVAAPTAATVDAPAPTA 3299

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK--GLVIKGD 367
            +T           +                S I    +  S+  + +         +   
Sbjct: 3300 ATVDAPAPTAATVDAPAPTDSDANVAAIVSSEITMENVTQSMVDDAATTSAVMSSALTEV 3359

Query: 368  IPMIDN-----AFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVD 411
            + M+D+       S ++  +   +          +    P +   A  D
Sbjct: 3360 LTMVDSEDDVGDVSLTLARRRRLEAGSVARATFTVTIDTPADYGFASAD 3408



 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/273 (5%), Positives = 50/273 (18%), Gaps = 11/273 (4%)

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
               +         + +   + T+       P   ++ +   +          +       
Sbjct: 3089 PAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAAT----- 3143

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                   +        +     T    D+     A ++               +    + 
Sbjct: 3144 ------VDAPAPTAATVDAPAPTAATVDAPSPTAATVDAPAPTAATVDAPAPTAATVDAP 3197

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
              +                 A +   +         +   A   +     +  + T    
Sbjct: 3198 APTAATVDAPAPTAATVDAPAPTAATIDAPAPTAATVDAPAPTAATVDAPAPTTATVDAP 3257

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
              +    +       +   P  T   +   +   V       A     +  A        
Sbjct: 3258 APTAATVDAPAPTAATVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVDAPAP 3317

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQS 340
             +S   +      E         +  +     +
Sbjct: 3318 TDSDANVAAIVSSEITMENVTQSMVDDAATTSA 3350



 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 15/326 (4%), Positives = 65/326 (19%), Gaps = 8/326 (2%)

Query: 41   MKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRL 100
            +    P              +         +   +    ++  P ++             
Sbjct: 3076 VDAPAPTAGFVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVD 3135

Query: 101  RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS---CRLREILSFSVNTQHEYDSS 157
                +    +     A  +     +    +      +          +            
Sbjct: 3136 APAPTAATVDAPAPTAATVDAPAPTAATVDAPSPTAATVDAPAPTAATVDAPAPTAATVD 3195

Query: 158  VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
                 A   D        +             +      +      +   A +       
Sbjct: 3196 APAPTAATVDAPAPTAATVDAPAPTAATIDAPAPTAATVDAPAPTAATVDAPAPTTATVD 3255

Query: 218  FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
                      A   + +   +       +   +    +       +   P  T   ++  
Sbjct: 3256 APAPTAATVDAPAPTAATVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVDAP 3315

Query: 278  SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE-----EGNPLIGEGRVF 332
            +  D   +   +     T     ++ +     ++ V+     E     +    +G+  + 
Sbjct: 3316 APTDSDANVAAIVSSEITMENVTQSMVDDAATTSAVMSSALTEVLTMVDSEDDVGDVSLT 3375

Query: 333  INKGRGQSSILSGKILWSLQQEKSQG 358
            + + R   +    +  +++  +    
Sbjct: 3376 LARRRRLEAGSVARATFTVTIDTPAD 3401



 Score = 99.3 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 17/315 (5%), Positives = 52/315 (16%), Gaps = 11/315 (3%)

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
                  T+ +  ++  P +     ++     +  +       +++      +  +  S  
Sbjct: 2993 APAPAPTAGEFVDAPAPTAGADCADSESWYKKGTTWKDCTWVSEYSPNRCTVVGEDDSLA 3052

Query: 128  NTNLSPK-----NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                          +                         A                 + 
Sbjct: 3053 EDACPAACDACDGVAPAPTAGEFVDAPAPTAGFVDAPAPTASPVAAPTAATVDAPAPTAA 3112

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
               +   +                 A +   +         +   A   +     S  + 
Sbjct: 3113 TVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPSPTAA 3172

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRL--LEDGSEVDVGPSTIPVADFANTSNIAF 300
            T      +    +       +   P  T         +   V       A     +  A 
Sbjct: 3173 TVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATIDAPAPTAA 3232

Query: 301  KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS---- 356
                     +T           +                +++ +     S     +    
Sbjct: 3233 TVDAPAPTAATVDAPAPTTATVDAPAPTAATVDAPAPTAATVDAPAPTASPVAAPTAATV 3292

Query: 357  QGLKGLVIKGDIPMI 371
                      D P  
Sbjct: 3293 DAPAPTAATVDAPAP 3307



 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/282 (6%), Positives = 50/282 (17%), Gaps = 29/282 (10%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A      + P   +   + A    A  +++  P                A          
Sbjct: 3098 APTAATVDAPAPTAATVD-APAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDA 3156

Query: 71   SLHTSKQDKESDIPK-----SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
               T+                + T+       P   ++ +   +          +     
Sbjct: 3157 PAPTAATVDAPSPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAAT--- 3213

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                                                 A   D        +         
Sbjct: 3214 --------------------VDAPAPTAATIDAPAPTAATVDAPAPTAATVDAPAPTTAT 3253

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                +      +      +   A +             +   A   +     +  + T  
Sbjct: 3254 VDAPAPTAATVDAPAPTAATVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATVD 3313

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI 287
                +    NV            +T+ +++D +      S+ 
Sbjct: 3314 APAPTDSDANVAAIVSSEITMENVTQSMVDDAATTSAVMSSA 3355



 Score = 50.4 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/198 (6%), Positives = 35/198 (17%), Gaps = 9/198 (4%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLES-MKPRLPKE---ILERQFNKLEQAILQV 64
               VD          +     A         + +    P                A    
Sbjct: 3161 AATVDAPSPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPT 3220

Query: 65   EKQNQKSLHTSKQDKESDI-----PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
                     T+                + T+       P   ++ +   +          
Sbjct: 3221 AATIDAPAPTAATVDAPAPTAATVDAPAPTTATVDAPAPTAATVDAPAPTAATVDAPAPT 3280

Query: 120  SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
            +    + T   +     +    +  + +  T      + S         S +    +   
Sbjct: 3281 ASPVAAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTDSDANVAAIVSSEITMENVTQS 3340

Query: 180  FSFPTGSIFWSVHNYFFN 197
                  +    + +    
Sbjct: 3341 MVDDAATTSAVMSSALTE 3358


>gi|296446632|ref|ZP_06888573.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296255860|gb|EFH02946.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 408

 Score =  111 bits (276), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/394 (13%), Positives = 110/394 (27%), Gaps = 4/394 (1%)

Query: 110 NKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKS 169
            +    +     +   +                 +        E  + V   A    ++ 
Sbjct: 16  PQSAPESRQAVYERARKALFKQLRSIQPPVAEGDIESEGRALDEAIARVELEAVRGGERP 75

Query: 170 RLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAI 229
             R+   A   S P                  +                           
Sbjct: 76  VERKEPPAPPPSAPLRVATERPAAPTPPPGEPVAPPPEIERSAEPPLREEGSTPSASQRP 135

Query: 230 GVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPV 289
                      S +  +   +     V        ++ +     L   +           
Sbjct: 136 AAPLPSLPEPTSNSRRILVIAGVLAAVVALVALLALQFRERPEDLAKLAPEPQTAEEPEE 195

Query: 290 ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILW 349
               +      +     +       G+K          E  V   +   +     G ++W
Sbjct: 196 GAKLSDRVGGAEPAAPAETGRAPDQGQKAQPVAVAQKAELWVAAPEEASKVKTFPGTVIW 255

Query: 350 SLQQEKSQGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSF-PKESQ 406
            L+   S   +     I+GDI +      A++ ++ N D +LS +H + + F F P    
Sbjct: 256 RLESLPSGAEQALTPAIRGDIDIPGAKMKAALVIQKNFDPALSASHTINVSFQFAPGGEL 315

Query: 407 DAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDI 466
             V  +  + MR+ +      I   +  I++N++L+ L     +  RN  +L     ID+
Sbjct: 316 KGVKTIAPLQMRRPEAQSGEQISGVLVPITENNFLLGLLPGNPE-ARNLTLLRAPLIIDL 374

Query: 467 PITYRSGQKILFTIDKGKKGADIFKSAIMQWENR 500
           P+   +G+     ++KG  G  +F  A+  W  +
Sbjct: 375 PMQLENGRAATIALEKGPAGERVFLDALDAWAGK 408



 Score = 70.0 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 33/244 (13%), Positives = 79/244 (32%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RAV +LP++ PE R  +YE AR ++ ++L S++P + +  +E +   L++A
Sbjct: 1   MADYYSLLSRAVASLPQSAPESRQAVYERARKALFKQLRSIQPPVAEGDIESEGRALDEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE +  +      + KE   P  S   +                 +   +   +   
Sbjct: 61  IARVELEAVRGGERPVERKEPPAPPPSAPLRVATERPAAPTPPPGEPVAPPPEIERSAEP 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +  +  + S +  +         S + +    + V            L+  +     
Sbjct: 121 PLREEGSTPSASQRPAAPLPSLPEPTSNSRRILVIAGVLAAVVALVALLALQFRERPEDL 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
           +        +       K    +      +     +          +A+     +  +  
Sbjct: 181 AKLAPEPQTAEEPEEGAKLSDRVGGAEPAAPAETGRAPDQGQKAQPVAVAQKAELWVAAP 240

Query: 241 SITH 244
               
Sbjct: 241 EEAS 244


>gi|160358754|sp|A2ASS6|TITIN_MOUSE RecName: Full=Titin; AltName: Full=Connectin
 gi|123232571|emb|CAM24262.1| titin [Mus musculus]
 gi|123232627|emb|CAM27059.1| titin [Mus musculus]
 gi|123232651|emb|CAM23449.1| titin [Mus musculus]
          Length = 35213

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/363 (7%), Positives = 74/363 (20%), Gaps = 11/363 (3%)

Query: 13    DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
             +  P   PE    +         ++L    P+ P+          + A   V ++     
Sbjct: 11809 EAPPVKVPEAPKKV------VPEKKLPVAAPKKPEAPAAEVPEVPKTA---VPQKKIPEA 11859

Query: 73    HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                K +            +     +      +           A   +V  +        
Sbjct: 11860 IPPKPESPPLEVPEVPPKEVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPK 11919

Query: 133   PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                 +      +  +V  +           A      ++++                +  
Sbjct: 11920 KAEAAPVPVPQVQETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEART 11979

Query: 193   NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                    +          E            +      V         ++     +E++ 
Sbjct: 11980 VPETVPEKTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIP 12039

Query: 253   GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK-NYIGGDENST 311
                   K   +   P    +         VGP   P A   +   +              
Sbjct: 12040 EKTRPPKKPEATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPP 12099

Query: 312   FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG-DIPM 370
                    + E  P          +    +  +       + ++K   +    ++   I +
Sbjct: 12100 KKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITV 12159

Query: 371   IDN 373
              + 
Sbjct: 12160 PEE 12162



 Score =  103 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/381 (8%), Positives = 93/381 (24%), Gaps = 27/381 (7%)

Query: 18    NTPERRSHIYEHARNSVARRLESMK-----PRLPKEILERQFN-------------KLEQ 59
               PE    +    + SV    +        P  PKE    +               K+ +
Sbjct: 11758 KVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPE 11817

Query: 60    AILQV--EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
             A  +V  EK+   +     +   +++P+   T+     +   +            +    
Sbjct: 11818 APKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEVPEVPPK 11877

Query: 118   ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
              ++ + K        P+    ++ E    +V  +   ++      A      +++     
Sbjct: 11878 EVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPKKAEAAPVPVPQVQETVPE 11937

Query: 178   GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                         +         + +       +     +       +      ++     
Sbjct: 11938 KTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEARTVPETVPEKTRPMAPPKKP 11997

Query: 238   SKGSITHFLRRESLDGGNVDKKNV----FSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
                ++     +E++               + +     +  + + +     P   PV    
Sbjct: 11998 EATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPPKKPEATPVPVPE 12057

Query: 294   NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                 +  K    G             E    +  + R      + +++ +   I    + 
Sbjct: 12058 VQETVPEKTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRP 12117

Query: 354   EKSQGLKGLVIKGDIPMIDNA 374
             E             +P+ +  
Sbjct: 12118 EAPPKRPEAT---TVPVPEAD 12135



 Score = 96.6 bits (238), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/436 (8%), Positives = 94/436 (21%), Gaps = 42/436 (9%)

Query: 20    PERRSHIYEHARNSVARRLESMK-----PRLPKEILERQFNKL---------EQAILQVE 65
             PE    ++     ++A   E        P  PKE++  +   +            + +  
Sbjct: 11732 PEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAP 11791

Query: 66    KQNQKS---------LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
             K+                +   K  + PK  V  K+     P+     +       K   
Sbjct: 11792 KEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAV 11851

Query: 117   NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
                 +           P        + ++          +          +  +    + 
Sbjct: 11852 PQKKIPEAIPPKPESPPLEVPEVPPKEVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEE 11911

Query: 177   AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                 + P  +    V      +T    +      +           +   +         
Sbjct: 11912 KTPEALPKKAEAAPVPVPQVQETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAP 11971

Query: 237   K-SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
                  + T               K   +   P    +         VGP   P A     
Sbjct: 11972 PKRPEARTVPETVPEKTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPV 12031

Query: 296   SNIAF--KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
               +           +            +         V   K    +++   ++  ++ +
Sbjct: 12032 PEVQETIPEKTRPPKKPEATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPE 12091

Query: 354   EKSQGLKGLVIKGDI---PMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVV 410
             +          +       + +         +  A         +      P+  Q  V 
Sbjct: 12092 KTRPAAPPKKPEATAVPETIPEK-------TRPEAPPKRPEATTV----PVPEADQAVVP 12140

Query: 411   D--LRRISMRKTDNSP 424
             +  + R+  +K +  P
Sbjct: 12141 EKKVPRVPPKKVEAPP 12156



 Score = 92.8 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/389 (5%), Positives = 69/389 (17%), Gaps = 11/389 (2%)

Query: 10    RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
             +  + LP+        + +       +      P+ P+          +    +   +  
Sbjct: 11912 KTPEALPKKAEAAPVPVPQVQETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAP 11971

Query: 70    KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                  ++   E+   K+   +         L          +  +          +    
Sbjct: 11972 PKRPEARTVPETVPEKTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPV 12031

Query: 130   NLSPKNFSC--RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                 +      R  +    +     E   +V           +     ++      T   
Sbjct: 12032 PEVQETIPEKTRPPKKPEATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPE 12091

Query: 188   FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                            +                     + +       + + K       +
Sbjct: 12092 KTRPAAPPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKK 12151

Query: 248   RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN-------IAF 300
              E+      ++       +        +  +     P         +           A 
Sbjct: 12152 VEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAP 12211

Query: 301   KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
                +           K  +                 +  +      +    + E      
Sbjct: 12212 PAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKV 12271

Query: 361   GLVIKGDIPMIDNAFSASMTLKCNADISL 389
                 K  +   +     +   K  A  + 
Sbjct: 12272 PEAPKKVV--PEKKLPVAAPKKPEAPAAE 12298



 Score = 90.8 bits (223), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/364 (8%), Positives = 84/364 (23%), Gaps = 12/364 (3%)

Query: 16    PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
              E TPE      +    +   + E   P++P+     Q   +E+   +   +  ++    
Sbjct: 11877 KEVTPE------KKVPAAPPTKPEIPPPKVPEAP---QAAVVEEKTPEALPKKAEAAPVP 11927

Query: 76    KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
                 +  +P+ +         E     +  + ++   K        + ++RT     P+ 
Sbjct: 11928 VPQVQETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEARTVPETVPEK 11987

Query: 136   FSC--RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                    ++  + ++      ++       +   K                         
Sbjct: 11988 TRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPPKK 12047

Query: 194   YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                          +   +                   V  +I +         + E+   
Sbjct: 12048 PEATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPPKKPEATAV 12107

Query: 254   GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV 313
                  +       PK          E D                +        +E    +
Sbjct: 12108 PETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVI 12167

Query: 314   LGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
               KK             V + +   +      + L   Q+ ++   K      ++ + + 
Sbjct: 12168 PEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEV-VPEK 12226

Query: 374   AFSA 377
               S 
Sbjct: 12227 KVSV 12230



 Score = 80.8 bits (197), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/458 (7%), Positives = 96/458 (20%), Gaps = 64/458 (13%)

Query: 8     IQRAVDNLP--ENTPERRSHIYEHARNSVARRLESMKPRL--PKEILERQFNKLEQAILQ 63
             I R    LP  E  PE    +    +    +  E +  ++    + +  +   LE+   +
Sbjct: 11636 ISRKKPELPSDEEVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEPPKK 11695

Query: 64    VEKQNQKSLHTSKQDKE-------------------SDIPKS------------------ 86
                +        K+                       + P+                   
Sbjct: 11696 PAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAP 11755

Query: 87    ---SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
                   + + +  E ++  +          K+          +       K       ++
Sbjct: 11756 PAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKV 11815

Query: 144   LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF------- 196
                      E    V+     E   + +       +                        
Sbjct: 11816 PEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEVPEVP 11875

Query: 197   --NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                 T       +  ++  +    V       +    +      K         +  +  
Sbjct: 11876 PKEVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPKKAEAAPVPVPQVQETV 11935

Query: 255   NVDKKNVFSGIRPKITRRLLE------DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                 + V    +P+ T   +               P   P A     +       +   +
Sbjct: 11936 PEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEARTVPETVPEKTRPMAPPK 11995

Query: 309   NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
                         +         V   K    +++   ++  ++ ++     K       +
Sbjct: 11996 KPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPPKKPEAT--PV 12053

Query: 369   PMIDNAFSASMTLKCNADISLSITHVM---EIMFSFPK 403
             P+ +   +     +            +   E+  + P+
Sbjct: 12054 PVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPE 12091



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 39/446 (8%), Positives = 106/446 (23%), Gaps = 63/446 (14%)

Query: 17    ENTPERRSHIYEHARNSVARRLESMKPRLPK----EILERQFNKLEQAI------LQVE- 65
             +  PE+R    +  +  +    E+ +   P+    E +  +   L   +        VE 
Sbjct: 11572 DVLPEKRPPASKRRKTQLPTAPEAPREMPPEMNTFEEISVEPEMLPTQVLDTYQEATVEK 11631

Query: 66    -----KQNQKSLHTSKQDKESD------------------------IPKSSVTSKENIFL 96
                   + +  L + ++  E+                          PK  V+ ++++  
Sbjct: 11632 KTLRISRKKPELPSDEEVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEE 11691

Query: 97    EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
              P+  ++  +    + K++     V           P        E+ S    T      
Sbjct: 11692 PPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQE 11751

Query: 157   SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
               +P A +      +   K   +          +       +         A  +     
Sbjct: 11752 PEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAP 11811

Query: 217   YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI------- 269
                       +       +   K           +    V +K +   I PK        
Sbjct: 11812 PVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEV 11871

Query: 270   ---------TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                        + +              V +    + +  K      + +          
Sbjct: 11872 PEVPPKEVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPKKAEAAPVPVPQV 11931

Query: 321   EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMT 380
             +         V   K    +++   K+  ++ ++          +    + +   +    
Sbjct: 11932 QETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEAR-TVPE---TVPEK 11987

Query: 381   LKCNADISLSITHVM---EIMFSFPK 403
              +  A         +   E+  + P+
Sbjct: 11988 TRPMAPPKKPEATTLPVPEVQETVPE 12013



 Score = 66.6 bits (160), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/294 (7%), Positives = 66/294 (22%), Gaps = 13/294 (4%)

Query: 10    RAVDNLPENTPERRSHIYEHAR-----NSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
             +  +      PE +  I E  R      +    +  ++  +P++       K  +A    
Sbjct: 12022 KKPEATTVPVPEVQETIPEKTRPPKKPEATPVPVPEVQETVPEKTRPVGPPKKPEATTVS 12081

Query: 65    EKQNQKSLHTSKQDKESDIPKSSVT-----SKENIFLEPRLRSISSILRSNKHKKLANIL 119
               + Q+++    +         +        ++     P  R  ++ +   +  +     
Sbjct: 12082 VPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPE 12141

Query: 120   SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR-RGKLAG 178
                 +       +P        + +              +       +            
Sbjct: 12142 KKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEET 12201

Query: 179   IFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKS 238
             +          +       +            +                A      +   
Sbjct: 12202 LAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPK 12261

Query: 239   KGSITHFLRRESLDGGNVDKK--NVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
             K      ++        V +K   V +  +P+     + +  +  V    IP A
Sbjct: 12262 KKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEA 12315



 Score = 65.4 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/372 (7%), Positives = 68/372 (18%), Gaps = 7/372 (1%)

Query: 10    RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE----QAILQVE 65
             +     P   PE  +      + ++  +     P    E         E    +A  +  
Sbjct: 12065 KTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRP 12124

Query: 66    KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
             +     +  + Q    +     V  K+       +      +   K   L          
Sbjct: 12125 EATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPP 12184

Query: 126   RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
              T      + FS     +               +P   +   K  +   K          
Sbjct: 12185 VTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVP 12244

Query: 186   SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                  +   +       V     L +A         ++      
Sbjct: 12245 EAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPK 12304

Query: 246   LRRESLDGGNV--DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                           K         +     +      +        A     +    K  
Sbjct: 12305 AAVPQKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPV 12364

Query: 304   IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                      V   +      P + +      K   +        +  + +E     K + 
Sbjct: 12365 PEKKAPPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKPEAPPAKVPEVPKEVVTEKK-VA 12423

Query: 364   IKGDIPMIDNAF 375
             +     +     
Sbjct: 12424 VPKKPEVPPAKV 12435



 Score = 60.0 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/400 (8%), Positives = 77/400 (19%), Gaps = 46/400 (11%)

Query: 10    RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
             +  +    + PE +  I E  R +   +       +P+ I E+      +A  +  +   
Sbjct: 12073 KKPEATTVSVPEVQETIPEKTRPAAPPKKPEATA-VPETIPEKTR---PEAPPKRPEATT 12128

Query: 70    KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
               +  + Q    +     V  K+       +      +   K   L           T  
Sbjct: 12129 VPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVP 12188

Query: 130   NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                 + FS     +               +P   +   K  +   K              
Sbjct: 12189 EAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPK 12248

Query: 190   SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                              +   +       V     L +A         ++          
Sbjct: 12249 EAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKAAVP 12308

Query: 250   SLDGGNV------------------------------------DKKNVFSGIRPKITRRL 273
                                                            V    +  +  + 
Sbjct: 12309 QKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPVPEKK 12368

Query: 274   LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFI 333
                       P    V +    +    K      E     +     E    ++ E +V +
Sbjct: 12369 APPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKPEAPPAKV----PEVPKEVVTEKKVAV 12424

Query: 334   NKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
              K          ++      E  +     V++        
Sbjct: 12425 PKKPEVPPAKVPEVPKKPVIE--EKPAIPVVEKVASPPAE 12462



 Score = 56.9 bits (135), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/307 (8%), Positives = 58/307 (18%), Gaps = 11/307 (3%)

Query: 8     IQRAVDNLPENTPERRSHIYEHARNSVA--RRLESMKPRLPKEILERQFNKLEQAILQVE 65
             IQ+ +  LP   PE    + E         R  + +   + K  ++ +    E  I    
Sbjct: 10701 IQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVTEPVAKVPMKPKRVVPEAKIPAPT 10760

Query: 66    KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
             K+    +      K+ ++ +  V  +E    E  +          +          + + 
Sbjct: 10761 KEVAVPVRVPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEEYVHEEEY 10820

Query: 126   RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                     +       E  + +            PV   +      +   +      P  
Sbjct: 10821 VHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKVPVVPKKPVPEEKKPVPVPKKKEAPPA 10880

Query: 186   SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS---------YSIG 236
              +              +     A            +                      + 
Sbjct: 10881 KVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPPAKVPEVP 10940

Query: 237   KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
             K                     K      +P    +      +    P            
Sbjct: 10941 KKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAPKKREVVP 11000

Query: 297   NIAFKNY 303
                    
Sbjct: 11001 VPVALPR 11007



 Score = 56.9 bits (135), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 29/307 (9%), Positives = 70/307 (22%), Gaps = 1/307 (0%)

Query: 27    YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEK-QNQKSLHTSKQDKESDIPK 85
              E A   + ++L+ + P+ P+E  +    K++ +I + EK Q  + +       +  +P+
Sbjct: 10694 EEKAPLPIQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVTEPVAKVPMKPKRVVPE 10753

Query: 86    SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILS 145
             + + +       P         R  +   +        +                     
Sbjct: 10754 AKIPAPTKEVAVPVRVPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEE 10813

Query: 146   FSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
             +    ++ +             +      +   +   P              K    +  
Sbjct: 10814 YVHEEEYVHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKVPVVPKKPVPEEKKPVPVPK 10873

Query: 206   YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
                     + +        + + I        +K                   K V    
Sbjct: 10874 KKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPP 10933

Query: 266   RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
                          +    P+   V           K  I  ++  T +L K E       
Sbjct: 10934 AKVPEVPKKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAP 10993

Query: 326   IGEGRVF 332
                  V 
Sbjct: 10994 KKREVVP 11000



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/334 (6%), Positives = 62/334 (18%), Gaps = 10/334 (2%)

Query: 5     ILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
             + V ++  + LPE  PE    I    + SV    E   P    E    +    E+A + +
Sbjct: 12562 VPVTKKT-EVLPEKVPEAPKKITPEKKESVPVPEEPEAPPASVEETPEETIYEEKATITI 12620

Query: 65    EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
              ++    +   + +K     +  +  +              ++   K K           
Sbjct: 12621 GRKETPPVEEREIEKFIQPEEPELEPEPEEIPVQEPEPEKKVIEKPKLKPRPPARPPSPP 12680

Query: 125   SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA---------AIEHDKSRLRRGK 175
                      +  +   +++       +    + +                  + +     
Sbjct: 12681 KEDVKEKMFQLKAVSKKKVPEKPEVVEKVEPAPLKVPTAEKKVRKLLPEPKPQPKEEVVL 12740

Query: 176   LAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSI 235
              + +   P                +         +                        I
Sbjct: 12741 KSVLRKKPEEEEPKVEPKKVEKAKKPEEPQPPPKAVEVEAPPEPTPKERKVPEPAKVPEI 12800

Query: 236   GKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
               +        + +        K          I   +                A     
Sbjct: 12801 KPAIPLPGPEPKPKPEPEVKTMKAPPIEPAPTPIAAPVTAPVVGKKAEAKPKDEAAKPKG 12860

Query: 296   SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
                           +     +       P     
Sbjct: 12861 PIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAP 12894



 Score = 51.2 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/434 (7%), Positives = 88/434 (20%), Gaps = 43/434 (9%)

Query: 5     ILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
              + I++  + L     E     +   ++  A       P      +    + L +     
Sbjct: 11524 YVTIRKTRETLALKESETTREAFPELKSYKAVPEIPEPPSPEDLEIIE--DVLPEKRPPA 11581

Query: 65    EKQNQKSLHTSKQDKESDIPK----SSVTSKENIFL----------------------EP 98
              K+ +  L T+ +      P+      ++ +  +                        +P
Sbjct: 11582 SKRRKTQLPTAPEAPREMPPEMNTFEEISVEPEMLPTQVLDTYQEATVEKKTLRISRKKP 11641

Query: 99    RLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSV 158
              L S   +  + +       +             P      + E  S     +      V
Sbjct: 11642 ELPSDEEVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEPPKKPAVRPV 11701

Query: 159   SPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGL-----------LSFYS 207
             +     +      +   +                   F++                    
Sbjct: 11702 TVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPE 11761

Query: 208   ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
             A  E    K    +      A          + +    +              V    + 
Sbjct: 11762 APKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKK 11821

Query: 268   KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
              +  + L   +          V +   T+    K              +        +  
Sbjct: 11822 VVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEVPEVPPKEVTP 11881

Query: 328   EGRVFIN----KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKC 383
             E +V              +        ++++  + L        +P+     +     + 
Sbjct: 11882 EKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPKKAEAAPVPVPQVQETVPEKTRP 11941

Query: 384   NADISLSITHVMEI 397
                        + +
Sbjct: 11942 VGPPKKPEATTVPV 11955



 Score = 48.5 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/373 (8%), Positives = 71/373 (19%), Gaps = 31/373 (8%)

Query: 21    ERRSHIYEHARNSVARRLESMKPRLPKEIL------ERQFNKLEQAILQVEKQN------ 68
             E    + + AR  VA+     +  + +E         R+   L+++    E         
Sbjct: 11494 EEHVTLPQKARLKVAKVPAPPQTVVTEEKTYVTIRKTRETLALKESETTREAFPELKSYK 11553

Query: 69    -----------------QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNK 111
                              +  L   +            T+ E     P   +    +    
Sbjct: 11554 AVPEIPEPPSPEDLEIIEDVLPEKRPPASKRRKTQLPTAPEAPREMPPEMNTFEEISVEP 11613

Query: 112   HKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL 171
                   +L    ++         +                 E  +    +     +   +
Sbjct: 11614 EMLPTQVLDTYQEATVEKKTLRISRKKPELPSDEEVPEAPREVVAKKKVLPPQVPEVVPV 11673

Query: 172   RRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
             +             S+                     + E  +            + +  
Sbjct: 11674 KVPGAPKEVVSERKSLEEPPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPE 11733

Query: 232   SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG--PSTIPV 289
             +     S+   T    +E         +     +  K    +     E      P     
Sbjct: 11734 APEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKE 11793

Query: 290   ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILW 349
             A       +A K              KK + E    +   +           +    +  
Sbjct: 11794 AAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQ 11853

Query: 350   SLQQEKSQGLKGL 362
                 E        
Sbjct: 11854 KKIPEAIPPKPES 11866



 Score = 43.5 bits (100), Expect = 0.078,   Method: Composition-based stats.
 Identities = 29/348 (8%), Positives = 71/348 (20%), Gaps = 3/348 (0%)

Query: 18    NTPERRSH-IYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
               PE     + E    +     + ++    K     +    E+       +  ++     
Sbjct: 10935 KVPEVPKKPVPEKKVPAPT--PKKVEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKA 10992

Query: 77    QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
               K   +P      +E    E     +       + +  +   +   +            
Sbjct: 10993 PKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEEVPSEEEAPPEEVPPEEEEVLPEE 11052

Query: 137   SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                L E        +       +               K           +   V     
Sbjct: 11053 EEVLPEEEEVLPEEEEVQPEEEALPEIKPKVPKPAPVPKKTVPEKKVPVPVPKKVEPPPP 11112

Query: 197   NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
              K   +             K       +  ++  V                    +    
Sbjct: 11113 PKVPEIKKKVPEKKVVVPKKEEAPPTKVPEVSKKVEERRIIPPKEEEVPPAEVYEEAEEP 11172

Query: 257   DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
               + +           ++E+  E +                 A        E     + K
Sbjct: 11173 TPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRAPEVVKKAVPEAPTPVPKKAEAPPAKVPK 11232

Query: 317   KEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
             K  EE  P+  + +        +   +  K +   ++E     KG  +
Sbjct: 11233 KIPEEKVPVPVQKKEAPPAKVPEKKKIPEKKVPVPKKEAVPPAKGKAV 11280



 Score = 43.5 bits (100), Expect = 0.083,   Method: Composition-based stats.
 Identities = 22/362 (6%), Positives = 74/362 (20%), Gaps = 13/362 (3%)

Query: 5     ILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRL----PKEILERQFNKLEQA 60
             + V ++  +  P   PE +  +    + ++  + E   P      PK+ +  +   + + 
Sbjct: 10246 VPVTKKK-EAPPAKVPEVQKKVVTEEKIAIITQREESPPPAVPEIPKKKVPEEKRPVPRK 10304

Query: 61    ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS-ILRSNKHKKLANIL 119
                   +       +  +     P            +  +               +   +
Sbjct: 10305 EEVPPPKVPVPPKKAVPEAVVPAPIPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRV 10364

Query: 120   SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
              +          S +     +        + +    +    +   E      +   ++  
Sbjct: 10365 ELMRHEEEEWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKMHFISKK 10424

Query: 180   FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
                    +              +             K      +       V  +    +
Sbjct: 10425 VEVEPAKVPEKKIIPKPKVPAKIEEPPPTKVPEPPKKIVPEKKVPAPAPKKVPPAKAPEE 10484

Query: 240   GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
                    +R   +   +++          +     E            P A         
Sbjct: 10485 SKRPVPEKRAPAEEVGIEEPPPTKVAERHMKITQEEKVLVAVTKKEAPPRARVPEEPKKV 10544

Query: 300   FKN-------YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
                           +E    V   ++       +            +   ++ +  WS  
Sbjct: 10545 APEERFPKLKPRREEEPPAKVTEVRKRAVKEEKVSIEVPKREPRPTKEVTVTEEKKWSYT 10604

Query: 353   QE 354
             +E
Sbjct: 10605 RE 10606



 Score = 43.5 bits (100), Expect = 0.085,   Method: Composition-based stats.
 Identities = 27/351 (7%), Positives = 73/351 (20%), Gaps = 11/351 (3%)

Query: 13    DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAIL--QVEKQNQK 70
             +  P   PE    +         ++L    P+ P+          + A+   ++ +    
Sbjct: 12265 EAPPVKVPEAPKKV------VPEKKLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEAIPP 12318

Query: 71    SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
                +   +   +  +  V  +                 +   KK                
Sbjct: 12319 KPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPVPEKKAPPAVVKKPE 12378

Query: 131   LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
               P       +E          + ++  + V  +  +    ++  +      P   +   
Sbjct: 12379 PPPAKVPEVPKEAPPEKKVPPKKPEAPPAKVPEVPKEVVTEKKVAVPKKPEVPPAKVPEV 12438

Query: 191   VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                    +   +       S           +         +    + +         E 
Sbjct: 12439 PKKPVIEEKPAIPVVEKVASPPAEVYEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPVPEE 12498

Query: 251   LDGGNVDKKNV---FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                   +KK          P     + +    V   P                K  +   
Sbjct: 12499 PKKVVPEKKFPVIKKPEAPPPKVPEVPKKAVPVKKVPVVKKPEPPEAEVPEVPKKLVPVK 12558

Query: 308   ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQG 358
             +    V  K E+          ++   K          +   +  +E  + 
Sbjct: 12559 KEPVPVTKKTEVLPEKVPEAPKKITPEKKESVPVPEEPEAPPASVEETPEE 12609



 Score = 43.5 bits (100), Expect = 0.086,   Method: Composition-based stats.
 Identities = 26/326 (7%), Positives = 79/326 (24%), Gaps = 8/326 (2%)

Query: 15    LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
             LP   PE        A   V ++ E+   ++PK+I E +     Q       +  +    
Sbjct: 11200 LPPRAPEVVKKAVPEAPTPVPKKAEAPPAKVPKKIPEEKVPVPVQKKEAPPAKVPEKKKI 11259

Query: 75    SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
              ++       ++   +K     E ++          + +    ++  + +         +
Sbjct: 11260 PEKKVPVPKKEAVPPAKGKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEEFHE 11319

Query: 135   NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
                    E            +        +E     +   +   +  +    I       
Sbjct: 11320 VQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKGPE 11379

Query: 195   FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE---SL 251
                K        + +         V  +    +      +  + K             + 
Sbjct: 11380 VSEKVIPPKKPPTKVIPRKEPPAKVPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITP 11439

Query: 252   DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD-----FANTSNIAFKNYIGG 306
             +    +       + P     + +   + +  P  +P         A+   +  + ++  
Sbjct: 11440 EEKVREAVPKKPEVPPPKVPEVPKKIIQEEKLPVVLPEDTEIYMYEASEETVIEEEHVTL 11499

Query: 307   DENSTFVLGKKEIEEGNPLIGEGRVF 332
              + +   + K        +  E    
Sbjct: 11500 PQKARLKVAKVPAPPQTVVTEEKTYV 11525



 Score = 40.8 bits (93), Expect = 0.53,   Method: Composition-based stats.
 Identities = 25/235 (10%), Positives = 66/235 (28%), Gaps = 2/235 (0%)

Query: 10    RAVDNLP-ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
             +AV        PE    + E A   V    + ++  LP+   + +   + +++L+ + + 
Sbjct: 12692 KAVSKKKVPEKPEVVEKV-EPAPLKVPTAEKKVRKLLPEPKPQPKEEVVLKSVLRKKPEE 12750

Query: 69    QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             ++     K+ +++  P+      + + +E          +  +  K+  I          
Sbjct: 12751 EEPKVEPKKVEKAKKPEEPQPPPKAVEVEAPPEPTPKERKVPEPAKVPEIKPAIPLPGPE 12810

Query: 129   TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                 P+     ++        T      +   V      K +    K  G          
Sbjct: 12811 PKPKPEPEVKTMKAPPIEPAPTPIAAPVTAPVVGKKAEAKPKDEAAKPKGPIKGVAKKTP 12870

Query: 189   WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
               +         G             ++     +  +     +  +  +S GS  
Sbjct: 12871 SPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSA 12925



 Score = 39.6 bits (90), Expect = 1.3,   Method: Composition-based stats.
 Identities = 39/395 (9%), Positives = 87/395 (22%), Gaps = 29/395 (7%)

Query: 8     IQRAVDNLPENTPERRSH-IYEHAR----------NSVARRLESMKPRLPKEILERQFNK 56
             I + V+      PE     + E  +           +  +  E+ K   P+E +     K
Sbjct: 10191 IPKKVEPPAAKVPEAPKKPVPEEKKPVPIPKKKEPAAPPQVPEAPKKPAPEEKIPVPVTK 10250

Query: 57    LEQAILQVEKQNQKSLHTSK------QDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
              ++A      + QK + T +      Q +ES  P      K+ +  E R       +   
Sbjct: 10251 KKEAPPAKVPEVQKKVVTEEKIAIITQREESPPPAVPEIPKKKVPEEKRPVPRKEEVPPP 10310

Query: 111   KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
             K          +              +   ++ +        E   SV+    +E  +  
Sbjct: 10311 KVPVPPKKAVPEAVVPAPIPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRHE 10370

Query: 171   LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
                   +      + S++                      E+ + +   F+   + +   
Sbjct: 10371 EEEWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKMHFISKKVEVEPA 10430

Query: 231   VSYSIGKSKGSITHF------LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                                    +       +  +       PK               P
Sbjct: 10431 KVPEKKIIPKPKVPAKIEEPPPTKVPEPPKKIVPEKKVPAPAPKKVPPAKAPEESKRPVP 10490

Query: 285   STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
                  A+                   T                  RV     +       
Sbjct: 10491 EKRAPAEEVGIEEPPPTKVAERHMKITQEEKVLVAVTKKEAPPRARVPEEPKKVAPEERF 10550

Query: 345   GKILWSLQQEKSQGLKGLVIKGD------IPMIDN 373
              K+    ++E    +  +  +        I +   
Sbjct: 10551 PKLKPRREEEPPAKVTEVRKRAVKEEKVSIEVPKR 10585



 Score = 39.2 bits (89), Expect = 1.6,   Method: Composition-based stats.
 Identities = 36/418 (8%), Positives = 84/418 (20%), Gaps = 46/418 (11%)

Query: 16    PENTPERRSHI--YEHARNSVAR-----------------RLESMKPRLPKEILERQFNK 56
                 PE    I   E  R +V +                 + E +   LP++     +  
Sbjct: 11427 APKAPEVPKKITPEEKVREAVPKKPEVPPPKVPEVPKKIIQEEKLPVVLPEDTEIYMYEA 11486

Query: 57    LEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKE------------NIFLEPRLRSIS 104
              E+ +++ E          K  K    P++ VT ++             +      R   
Sbjct: 11487 SEETVIEEEHVTLPQKARLKVAKVPAPPQTVVTEEKTYVTIRKTRETLALKESETTREAF 11546

Query: 105   SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
               L+S K                  ++ P+      +   +               +   
Sbjct: 11547 PELKSYKAVPEIPEPPSPEDLEIIEDVLPEKRPPASKRRKTQLPTAPEAPREMPPEMNTF 11606

Query: 165   EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
             E             + ++   ++          K           +   +      L   
Sbjct: 11607 EEISVEPEMLPTQVLDTYQEATVEKKTLRISRKKPELPSDEEVPEAPREVVAKKKVLPPQ 11666

Query: 225   LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
             +   + V       +         E      V    V    +  I  + +          
Sbjct: 11667 VPEVVPVKVPGAPKEVVSERKSLEEPPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAA 11726

Query: 285   STIPVADFANT-------------SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRV 331
               + V +                    A    +           K  +            
Sbjct: 11727 PPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAK 11786

Query: 332   FINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISL 389
                  +  +      +    + E          K  +   +     +   K  A  + 
Sbjct: 11787 VPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVV--PEKKLPVAAPKKPEAPAAE 11842



 Score = 39.2 bits (89), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/375 (6%), Positives = 86/375 (22%), Gaps = 27/375 (7%)

Query: 16    PENTPERRSH--IYEHARNSVARRLESMKPRLPKEILERQFN------------------ 55
             P   PE      + E  R     ++ + K     + +  +                    
Sbjct: 11401 PAKVPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITPEEKVREAVPKKPEVPPPKVPE 11460

Query: 56    -----KLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
                    E+ +  V  ++ +       ++     +     ++      ++ +    + + 
Sbjct: 11461 VPKKIIQEEKLPVVLPEDTEIYMYEASEETVIEEEHVTLPQKARLKVAKVPAPPQTVVTE 11520

Query: 111   KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
             +   +    + +  +   +  + + F           +      +        +   +  
Sbjct: 11521 EKTYVTIRKTRETLALKESETTREAFPELKSYKAVPEIPEPPSPEDLEIIEDVLPEKRPP 11580

Query: 171   LRRGKLAGIFSFPTGSIFWSVHNYFFNK--TRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
               + +   + + P            F +      +     L  +         + +    
Sbjct: 11581 ASKRRKTQLPTAPEAPREMPPEMNTFEEISVEPEMLPTQVLDTYQEATVEKKTLRISRKK 11640

Query: 229   IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
               +       +       +++ L     +   V     PK      +   E    P+  P
Sbjct: 11641 PELPSDEEVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEPPKKPAVRP 11700

Query: 289   VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
             V        +  +  +              + E    +            +      K+ 
Sbjct: 11701 VTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVP 11760

Query: 349   WSLQQEKSQGLKGLV 363
              + ++   +    +V
Sbjct: 11761 EAPKEVVPEKKVSVV 11775



 Score = 37.3 bits (84), Expect = 5.8,   Method: Composition-based stats.
 Identities = 18/257 (7%), Positives = 53/257 (20%), Gaps = 7/257 (2%)

Query: 4     FILVIQRAVDNLPE-NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAIL 62
              + V ++  +  P    PE    +    R    +     +P      + ++  K E    
Sbjct: 10523 LVAVTKK--EAPPRARVPEEPKKVAPEERFPKLKPRREEEPPAKVTEVRKRAVKEE---- 10576

Query: 63    QVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
             +V  +  K      ++      K    ++E   +              +  K        
Sbjct: 10577 KVSIEVPKREPRPTKEVTVTEEKKWSYTREEETVSEHREEEYEDYEDYEEYKEFEEYEPT 10636

Query: 123   GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
              +       + +            +   +             +      +  K A     
Sbjct: 10637 EEYDQYDEYAEREVEHYEEHEEYVTEPKKPVPVKPAQEPVPAKPKAPPPKVLKKAVPEEK 10696

Query: 183   PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                 I   +                   +  + K     +      + +       +  I
Sbjct: 10697 APLPIQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVTEPVAKVPMKPKRVVPEAKI 10756

Query: 243   THFLRRESLDGGNVDKK 259
                 +  ++        
Sbjct: 10757 PAPTKEVAVPVRVPGVP 10773


>gi|323137337|ref|ZP_08072415.1| hypothetical protein Met49242DRAFT_1803 [Methylocystis sp. ATCC
           49242]
 gi|322397324|gb|EFX99847.1| hypothetical protein Met49242DRAFT_1803 [Methylocystis sp. ATCC
           49242]
          Length = 413

 Score =  106 bits (264), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 55/400 (13%), Positives = 114/400 (28%), Gaps = 5/400 (1%)

Query: 102 SISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPV 161
           S      +   + +         ++      P   +    E  +           + +  
Sbjct: 13  SALPQPTTEARQAVYERARKALVNQLRNIQPPVAEADIAAEGRALEEAITRLEIETAAKG 72

Query: 162 AAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFL 221
           A      ++        +    T             K        +A     L       
Sbjct: 73  AQALSPGAQPSPQPAPSMKREATPPPAAPARPPEPPKAPAPPRDENAAWRETLAAAEKAP 132

Query: 222 IILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVD 281
           I                       L    +   +     +   +     +          
Sbjct: 133 IENDSHPREPQRPAAPLPLPPAPQLASRRIIAVSAVLVALIGVVGVLAWQLRERPEDLAK 192

Query: 282 VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ-S 340
           + P     A+ A       +   G    +    GK+          E  V   +   +  
Sbjct: 193 LKPEETKTAENAEAGKFDDRVDGGAKSAAPAASGKRASNLPVAQRAEMWVASLQEPAKVD 252

Query: 341 SILSGKILWSLQQEKSQGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIM 398
            I +  ++W L+       +     I+GD+ + D     ++  + N D +LS +H + + 
Sbjct: 253 KIYNANVVWRLENVGGGPGEPVGSAIRGDVDIPDAKLKLTLLFRKNTDTALSASHTINVT 312

Query: 399 FSFPKESQ-DAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKI 457
           F+    S    V  +  I MR+ D      +      I++N++LI L   + +  RN  +
Sbjct: 313 FTPAPGSPVGGVKAIGPIQMRRVDAQSGEKVAGIPVPITENNFLIGLMRGDRE-QRNVTL 371

Query: 458 LEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQW 497
           L     +D+P+ +  G+     ++KG  G  +F  AI  W
Sbjct: 372 LRSLPLLDLPMQFNDGRAATINMEKGATGERVFADAIDAW 411



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/249 (11%), Positives = 65/249 (26%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  +I RA+  LP+ T E R  +YE AR ++  +L +++P + +  +  +   LE+A
Sbjct: 1   MADYYSLISRAISALPQPTTEARQAVYERARKALVNQLRNIQPPVAEADIAAEGRALEEA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E +       +        P+ + + K      P   +                 +
Sbjct: 61  ITRLEIETAAKGAQALSPGAQPSPQPAPSMKREATPPPAAPARPPEPPKAPAPPRDENAA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +           +N S         +           S              G +  + 
Sbjct: 121 WRETLAAAEKAPIENDSHPREPQRPAAPLPLPPAPQLASRRIIAVSAVLVALIGVVGVLA 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
                                  +      +              G          +++ 
Sbjct: 181 WQLRERPEDLAKLKPEETKTAENAEAGKFDDRVDGGAKSAAPAASGKRASNLPVAQRAEM 240

Query: 241 SITHFLRRE 249
            +       
Sbjct: 241 WVASLQEPA 249


>gi|293364235|ref|ZP_06610961.1| alpha-L-fucosidase [Streptococcus oralis ATCC 35037]
 gi|291317081|gb|EFE57508.1| alpha-L-fucosidase [Streptococcus oralis ATCC 35037]
          Length = 2031

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/388 (6%), Positives = 87/388 (22%), Gaps = 3/388 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            + +A++         +    +    +        + +  + + +     LEQ       Q
Sbjct: 1615 LAKAIEKKVAELGSNKEAKKQLLAIADQAIAAIQEAKTQEAVNKALETALEQISKLEAAQ 1674

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +K        +     +    ++     +P   +        +        +   K   
Sbjct: 1675 PEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQ 1734

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +      +  +        Q E  +     A  E      +  +          + 
Sbjct: 1735 PETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQ 1794

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                            +     ++                A   + +  +         +
Sbjct: 1795 PEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQ 1854

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             E     +  ++ V   +    +  ++             P  D      ++        
Sbjct: 1855 PEKPITSSSPEEGVKDLVFTLPSLEIVNKVVPFKTIRHENPQLDKGKEHVLSEGKDGLLV 1914

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ---EKSQGLKGLVI 364
            E        +++ +      + RV     +  S       + +L +    +        +
Sbjct: 1915 EYVEVDGDNRKVLQTEATPAQDRVIEVGSKQSSVGTEAPPVVTLPEYVLPRETEKPTPAV 1974

Query: 365  KGDIPMIDNAFSASMTLKCNADISLSIT 392
              +    D     + T+K + +  L  T
Sbjct: 1975 TDNSSAKDEKAPVTATVKEDKERELPAT 2002


>gi|194209578|ref|XP_001915278.1| PREDICTED: similar to piccolo [Equus caballus]
          Length = 5117

 Score =  100 bits (248), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/380 (6%), Positives = 68/380 (17%), Gaps = 4/380 (1%)

Query: 10  RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLP-KEILERQFNKLEQAIL--QVEK 66
           ++V +      + +    E     + +  ++ + +LP +    R   K    +    V+ 
Sbjct: 189 KSVSSQQPEKIKSQPPGTEKPIQGLTQSPQTDQAKLPLQRDAARPQTKQSDTVRGESVKA 248

Query: 67  QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
             Q     + Q      P +     E +       +  S  +    K  A        S 
Sbjct: 249 SVQSPFKPTLQQASPAKPPAQQPGPEKLSTPQPGPAKPSTQQPGPTKAPAQPPGPAKPSP 308

Query: 127 TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
           T              +  +     +          +  +         +  G    P   
Sbjct: 309 TQPAAKLPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQ 368

Query: 187 IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
              +                   ++    +               +              
Sbjct: 369 PGPAKPAPQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQ 428

Query: 247 RRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPS-TIPVADFANTSNIAFKNYIG 305
                              +P   +   +        P    P                 
Sbjct: 429 PGPVKAPPQQPGPAKAPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPPPQQPGPVKAPPQQ 488

Query: 306 GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                         +      G  +    +           I    +    + L+     
Sbjct: 489 PGPAKPPPQQPGPAKPAPQQPGPAKPTPQQPGPAKVSDQQAIKPVSRTGAGKPLQPPTSP 548

Query: 366 GDIPMIDNAFSASMTLKCNA 385
             +         ++   CN 
Sbjct: 549 SAVQTPVQGLPKTICPLCNT 568



 Score = 87.0 bits (213), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/337 (7%), Positives = 66/337 (19%), Gaps = 9/337 (2%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
           +++   +   P+ I++    +  + I + +   +  L      K     +      +   
Sbjct: 146 QKIAQKEQGKPEGIVKPPQQQSPKPIPKQQGPVRAPLQHDGSLKSVSSQQPEKIKSQPPG 205

Query: 96  LEPR----LRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQ 151
            E       +S  +       ++ A     +            +     +  L  +   +
Sbjct: 206 TEKPIQGLTQSPQTDQAKLPLQRDAARPQTKQSDTVRGESVKASVQSPFKPTLQQASPAK 265

Query: 152 HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                      +           +  G    P      +  +      +      +    
Sbjct: 266 PPAQQPGPEKLSTPQPGPAKPSTQQPGPTKAPAQPPGPAKPSPTQPAAKLPAQPPATTKP 325

Query: 212 HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR---RESLDGGNVDKKNVFSGIRPK 268
                         G A   +   G +K +              G            +P 
Sbjct: 326 ATQQPRPKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQPGPAKPAPQQPGPAKPP 385

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP--LI 326
             +      +    GP+  P            +              K   ++  P    
Sbjct: 386 PQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAP 445

Query: 327 GEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
            +          Q              +      G V
Sbjct: 446 PQQPGPAKPAPQQPGPAKPPPQQPGPAKPPPQQPGPV 482



 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/298 (6%), Positives = 50/298 (16%), Gaps = 3/298 (1%)

Query: 66  KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
            Q + +       KE   P+  V   +    +P  +    +    +H      +S Q   
Sbjct: 138 SQEETTKKQKIAQKEQGKPEGIVKPPQQQSPKPIPKQQGPVRAPLQHDGSLKSVSSQQPE 197

Query: 126 RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
           +  +         +       +   +       +     + D  R    K +    F   
Sbjct: 198 KIKSQPPGTEKPIQGLTQSPQTDQAKLPLQRDAARPQTKQSDTVRGESVKASVQSPFKPT 257

Query: 186 SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
               S       +                               G +        +    
Sbjct: 258 LQQASPAKPPAQQPGPEKLSTPQPGPAKPSTQQPGPTKAPAQPPGPAKPSPTQPAAKLPA 317

Query: 246 LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +        +       P   +   +   +     +       A            
Sbjct: 318 QPPATTKPATQQPRPKSPAQPPGPAKSPAQ---QPGPAKAASQQPGPAKPPPQQPGPAKP 374

Query: 306 GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
             +         +         +          Q              +      G V
Sbjct: 375 APQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPV 432



 Score = 66.6 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 27/417 (6%), Positives = 71/417 (17%), Gaps = 44/417 (10%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
             +P +     +           + +   P +   +Q    + A  Q             
Sbjct: 332 PKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQPGPAKPAPQQPGPAKPPPQQPGP 391

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
               S  P  +    +               +    +        Q              
Sbjct: 392 AKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAPPQQPGP 451

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
           +    +        +             +         +  G    P      +      
Sbjct: 452 AKPAPQQP---GPAKPPPQQPGPAKPPPQQPGPVKAPPQQPGPAKPPPQQPGPAKPAPQQ 508

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
                        ++    +    +            +   +  +    L +      N 
Sbjct: 509 PGPAKPTPQQPGPAKVSDQQAIKPVSRTGAGKPLQPPTSPSAVQTPVQGLPKTICPLCNT 568

Query: 257 DKKNVFSGI---------------------------------------RPKITRRLLEDG 277
            +  +                                           +  +   L    
Sbjct: 569 TELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEIKEWLCLNCQMQRALGGDLASIA 628

Query: 278 SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR 337
           S     P T P       S  + ++     +  T           +              
Sbjct: 629 SSPQPKPKTGPAIPKTGVSKPSPQSQQISPKKDTAPKQDISKAPESKTPPPPVKQPALHG 688

Query: 338 GQSSILSGKILWSLQQEKSQGLKG--LVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
               +     +     + +   +      +  IPM D+      T+K   D   S +
Sbjct: 689 SPLVVAKQSPMAESPSKPAPPKEPSVPSEQAKIPMADDKPKQPKTVKPAIDTVSSSS 745



 Score = 66.2 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/285 (4%), Positives = 45/285 (15%), Gaps = 5/285 (1%)

Query: 79  KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
            +SD  +   T K+ I  + + +    +    +                  +        
Sbjct: 133 TDSDASQEETTKKQKIAQKEQGKPEGIVKPPQQQSPKPIPKQQGPVRAPLQHDGSLKSVS 192

Query: 139 RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +     S     E        +          +   A   +  + ++           
Sbjct: 193 SQQPEKIKSQPPGTEKPIQGLTQSPQTDQAKLPLQRDAARPQTKQSDTVRGESVKASVQS 252

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
                   ++ ++    +     +           +               +        
Sbjct: 253 PFKPTLQQASPAKPPAQQPGPEKLSTPQPGPAKPSTQQPGPTKAPAQPPGPAKPSPTQPA 312

Query: 259 KNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKE 318
             + +           +   +    P     +           +   G            
Sbjct: 313 AKLPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQPGPA 372

Query: 319 IEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                            G  + +            +      G  
Sbjct: 373 KPAPQQPGPAKPPPQQPGPAKPASQQPG-----PAKPPPQQPGPA 412



 Score = 53.1 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/252 (6%), Positives = 42/252 (16%), Gaps = 2/252 (0%)

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
              +        +  + + +      V    +      P             G L  + S
Sbjct: 134 DSDASQEETTKKQKIAQKEQGKPEGIVKPPQQQSPKPIPKQQGPVRAPLQHDGSLKSVSS 193

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                I                S  +  ++  L +            +         +  
Sbjct: 194 QQPEKIKSQPPGTEKPIQGLTQSPQTDQAKLPLQRDAARPQTKQSDTVRGESVKASVQSP 253

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L++ S       +        P+                   P      +      
Sbjct: 254 FKPTLQQASPAKPPAQQPGPEKLSTPQPGPAKPSTQQPGPTKAPAQPPGPAKPSPTQPAA 313

Query: 302 NYIGGDENSTFVLGKKEIE--EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
                   +T    ++        P           G  +++           Q+     
Sbjct: 314 KLPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQPGPAK 373

Query: 360 KGLVIKGDIPMI 371
                 G     
Sbjct: 374 PAPQQPGPAKPP 385



 Score = 41.1 bits (94), Expect = 0.39,   Method: Composition-based stats.
 Identities = 33/337 (9%), Positives = 77/337 (22%), Gaps = 1/337 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            I +A ++     P ++  ++      VA++    +        +      EQA + +   
Sbjct: 668  ISKAPESKTPPPPVKQPALHGS-PLVVAKQSPMAESPSKPAPPKEPSVPSEQAKIPMADD 726

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
              K   T K   ++    S+ T  +      + +       + K        S       
Sbjct: 727  KPKQPKTVKPAIDTVSSSSTETKPDIPTSRVQSQDQEKTTPALKTDSAKPSQSFPPTGEK 786

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
             T    K       +    S               +++  +   +              +
Sbjct: 787  VTPFDSKVIPRPASDSKIISHPGPSSEGKGQKQFDSVQKREEPKKAQTKISPKPDAKLML 846

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
              S        T G  +  S        +   F + L  +           + ++T  L 
Sbjct: 847  KGSPTPLDPRPTTGQTAPASQQPPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLF 906

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                   +     + +  +P    +           P + P                   
Sbjct: 907  GFGASIFSQASNLISTAGQPGSHLQSGSGAPTKQGPPPSQPPPSQGPPKPTDQVPLAPAK 966

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
                    K  + E      E    + +   +   L 
Sbjct: 967  VMPVEKETKAPVAEKLEPKAEQVPAVKRTETEKKPLP 1003



 Score = 36.9 bits (83), Expect = 8.3,   Method: Composition-based stats.
 Identities = 19/314 (6%), Positives = 52/314 (16%), Gaps = 15/314 (4%)

Query: 48  EILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSIL 107
               +   K   AI +               K+   PK  ++        P      ++ 
Sbjct: 628 ASSPQPKPKTGPAIPKTGVSKPSPQSQQISPKKDTAPKQDISKAPESKTPPPPVKQPALH 687

Query: 108 RSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHD 167
            S       + ++                S               +    ++     +  
Sbjct: 688 GSPLVVAKQSPMAE---------------SPSKPAPPKEPSVPSEQAKIPMADDKPKQPK 732

Query: 168 KSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM 227
             +     ++   +     I  S       +         +      F      +     
Sbjct: 733 TVKPAIDTVSSSSTETKPDIPTSRVQSQDQEKTTPALKTDSAKPSQSFPPTGEKVTPFDS 792

Query: 228 AIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI 287
            +    +      S                 +      + +       D   +  G  T 
Sbjct: 793 KVIPRPASDSKIISHPGPSSEGKGQKQFDSVQKREEPKKAQTKISPKPDAKLMLKGSPTP 852

Query: 288 PVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKI 347
                               +  +           +    +         G+       I
Sbjct: 853 LDPRPTTGQTAPASQQPPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASI 912

Query: 348 LWSLQQEKSQGLKG 361
                   S   + 
Sbjct: 913 FSQASNLISTAGQP 926


>gi|71649745|ref|XP_813586.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70878483|gb|EAN91735.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 1748

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/356 (5%), Positives = 44/356 (12%), Gaps = 3/356 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQN 68
            A     E  P                  +S +P+  +                  VE + 
Sbjct: 840  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKSAEPKPAEPKPAEPKPAEPKPAEPKPVEPKP 899

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +      +    +P     +    +            +      
Sbjct: 900  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 959

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                P        +            +   +     E   +  +  +       P     
Sbjct: 960  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 1019

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                           +                             +  K         + 
Sbjct: 1020 AEPKPAEPKSAEPKSAEPKPAEPKLAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 1079

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                                   +  E            P          A         
Sbjct: 1080 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 1139

Query: 309  NSTFVLGKKEIEEGNP-LIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                    K  E                   +      K       E         
Sbjct: 1140 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKSAEPKSAEPKPAEPKLAEPKPAEPKPA 1195



 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/321 (5%), Positives = 45/321 (14%)

Query: 43   PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
             R   +        +E A  +V    Q ++            ++++ +            
Sbjct: 695  ERKSAKAAAATSPSVESANDRVNTNTQPTVPPPATAGPQQTDQTTLNTSSVPSGGAASTP 754

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                    K  +         + +       +      +         +        P  
Sbjct: 755  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 814

Query: 163  AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI 222
            A                                            A  +    K      
Sbjct: 815  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSAEPKP 874

Query: 223  ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
                 A         ++         E         +   +  +P   +      +E   
Sbjct: 875  AEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 934

Query: 283  GPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
                      A       K              K    +                 +   
Sbjct: 935  AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKP 994

Query: 343  LSGKILWSLQQEKSQGLKGLV 363
               K       E         
Sbjct: 995  AEPKPAEPKPAEPKPAEPKPA 1015


>gi|198475573|ref|XP_002132955.1| GA26108 [Drosophila pseudoobscura pseudoobscura]
 gi|198138883|gb|EDY70357.1| GA26108 [Drosophila pseudoobscura pseudoobscura]
          Length = 17011

 Score = 94.7 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/375 (8%), Positives = 68/375 (18%), Gaps = 13/375 (3%)

Query: 12    VDNLPENTPERRSHI---YEHARNSVARRLESMK-PRLPKEILERQFNK--LEQAILQVE 65
             + ++P+ TP  +  +       + + A +      P +P+ I         L   +  V 
Sbjct: 12986 IPSVPQPTPAPQPGVINIPSVPQPTPAPQPGVFNIPSVPQPIPPSHQPPVYLSTPLNSVP 13045

Query: 66    KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
                Q  +       +   P   V         P        + S                
Sbjct: 13046 PAPQPGIINIPSVPQPRPPIHGVHYPTPQTPIPERPVGVVNIPSVVQPVYPTPQPPVYDV 13105

Query: 126   RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                T  SP      +  I S            +   + +       + G +      P  
Sbjct: 13106 NYPTPHSPVPQRPVIVNIPSLPQPVAPVSQRPIFTPSPVSPVTPAPQPGVINVPSVPPQQ 13165

Query: 186   S-IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
                              +           +        +       +             
Sbjct: 13166 VYPSPQPPIVQSPAIYDVYYPPPPSIPGVINIPSPPRPVYPVPQQPIYVPAPPRPTPHPQ 13225

Query: 245   FLRR----ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                      S+        N         T+R       ++V     P         +  
Sbjct: 13226 PQPGVVNIPSMPQPTYPHPNPPIHDVSYPTQRPSPVPGVINVHSVPQPTPVPNPVPGVIN 13285

Query: 301   KNYIGGDEN--STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQG 358
                     N   T  +                   +        +       +    +  
Sbjct: 13286 IPSQQSPPNIVPTPGVVNIPSVPQPTYPTYNPPIHDVSYPTPQPIPSPAPGVVNIPSAPQ 13345

Query: 359   LKGLVIKGDIPMIDN 373
                  I G I +   
Sbjct: 13346 PMPSSIPGVINIPSQ 13360



 Score = 92.0 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/344 (5%), Positives = 43/344 (12%), Gaps = 42/344 (12%)

Query: 55    NKLEQAILQVEKQNQKSLHTSKQD------KESDIPKSSVTSKENIFLEPRLRSISSILR 108
                +  I+ +    Q    + +             P        NI   P       ++ 
Sbjct: 12872 PAPQPGIVNIPSVPQPVYPSPQPPVYDVNYSTPQTPSHQQPGVVNIPSVPHPSPQPGVVN 12931

Query: 109   SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
                  +             N    P          +      Q         V      +
Sbjct: 12932 IPSVPQPVYPSPQPPIYDVNHPTIPHPQPAPGIVNIPSVPQPQPTPVPQPGVVNIPSVPQ 12991

Query: 169   SRLRRGKLAGIFSFPTGSIFWSVH-----NYFFNKTRGLLSFYS---------ALSEHHL 214
                                                                    +    
Sbjct: 12992 PTPAPQPGVINIPSVPQPTPAPQPGVFNIPSVPQPIPPSHQPPVYLSTPLNSVPPAPQPG 13051

Query: 215   FKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSG------IRPK 268
                   +        GV Y   ++                                  P 
Sbjct: 13052 IINIPSVPQPRPPIHGVHYPTPQTPIPERPVGVVNIPSVVQPVYPTPQPPVYDVNYPTPH 13111

Query: 269   ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                        +   P  +           +  + +        +       +      +
Sbjct: 13112 SPVPQRPVIVNIPSLPQPVAPVSQRPIFTPSPVSPVTPAPQPGVINVPSVPPQQVYPSPQ 13171

Query: 329   GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMID 372
               +  +                             I G I +  
Sbjct: 13172 PPIVQSPAIYDVYY----------------PPPPSIPGVINIPS 13199



 Score = 90.5 bits (222), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/368 (8%), Positives = 69/368 (18%), Gaps = 20/368 (5%)

Query: 18    NTPERRSHIYEHARNSVARRLESMKP--RLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             N P     +Y          +    P   +P+  +      L Q +  V ++   +    
Sbjct: 13086 NIPSVVQPVY-PTPQPPVYDVNYPTPHSPVPQRPVIVNIPSLPQPVAPVSQRPIFTPSPV 13144

Query: 76    KQDKESDIPKS---SVTSKENIFLEPRLRSISSIL-----RSNKHKKLANILSVQGKSRT 127
                  +  P          + ++  P+   + S                 I         
Sbjct: 13145 SPVTPAPQPGVINVPSVPPQQVYPSPQPPIVQSPAIYDVYYPPPPSIPGVINIPSPPRPV 13204

Query: 128   NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                     +                  +    P     H    +           P   +
Sbjct: 13205 YPVPQQPIYVPAPPRPTPHPQPQPGVVNIPSMPQPTYPHPNPPIHDVSYPTQRPSPVPGV 13264

Query: 188   FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                            +     +         V    ++ +      +       I     
Sbjct: 13265 INVHSVPQPTPVPNPVPGVINIPSQQSPPNIVPTPGVVNIPSVPQPTYPTYNPPIHDVSY 13324

Query: 248   RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                    +     V     P+     +     +   PS   V +     NI         
Sbjct: 13325 PTPQPIPSPAPGVVNIPSAPQPMPSSIPGVINIPSQPSPPTVIEIPGVINIPSAPQPTYP 13384

Query: 308   ENSTFVLGKK--EIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS-QGLKGLVI 364
               +   +        + NP+ G   V                  S+    S      +  
Sbjct: 13385 TQNPTPIQDVSYPTPQPNPITGVIIVPSEPHP------VPSSTPSVINIPSQPSPPHVPA 13438

Query: 365   KGDIPMID 372
              G + +  
Sbjct: 13439 HGVVNIPS 13446



 Score = 86.2 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/372 (6%), Positives = 69/372 (18%), Gaps = 35/372 (9%)

Query: 61    ILQVEKQNQKSLHT----SKQDKESDIPKS-----SVTSKENIFLEPRL---RSISSILR 108
             I  V +                + +  P+          +             +  + + 
Sbjct: 12986 IPSVPQPTPAPQPGVINIPSVPQPTPAPQPGVFNIPSVPQPIPPSHQPPVYLSTPLNSVP 13045

Query: 109   SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV--NTQHEYDSSVSPVAAIEH 166
                   + NI SV         +        + E     V   +  +           + 
Sbjct: 13046 PAPQPGIINIPSVPQPRPPIHGVHYPTPQTPIPERPVGVVNIPSVVQPVYPTPQPPVYDV 13105

Query: 167   DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
             +                  S+   V                           V  +    
Sbjct: 13106 NYPTPHSPVPQRPVIVNIPSLPQPVAPVSQRPIFTPSPVSPVTPAPQPGVINVPSVPPQQ 13165

Query: 227   MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST 286
             +       I +S      +        G ++  +    + P   + +             
Sbjct: 13166 VYPSPQPPIVQSPAIYDVYYPPPPSIPGVINIPSPPRPVYPVPQQPIYVPAPPRPTPHPQ 13225

Query: 287   IPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGK 346
                      S            +    +         P    G + ++            
Sbjct: 13226 PQPGVVNIPSMP-----QPTYPHPNPPIHDVSYPTQRPSPVPGVINVHSVP--QPTPVPN 13278

Query: 347   ILWSLQQEKSQGLKGLVI--KGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFP-- 402
              +  +    SQ     ++   G + +           +          H  ++ +  P  
Sbjct: 13279 PVPGVINIPSQQSPPNIVPTPGVVNIPS-------VPQPTYPTYNPPIH--DVSYPTPQP 13329

Query: 403   -KESQDAVVDLR 413
                    VV++ 
Sbjct: 13330 IPSPAPGVVNIP 13341



 Score = 83.1 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/423 (6%), Positives = 65/423 (15%), Gaps = 57/423 (13%)

Query: 6     LVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLP-----KEILERQFNKLEQA 60
              V QR V     + P+  + + +    + +          P       +  +Q     Q 
Sbjct: 13113 PVPQRPVIVNIPSLPQPVAPVSQRPIFTPSPVSPVTPAPQPGVINVPSVPPQQVYPSPQP 13172

Query: 61    I----LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF--------------------- 95
                    +         +         P   V                            
Sbjct: 13173 PIVQSPAIYDVYYPPPPSIPGVINIPSPPRPVYPVPQQPIYVPAPPRPTPHPQPQPGVVN 13232

Query: 96    -LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEY 154
                    +                         N +  P+            ++ +Q   
Sbjct: 13233 IPSMPQPTYPHPNPPIHDVSYPTQRPSPVPGVINVHSVPQPTPVPNPVPGVINIPSQQSP 13292

Query: 155   DSSVSPVAAIEHDKSRLRRGKLAGIFS-----FPTGSIFWSVHNYFFNKTRGLLSFYS-- 207
              + V     +                           I           +       S  
Sbjct: 13293 PNIVPTPGVVNIPSVPQPTYPTYNPPIHDVSYPTPQPIPSPAPGVVNIPSAPQPMPSSIP 13352

Query: 208   -----ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL---------DG 253
                             +  +I +  A   +Y                             
Sbjct: 13353 GVINIPSQPSPPTVIEIPGVINIPSAPQPTYPTQNPTPIQDVSYPTPQPNPITGVIIVPS 13412

Query: 254   GNVDKKNVFSGI---RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                   +    +     + +   +     V++     P     N             +  
Sbjct: 13413 EPHPVPSSTPSVINIPSQPSPPHVPAHGVVNIPSVPQPTYPSQNPPIQDVSYPTPVPKP- 13471

Query: 311   TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                       + +P I      +                 +Q           + G I +
Sbjct: 13472 -VPGAISIPSQPSPPIYVPTPGVVNIPSVPQPTYPSQNPPIQDVSYPTPVPKPVPGVINI 13530

Query: 371   IDN 373
                
Sbjct: 13531 PSQ 13533



 Score = 72.0 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/309 (4%), Positives = 51/309 (16%), Gaps = 13/309 (4%)

Query: 75    SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
               Q    D+             +           S +              +    ++  
Sbjct: 12775 PNQPPIHDVQYPRPQYPPQSIPQQPGVVNIPTYPSPQPTISNVPSPETPIQQQPGVVNYP 12834

Query: 135   NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK-SRLRRGKLAGIFSFPTGSIFWSVHN 193
             +   +    +    +              I     +                 ++ S   
Sbjct: 12835 SSVPQQPGGIVNIPSVPQPVPVVPKRPVFIPTPANATPAPQPGIVNIPSVPQPVYPSPQP 12894

Query: 194   YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
               ++         S      +    V         + +         S    +   +   
Sbjct: 12895 PVYDVNYSTPQTPSHQQPGVVNIPSVPHPSPQPGVVNIPSVPQPVYPSPQPPIYDVNHPT 12954

Query: 254   GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN------IAFKNYIGGD 307
                 +        P + +       +  V                        +      
Sbjct: 12955 IPHPQPAPGIVNIPSVPQPQPTPVPQPGVVNIPSVPQPTPAPQPGVINIPSVPQPTPAPQ 13014

Query: 308   ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK-- 365
                  V     + +  P   +  V+++             + ++            +   
Sbjct: 13015 P---GVFNIPSVPQPIPPSHQPPVYLSTPLNSVPPAPQPGIINIPSVPQPRPPIHGVHYP 13071

Query: 366   -GDIPMIDN 373
                 P+ + 
Sbjct: 13072 TPQTPIPER 13080



 Score = 61.9 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/243 (8%), Positives = 52/243 (21%), Gaps = 10/243 (4%)

Query: 18    NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQV-EKQNQKSLHTSK 76
              TP+    I   A   V   + S    +P  I        + +   V E     ++ ++ 
Sbjct: 13325 PTPQP---IPSPAPGVV--NIPSAPQPMPSSIPGVINIPSQPSPPTVIEIPGVINIPSAP 13379

Query: 77    QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
             Q        + +        +P   +   I+ S  H   ++  SV       +       
Sbjct: 13380 QPTYPTQNPTPIQDVSYPTPQPNPITGVIIVPSEPHPVPSSTPSVINIPSQPSPPHVPAH 13439

Query: 137   SC-RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                 +  +   +  +Q+     VS    +                     +         
Sbjct: 13440 GVVNIPSVPQPTYPSQNPPIQDVSYPTPVPKPVPGAISIPSQPSPPIYVPTPGVVNIPSV 13499

Query: 196   FNKTRGLLSFYSALSEHHLFKYFVFLII---LLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                T    +       +          +       +  +           +      +  
Sbjct: 13500 PQPTYPSQNPPIQDVSYPTPVPKPVPGVINIPSQPSPPIYVPTPGVVNIPSVPQPSPAAP 13559

Query: 253   GGN 255
                
Sbjct: 13560 QQP 13562


>gi|327408418|emb|CCA30159.1| unnamed protein product [Neospora caninum Liverpool]
          Length = 2101

 Score = 93.9 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/316 (6%), Positives = 60/316 (18%), Gaps = 20/316 (6%)

Query: 41   MKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRL 100
            ++P  P+                 E + +       + +   +P      +         
Sbjct: 1709 VEPVPPEGS---------------EGEVEPVPPEGSEGEGEPVPPEGSEGEVEPVPPEGS 1753

Query: 101  RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
                  +     +     +  +G       + P+     +  +       + E       
Sbjct: 1754 EGEGEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGGEGEVEPVPPEGNEGEVEPVPPEGS 1813

Query: 161  VAAIEHDKSRLRRGKLAGIFSFPTG-SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
               +E        G++  +    +   +          +   +    S      +     
Sbjct: 1814 EGEVEPVPPEGGEGEVEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGG 1873

Query: 220  FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
               +      G            +          G+  +         +     +     
Sbjct: 1874 EGEVEPVPPEGGEGEGEPVPPEGSEGEVEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGS 1933

Query: 280  VDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ 339
               G   +P                 G+       G +   E  P  G            
Sbjct: 1934 EGEG-EPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSE---GEGEPVP 1989

Query: 340  SSILSGKILWSLQQEK 355
                 G++     +E 
Sbjct: 1990 PEGSEGEVEPVPPEEG 2005



 Score = 87.4 bits (214), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/302 (7%), Positives = 46/302 (15%), Gaps = 3/302 (0%)

Query: 12   VDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
            +D   E  P                  E     +P E  E +   +     + E +    
Sbjct: 1703 LDGEGEVEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGSEGEVEPVPPEGSEGEGEPVPP 1762

Query: 72   LHTSKQDKESDIPKSSVTSKENIFL--EPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
              +  + +      S    +       E  +  +       + + +    S         
Sbjct: 1763 EGSEGEVEPVPPEGSEGEGEPVPPEGGEGEVEPVPPEGNEGEVEPVPPEGSEGEVEPVPP 1822

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                        E     V       S                              +  
Sbjct: 1823 EGGEGEVEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGGEGEVEPVPP 1882

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS-ITHFLRR 248
                          S                  +    + G    +           +  
Sbjct: 1883 EGGEGEGEPVPPEGSEGEVEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGSEGEGEPVPP 1942

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E  +G         S    +       +G    V P              +         
Sbjct: 1943 EGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEVEPVPP 2002

Query: 309  NS 310
              
Sbjct: 2003 EE 2004



 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 75/370 (20%), Gaps = 27/370 (7%)

Query: 14   NLPENTPERRSHIY-EHARNSVARRLESMKPRLPK-EILERQFNKLEQAILQVEK----- 66
            +  E  P        E            ++P  P+    E +    E    +VE      
Sbjct: 1741 SEGEVEPVPPEGSEGEGEPVPPEGSEGEVEPVPPEGSEGEGEPVPPEGGEGEVEPVPPEG 1800

Query: 67   ---QNQKSLHT-SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
               + +      S+ + E   P+          +EP     S         + +      
Sbjct: 1801 NEGEVEPVPPEGSEGEVEPVPPE-----GGEGEVEPVPPEGSEGEVEPVPPEGSEGEGEP 1855

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                 +               +        E +    P    E +   +      G    
Sbjct: 1856 VPPEGSEGEGEPVPPEGGEGEVEPVPPEGGEGEGEPVPPEGSEGEVEPVPPEGSEGEVEP 1915

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                           +                    V      G    V     + +G  
Sbjct: 1916 VPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEPVPPEGSEGEGEP 1975

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
                     +G  V  +     + P          +E +                 A   
Sbjct: 1976 VPP-EGSEGEGEPVPPEGSEGEVEPVPPEEGNGGETEPETPEPESEEEHEKEEEGGAPIA 2034

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             I G      +L                       G +     +I++  +++ +Q  +  
Sbjct: 2035 AIAGGVVGGILLIAGGAGAAV----------YASHGGAEAAEDEIMFESEEDGAQAGENR 2084

Query: 363  VIKGDIPMID 372
              +  I + D
Sbjct: 2085 ETETVIEIED 2094


>gi|156546387|ref|XP_001606911.1| PREDICTED: hypothetical protein [Nasonia vitripennis]
          Length = 2318

 Score = 93.1 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/351 (8%), Positives = 67/351 (19%), Gaps = 5/351 (1%)

Query: 14  NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
             PE+ PE  S        +   + E      P+  +E +      A  + E ++     
Sbjct: 528 AEPESKPEPSSEPKSEPEPAAEPKSEPEPSSEPEPSVEPKSEPEPAAEPKSEPEHAAEPK 587

Query: 74  TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
           +  +        S  T++     EP     S     ++ K      +         +   
Sbjct: 588 SEPEPSADVTSASEPTAEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPK 647

Query: 134 KNFSCRLRE-----ILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                          +S   +         S    +   KS             P     
Sbjct: 648 SEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPKSEPEPALEPV 707

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
               +     +        A       +                 +   +    +    +
Sbjct: 708 AEPKSEPEPASEPTSDSEPAAEPKSEPEPASEPSAEPKSEPAAEPAAEPTILPESTAEPK 767

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
              +     +         + T  L        +   +      A   +    +     E
Sbjct: 768 SEPESAAKPEPASEPEPSTEPTSDLKPHAEPKSLAEPSSESEPTAEPKSEPEPSAEPKSE 827

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
                    + E       E     +                 + E S   
Sbjct: 828 PEPAAKPASQPEPSAEPKSEPEPTADPASEPEPTAEPTSKPESEMEPSSEP 878



 Score = 89.7 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/365 (10%), Positives = 89/365 (24%), Gaps = 2/365 (0%)

Query: 14  NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
           + PE+  E +S     A  + A    +     P+   E   +    +  + E +      
Sbjct: 578 SEPEHAAEPKSEPEPSADVTSASEPTAEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPA 637

Query: 74  TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ-GKSRTNTNLS 132
           +  +       +   +++     EP     S    S +    +  +S    +   +    
Sbjct: 638 SDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPK 697

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            +            S        +S S  AA    +        A   S P         
Sbjct: 698 SEPEPALEPVAEPKSEPEPASEPTSDSEPAAEPKSEPEPASEPSAEPKSEPAAEPAAEPT 757

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
               +         SA       +          +             S +        +
Sbjct: 758 ILPESTAEPKSEPESAAKPEPASEPEPSTEPTSDLKPHAEPKSLAEPSSESEPTAEPKSE 817

Query: 253 GGNVDKKNVFSGIRPKITRRLLE-DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
                +         K   +       + +  P+  P ++   T+    K     + +S 
Sbjct: 818 PEPSAEPKSEPEPAAKPASQPEPSAEPKSEPEPTADPASEPEPTAEPTSKPESEMEPSSE 877

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             L ++   +  P+     +  +K   +S            +  S+       K ++   
Sbjct: 878 PGLTEEHKNKLKPMSDFESIVESKSEAESESEPKSEQEPAAEPTSEPSPSADSKSEVEPA 937

Query: 372 DNAFS 376
           D   S
Sbjct: 938 DQPMS 942



 Score = 87.0 bits (213), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/356 (7%), Positives = 68/356 (19%), Gaps = 7/356 (1%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
            +  E   E +S     A  +      S     P+   E   +    +  + E +     
Sbjct: 617 ASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEP 676

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
            +  +       +   +++     EP L  ++      +        S       +    
Sbjct: 677 ASDSEPVSEPKSEPEPSAEPKSEPEPALEPVAEPKSEPEPASEPTSDSEPAAEPKSEPEP 736

Query: 133 PKNFSCRLREILSFSV-------NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
               S   +   +                  S    AA     S             P  
Sbjct: 737 ASEPSAEPKSEPAAEPAAEPTILPESTAEPKSEPESAAKPEPASEPEPSTEPTSDLKPHA 796

Query: 186 SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                      ++           S     +                        +    
Sbjct: 797 EPKSLAEPSSESEPTAEPKSEPEPSAEPKSEPEPAAKPASQPEPSAEPKSEPEPTADPAS 856

Query: 246 LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               + +  +  +  +     P +T         +    S +     A + +        
Sbjct: 857 EPEPTAEPTSKPESEMEPSSEPGLTEEHKNKLKPMSDFESIVESKSEAESESEPKSEQEP 916

Query: 306 GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
             E ++      + +       +            S L+         E     K 
Sbjct: 917 AAEPTSEPSPSADSKSEVEPADQPMSDSQPSAEPKSELNPISDPESNIEPVAEPKQ 972



 Score = 85.4 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/337 (8%), Positives = 66/337 (19%), Gaps = 3/337 (0%)

Query: 39  ESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESD--IPKSSVTSKENIFL 96
           ES      +     +     + + + E + + S     + + +     +   +S+    +
Sbjct: 505 ESKSKTEGEVDPSAEPKSEPEPVAEPESKPEPSSEPKSEPEPAAEPKSEPEPSSEPEPSV 564

Query: 97  EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEY-D 155
           EP+     +    ++ +  A   S    S   T+ S      +     S    +  E   
Sbjct: 565 EPKSEPEPAAEPKSEPEHAAEPKSEPEPSADVTSASEPTAEPKSEPEPSAEPASDSEPVS 624

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
              S         S             P+             K+    S   A     + 
Sbjct: 625 EPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVS 684

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
           +                 ++       +           +       S   P        
Sbjct: 685 EPKSEPEPSAEPKSEPEPALEPVAEPKSEPEPASEPTSDSEPAAEPKSEPEPASEPSAEP 744

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
                    +   +   +     +        E ++      E         E +     
Sbjct: 745 KSEPAAEPAAEPTILPESTAEPKSEPESAAKPEPASEPEPSTEPTSDLKPHAEPKSLAEP 804

Query: 336 GRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMID 372
                     K       E     +        P   
Sbjct: 805 SSESEPTAEPKSEPEPSAEPKSEPEPAAKPASQPEPS 841



 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/362 (7%), Positives = 77/362 (21%), Gaps = 6/362 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
               PE   E        +        +S+     +     +     +   + + + + + 
Sbjct: 773  AAKPEPASEPEPSTEPTSDLKPHAEPKSLAEPSSESEPTAEPKSEPEPSAEPKSEPEPAA 832

Query: 73   HTSKQDKESDIP--KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
              + Q + S  P  +   T+      EP     S      +      +           +
Sbjct: 833  KPASQPEPSAEPKSEPEPTADPASEPEPTAEPTSKPESEMEPSSEPGLTEEHKNKLKPMS 892

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK-SRLRRGKLAGIFSFPTGSIFW 189
                    +          ++ E  +  +   +   D  S +         S P+     
Sbjct: 893  DFESIVESKSEAESESEPKSEQEPAAEPTSEPSPSADSKSEVEPADQPMSDSQPSAEPKS 952

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
             ++     ++              + +       +         S+  +    +      
Sbjct: 953  ELNPISDPESNIEPVAEPKQEPETVAEPTSDSEPISEPKSEPEPSLESTPEPKSEPEPVI 1012

Query: 250  SLDGGNVDKKNVFSGIR---PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                G        S              +   E    P++ P       S     +    
Sbjct: 1013 ETVSGEKSSAESKSESAVKDSSEPLSEPKSEPEPVTEPASEPEPSAEPQSEKERSSESAA 1072

Query: 307  DENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
            +  ++            P          +   +   LS        +  +   +   I  
Sbjct: 1073 EPETSAEPKSVSEPSAEPEPVAEPTIQPESSTEFVNLSVSTSEPTAEPSASSAEPPKISE 1132

Query: 367  DI 368
            ++
Sbjct: 1133 EL 1134



 Score = 73.9 bits (179), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/334 (8%), Positives = 81/334 (24%), Gaps = 2/334 (0%)

Query: 14   NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
            + P++ PE  +        ++    E      P            +   + E  ++ S  
Sbjct: 684  SEPKSEPEPSAEPKSEPEPALEPVAEPKSEPEPASEPTSDSEPAAEPKSEPEPASEPSAE 743

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
               +       + ++  +     +    S +    +++ +      S         +L+ 
Sbjct: 744  PKSEPAAEPAAEPTILPESTAEPKSEPESAAKPEPASEPEPSTEPTSDLKPHAEPKSLAE 803

Query: 134  KNFSCRLREILSFSV-NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
             +               +                 +            + P      +  
Sbjct: 804  PSSESEPTAEPKSEPEPSAEPKSEPEPAAKPASQPEPSAEPKSEPEPTADPASEPEPTAE 863

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLI-ILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                 ++    S    L+E H  K         +  +   + S  + K          S 
Sbjct: 864  PTSKPESEMEPSSEPGLTEEHKNKLKPMSDFESIVESKSEAESESEPKSEQEPAAEPTSE 923

Query: 252  DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
               + D K+        ++        + ++ P + P ++    +    +     +  S 
Sbjct: 924  PSPSADSKSEVEPADQPMSDSQPSAEPKSELNPISDPESNIEPVAEPKQEPETVAEPTSD 983

Query: 312  FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSG 345
                 +   E  P +       ++       +SG
Sbjct: 984  SEPISEPKSEPEPSLESTPEPKSEPEPVIETVSG 1017



 Score = 73.1 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/400 (8%), Positives = 83/400 (20%), Gaps = 16/400 (4%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS- 71
               P++ PE  S      ++  A    +    LP+   E +      A  +   + + S 
Sbjct: 727  AAEPKSEPEPASEPSAEPKSEPAAEPAAEPTILPESTAEPKSEPESAAKPEPASEPEPST 786

Query: 72   ---------------LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
                              S + + +  PKS          EP   +  +       +  +
Sbjct: 787  EPTSDLKPHAEPKSLAEPSSESEPTAEPKSEPEPSAEPKSEPEPAAKPASQPEPSAEPKS 846

Query: 117  NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
                    +      +            S       E+ + + P++  E         + 
Sbjct: 847  EPEPTADPASEPEPTAEPTSKPESEMEPSSEPGLTEEHKNKLKPMSDFESIVESKSEAES 906

Query: 177  AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                                +         +                L  ++   S    
Sbjct: 907  ESEPKSEQEPAAEPTSEPSPSADSKSEVEPADQPMSDSQPSAEPKSELNPISDPESNIEP 966

Query: 237  KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
             ++         E         +          +    +   E  +   +   +   + S
Sbjct: 967  VAEPKQEPETVAEPTSDSEPISEPKSEPEPSLESTPEPKSEPEPVIETVSGEKSSAESKS 1026

Query: 297  NIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
              A K+                     P          +   +S+             + 
Sbjct: 1027 ESAVKDSSEPLSEPKSEPEPVTEPASEPEPSAEPQSEKERSSESAAEPETSAEPKSVSEP 1086

Query: 357  QGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVME 396
                  V +  I    +    ++++  +   +       E
Sbjct: 1087 SAEPEPVAEPTIQPESSTEFVNLSVSTSEPTAEPSASSAE 1126



 Score = 63.9 bits (153), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/358 (9%), Positives = 80/358 (22%), Gaps = 14/358 (3%)

Query: 14   NLPENTPERRSHIYEHARNSVARRLESM--KPRLPKEILERQFNKLEQAILQVEKQNQKS 71
            + PE + E +S     A+ +      +       P      +     +   + E + + S
Sbjct: 816  SEPEPSAEPKSEPEPAAKPASQPEPSAEPKSEPEPTADPASEPEPTAEPTSKPESEMEPS 875

Query: 72   LHTSKQDKESDIPKS------------SVTSKENIFLEPRLRSISSILRSNKHKKLANIL 119
                  ++  +  K                S+     E    +  +   S      + + 
Sbjct: 876  SEPGLTEEHKNKLKPMSDFESIVESKSEAESESEPKSEQEPAAEPTSEPSPSADSKSEVE 935

Query: 120  SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
                    +   +              ++    E       VA    D   +   K    
Sbjct: 936  PADQPMSDSQPSAEPKSELNPISDPESNIEPVAEPKQEPETVAEPTSDSEPISEPKSEPE 995

Query: 180  FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
             S  +     S          G  S   + SE  +      L         V+    + +
Sbjct: 996  PSLESTPEPKSEPEPVIETVSGEKSSAESKSESAVKDSSEPLSEPKSEPEPVTEPASEPE 1055

Query: 240  GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
             S      +E       + +               E  +E  + P +       + S   
Sbjct: 1056 PSAEPQSEKERSSESAAEPETSAEPKSVSEPSAEPEPVAEPTIQPESSTEFVNLSVSTSE 1115

Query: 300  FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
                          + ++  +E N          +     + +          +  S+
Sbjct: 1116 PTAEPSASSAEPPKISEELADEPNSESESSSAAKHDETTDNQVPDENKTEVPSEPSSE 1173



 Score = 55.8 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 11/223 (4%), Positives = 32/223 (14%), Gaps = 1/223 (0%)

Query: 151 QHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALS 210
             +    +         K+       A   S P             ++ +      +   
Sbjct: 492 WQDPYHGLHHEHDESKSKTEGEVDPSAEPKSEPEPVAEPESKPEPSSEPKSEPEPAAEPK 551

Query: 211 EHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKIT 270
                       +        +                              +  + +  
Sbjct: 552 SEPEPSSEPEPSVEPKSEPEPAAEPKSEPEHAAEPKSEPEPSADVTSASEPTAEPKSEPE 611

Query: 271 RRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGR 330
                      V          A  ++ +        E         + E  +    E  
Sbjct: 612 PSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPE 671

Query: 331 VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
                      +   K       E  +      ++        
Sbjct: 672 PSAEPASDSEPVSEPKSEPEPSAEP-KSEPEPALEPVAEPKSE 713



 Score = 47.7 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/285 (7%), Positives = 63/285 (22%)

Query: 14   NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
            + P  + + +S +    +     +  +        I + + N    A  + E +      
Sbjct: 922  SEPSPSADSKSEVEPADQPMSDSQPSAEPKSELNPISDPESNIEPVAEPKQEPETVAEPT 981

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
            +  +       +   + +     +     +   +   K    +   S    S    +   
Sbjct: 982  SDSEPISEPKSEPEPSLESTPEPKSEPEPVIETVSGEKSSAESKSESAVKDSSEPLSEPK 1041

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                           + + + +   S  +A E + S   +            +       
Sbjct: 1042 SEPEPVTEPASEPEPSAEPQSEKERSSESAAEPETSAEPKSVSEPSAEPEPVAEPTIQPE 1101

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                     +S     +E          I         S S   S          +  D 
Sbjct: 1102 SSTEFVNLSVSTSEPTAEPSASSAEPPKISEELADEPNSESESSSAAKHDETTDNQVPDE 1161

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
               +  +  S      T    +      +    +     +  + +
Sbjct: 1162 NKTEVPSEPSSEPHNETLDTKKVTDAASISNVEVSTTSTSEPATV 1206


>gi|145482197|ref|XP_001427121.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124394200|emb|CAK59723.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1734

 Score = 93.1 bits (229), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/326 (8%), Positives = 62/326 (19%), Gaps = 1/326 (0%)

Query: 40   SMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPR 99
             ++P+ P+     +  K +    +  KQ +      KQ +    P++     +      +
Sbjct: 917  KVQPKQPEPPKYPEAPKEQPKQPEPPKQPEPPKDQPKQPEPPKQPETHKEQPKQAEPPKQ 976

Query: 100  LRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVS 159
              S+    +  +  K    L  Q K                +         Q E      
Sbjct: 977  PESLMEQPKQPEPPKQPEQLKEQPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQP 1036

Query: 160  PVAAIEHDKSR-LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYF 218
                   ++ +     K       P                +               +  
Sbjct: 1037 KQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1096

Query: 219  VFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGS 278
                              + K       + +  +      K               ++  
Sbjct: 1097 KQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1156

Query: 279  EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
            +    P   P                           + E  +  P   E        + 
Sbjct: 1157 KQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQPESPKQPLPSKE 1216

Query: 339  QSSILSGKILWSLQQEKSQGLKGLVI 364
            Q            + E+       +I
Sbjct: 1217 QPKQPEPTKEPLKKPEQEIKKPDHLI 1242



 Score = 92.8 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 10/274 (3%), Positives = 36/274 (13%), Gaps = 3/274 (1%)

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                      +  + +   +           K    +           +           
Sbjct: 966  EQPKQAEPPKQPESLMEQPKQPEPPKQPEQLKEQPKQPEPPKQPEPPKEQPKQPEPLKEQ 1025

Query: 163  AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI 222
              + +  + +  +       P                +          E    K      
Sbjct: 1026 PKQPEPPKEQPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQP--KQPEPPK 1083

Query: 223  ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
                          + +       + E         +      +     +      E   
Sbjct: 1084 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1143

Query: 283  GPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
                 P                           K+          +      +   +   
Sbjct: 1144 EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPK 1203

Query: 343  LSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFS 376
                    L  ++         K  +   +    
Sbjct: 1204 QPESPKQPLPSKEQPKQPEP-TKEPLKKPEQEIK 1236



 Score = 61.6 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 9/148 (6%), Positives = 30/148 (20%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +     PE   E+                   +P+ P+   E+            + +  
Sbjct: 1093 KEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPP 1152

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
            K      +  +    +     ++    EP            + ++           +   
Sbjct: 1153 KEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQPESPKQPL 1212

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSS 157
                +       +        + +    
Sbjct: 1213 PSKEQPKQPEPTKEPLKKPEQEIKKPDH 1240



 Score = 43.5 bits (100), Expect = 0.081,   Method: Composition-based stats.
 Identities = 7/260 (2%), Positives = 35/260 (13%)

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                               +                +      +    +       S V 
Sbjct: 860  EQPKQPGPPKNPEPPKEQPKQPEPPKEQPKQPQPPKQPEPPKEYPKQPEPPKQPEPSKVQ 919

Query: 163  AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI 222
              + +  +                      +                             
Sbjct: 920  PKQPEPPKYPEAPKEQPKQPEPPKQPEPPKDQPKQPEPPKQPETHKEQPKQAEPPKQPES 979

Query: 223  ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
            ++            +                   ++      ++ +  +           
Sbjct: 980  LMEQPKQPEPPKQPEQLKEQPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQP 1039

Query: 283  GPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
             P                +     ++       K++ ++  P   + +            
Sbjct: 1040 EPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQP 1099

Query: 343  LSGKILWSLQQEKSQGLKGL 362
               K      +   +  K  
Sbjct: 1100 EPPKEQPKQPEPPKEQPKQP 1119


>gi|71029838|ref|XP_764562.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68351516|gb|EAN32279.1| hypothetical telomeric SfiI fragment 20 protein 3 [Theileria parva]
          Length = 3300

 Score = 92.4 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/242 (8%), Positives = 52/242 (21%), Gaps = 7/242 (2%)

Query: 19  TPERRSHIYEHARNSVARRLESM------KPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           TPE    +   A+ +               P    E         E A   V    +   
Sbjct: 623 TPEVSGEVVTPAKAATVTTPAKAPSPKVPTPPTADESATPSTTPDESATPVVTTPAKAPD 682

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                    D   + V +       P++ +  +   S       +  +    +       
Sbjct: 683 AKVTTPPTPDESATPVVTTPAKAPSPKVPTPPTADESATPSTTPDESATPVVTTPAKAPD 742

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            K  +    +  +  V T                D+S           +    +   +  
Sbjct: 743 AKVTTPPTPDESATPVVTTPAKAPDAKVTTPPTPDESATPSTTADESATPAKATPSATPS 802

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                    +++   A  +  + K    +   + +++  + +                  
Sbjct: 803 TTADESATPVVTTPKAAPKTEVVKSTDPVPAKVSVSV-EAPTGRPRPKRAPEAATGPRTA 861

Query: 253 GG 254
             
Sbjct: 862 VP 863



 Score = 50.8 bits (119), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 10/121 (8%), Positives = 24/121 (19%), Gaps = 2/121 (1%)

Query: 242  ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
                    +        +   +  +PK         S      +T P    A T+     
Sbjct: 2592 SASTGSAPAPATTPAKAQEATTPPQPKAVPATAATTSSSPAKVTTTPPETKAPTATTPAP 2651

Query: 302  NYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
               G +   +         +  P+              +   +     +  Q     +  
Sbjct: 2652 QVSGTEVTPSKAAPATTQPKAVPVTTPATPSATTQPSSTEAKAPT--ATTPQVSGGAVTP 2709

Query: 362  L 362
             
Sbjct: 2710 S 2710



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/169 (6%), Positives = 37/169 (21%), Gaps = 1/169 (0%)

Query: 43   PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
            P       + Q          V      +  +  +   +  P++   +      +     
Sbjct: 2599 PAPATTPAKAQEATTPPQPKAVPATAATTSSSPAKVTTT-PPETKAPTATTPAPQVSGTE 2657

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
            ++    +    +   +      + + T       +                  ++    A
Sbjct: 2658 VTPSKAAPATTQPKAVPVTTPATPSATTQPSSTEAKAPTATTPQVSGGAVTPSTATPAKA 2717

Query: 163  AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
            A         +       +  T     +V     +K   +    + L+ 
Sbjct: 2718 APAATAQPQPKAVPTTAPTVSTAPPKATVTKPIESKQPEVKLPLTPLNP 2766



 Score = 41.5 bits (95), Expect = 0.30,   Method: Composition-based stats.
 Identities = 14/182 (7%), Positives = 42/182 (23%), Gaps = 9/182 (4%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLE-SMKPRLPKEILERQFNKLEQAILQVEKQ 67
             +A +     TP +   +   A  + +   + +  P   K            A      +
Sbjct: 2606 AKAQEA---TTPPQPKAVPATAATTSSSPAKVTTTPPETKAPT-----ATTPAPQVSGTE 2657

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
               S       +   +P ++  +           + +    + +    A   S    ++ 
Sbjct: 2658 VTPSKAAPATTQPKAVPVTTPATPSATTQPSSTEAKAPTATTPQVSGGAVTPSTATPAKA 2717

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                + +     +            +   +    +     K  L       +    T + 
Sbjct: 2718 APAATAQPQPKAVPTTAPTVSTAPPKATVTKPIESKQPEVKLPLTPLNPVTLDMDKTQAT 2777

Query: 188  FW 189
              
Sbjct: 2778 PD 2779


>gi|194757120|ref|XP_001960813.1| GF13555 [Drosophila ananassae]
 gi|190622111|gb|EDV37635.1| GF13555 [Drosophila ananassae]
          Length = 1348

 Score = 91.2 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/287 (8%), Positives = 57/287 (19%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              P++ PE +S     A      + E      PK     +     +   + + + +   
Sbjct: 314 APEPKSEPEPKSEPGSAAEPKSEPKSEPKSEPEPKSEPGSEAEPKSEPKSEPKSEPKSEP 373

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
            +  + +    PKS    K     EP  +S        K +  +        +++     
Sbjct: 374 KSEPKSEPKSEPKSEPEPKSEPTSEPEPKSEPKSEPEPKSEPKSEPEPKSEPAKSQAEPK 433

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            +  S    E    S                    + +            P         
Sbjct: 434 SEPKSEPKSEPEPKSEPKSQPSSEPEPKSEPESQAEPKSEPKSEPKSEPEPKSEPESEAE 493

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                K+                +                     +    +        +
Sbjct: 494 PKSEPKSEPKSEPEPKSEPKSEPEPTSEPKSEPEPTSEPQSEPEPTSEPKSEPEPTSEPE 553

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
             + +        +  I    +   S      +         + +  
Sbjct: 554 ADSKNGAKSKRVAKEHIPLEGVTSVSTSVSYSTRSDRQRREASESPK 600


>gi|125975557|ref|YP_001039467.1| cellulosome anchoring protein, cohesin region [Clostridium
            thermocellum ATCC 27405]
 gi|145559529|sp|Q06852|SLAP1_CLOTH RecName: Full=Cell surface glycoprotein 1; AltName: Full=Outer layer
            protein B; AltName: Full=S-layer protein 1; Flags:
            Precursor
 gi|125715782|gb|ABN54274.1| cellulosome anchoring protein, cohesin region [Clostridium
            thermocellum ATCC 27405]
          Length = 2313

 Score = 90.8 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/361 (6%), Positives = 59/361 (16%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 1475 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1534

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +         T ++
Sbjct: 1535 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1594

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                + +           +     D           D+              P+     S
Sbjct: 1595 EPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1654

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                    T       +   E                         +            +
Sbjct: 1655 ETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1714

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1715 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1774

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1775 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1833

Query: 371  I 371
             
Sbjct: 1834 P 1834



 Score = 90.1 bits (221), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/345 (8%), Positives = 64/345 (18%), Gaps = 2/345 (0%)

Query: 28   EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
            E   +      E+ +  +P +    +    ++     E         S +   SD P  S
Sbjct: 1534 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1593

Query: 88   VTS-KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
                      EP      S   +   +   +         T ++    +      +  + 
Sbjct: 1594 DEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1653

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFY 206
            S   +    +          D+              P+     S        T       
Sbjct: 1654 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEP 1713

Query: 207  SALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR 266
            +   E                         +            +                
Sbjct: 1714 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1773

Query: 267  PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI 326
            P  +       +  +  P+  P  +   +      +     +  T        E     I
Sbjct: 1774 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1833

Query: 327  GEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                             S +   S  +             + P+ 
Sbjct: 1834 PTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1877



 Score = 89.3 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/361 (5%), Positives = 54/361 (14%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 1432 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1491

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 1492 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1551

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           D+                      
Sbjct: 1552 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1611

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                         +            +
Sbjct: 1612 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1671

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1672 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1731

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1732 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1790

Query: 371  I 371
             
Sbjct: 1791 P 1791



 Score = 88.9 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/361 (5%), Positives = 55/361 (15%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 1389 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1448

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 1449 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1508

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           +                       
Sbjct: 1509 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTP 1568

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                    + S   +           +
Sbjct: 1569 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1628

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1629 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1688

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1689 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1747

Query: 371  I 371
             
Sbjct: 1748 P 1748



 Score = 88.9 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/352 (6%), Positives = 61/352 (17%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +      E      P+E +       E         + +
Sbjct: 1567 TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1626

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S   +  +               +   +   +         T ++
Sbjct: 1627 PTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSD 1686

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                +      E     + T    D           D+              P+ +    
Sbjct: 1687 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1746

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +     +         +   E                          +           +
Sbjct: 1747 IPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT 1806

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +    E            P  +   +      +     +  
Sbjct: 1807 PSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1866

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
            T     +E    +    E               S +   S +   S+  +  
Sbjct: 1867 TPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1918



 Score = 87.8 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/341 (7%), Positives = 56/341 (16%), Gaps = 7/341 (2%)

Query: 42   KPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLR 101
             P       +      E    +  ++   +   S +   SD P  S     +    P   
Sbjct: 1634 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1693

Query: 102  SISSILRS-------NKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEY 154
               S              +   +         T ++    +      E     + T    
Sbjct: 1694 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPS 1753

Query: 155  DSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHL 214
            D           D+              P+ +    +     +         +   E   
Sbjct: 1754 DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTP 1813

Query: 215  FKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLL 274
                                   +           +                P  +    
Sbjct: 1814 SDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1873

Query: 275  EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFIN 334
            E            P  +   +      +     +  T     +E    +    E      
Sbjct: 1874 EPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1933

Query: 335  KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAF 375
                     S +   S +   S               +   
Sbjct: 1934 PTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1974



 Score = 87.4 bits (214), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 17/335 (5%), Positives = 49/335 (14%), Gaps = 1/335 (0%)

Query: 37   RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96
            +  S +P       +      E         + +   + +        +   T   +   
Sbjct: 1372 KAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEP 1431

Query: 97   EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
             P      S   +   +   +      ++      +                +     D 
Sbjct: 1432 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1491

Query: 157  SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
                      +                             +         +         
Sbjct: 1492 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1551

Query: 217  YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLED 276
                       +   + S   +           +                P+        
Sbjct: 1552 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1611

Query: 277  GSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKG 336
              E        P  +   +      +     +  T        E     I          
Sbjct: 1612 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1671

Query: 337  RGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                   S +   S  +             + P+ 
Sbjct: 1672 PSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1705



 Score = 85.1 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/342 (6%), Positives = 53/342 (15%), Gaps = 3/342 (0%)

Query: 24   SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
                            S +P    E    +  +          +   S   +  D+ +  
Sbjct: 1669 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS 1728

Query: 84   PKSSV---TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
             + +     +      EP      S   +   +   +         T ++    + +   
Sbjct: 1729 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 1788

Query: 141  REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR 200
                    +     D           D+                            +   
Sbjct: 1789 PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 1848

Query: 201  GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                  +   E                    + S   +           +          
Sbjct: 1849 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1908

Query: 261  VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                  P+          E        P  +   +      +     +  T        E
Sbjct: 1909 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSE 1968

Query: 321  EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 I                 S +   S +   S      
Sbjct: 1969 TPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 2010



 Score = 80.8 bits (197), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 19/304 (6%), Positives = 53/304 (17%), Gaps = 3/304 (0%)

Query: 24   SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
                            S +P    E    +  +          +   S   +  D+ +  
Sbjct: 1712 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS 1771

Query: 84   PKSSVTSKENI---FLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
             + + + +        EP      S   +   +   +         T ++    + +   
Sbjct: 1772 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 1831

Query: 141  REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR 200
                    +     D           D+                            +   
Sbjct: 1832 PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 1891

Query: 201  GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                  +   E                    + S   +           +          
Sbjct: 1892 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1951

Query: 261  VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                  P  +       +  +  P+  P  +   +      +     +  T        +
Sbjct: 1952 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 2011

Query: 321  EGNP 324
            E  P
Sbjct: 2012 EPTP 2015



 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 13/303 (4%), Positives = 43/303 (14%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 1714 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 1774 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           +                       
Sbjct: 1834 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTP 1893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +                    +   + S   +           +
Sbjct: 1894 SDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPT 1953

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P+          E        P  +   +      +     +  
Sbjct: 1954 PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 2013

Query: 311  TFV 313
            T  
Sbjct: 2014 TPS 2016



 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/275 (6%), Positives = 39/275 (14%)

Query: 88   VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
                +    EP      S   +   +   +         T ++    + +          
Sbjct: 1368 PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1427

Query: 148  VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
             +     D           D+                            +         +
Sbjct: 1428 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1487

Query: 208  ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
               E                    + S   +           +                P
Sbjct: 1488 PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1547

Query: 268  KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
            +          E        P  +   +      +     +  T        E     I 
Sbjct: 1548 EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIP 1607

Query: 328  EGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                            S +   S +   S      
Sbjct: 1608 TDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1642



 Score = 73.1 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/270 (5%), Positives = 39/270 (14%)

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQH 152
                            +   +   +         T ++    +      E     + T  
Sbjct: 1367 QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 1426

Query: 153  EYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEH 212
              D           D+              P+ +    +     +         +   E 
Sbjct: 1427 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEP 1486

Query: 213  HLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRR 272
                                     +           +                P  +  
Sbjct: 1487 TPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1546

Query: 273  LLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVF 332
              E            P  +   +      +     +  T        +E  P        
Sbjct: 1547 PEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1606

Query: 333  INKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                       S +   S +   S      
Sbjct: 1607 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPS 1636



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/356 (6%), Positives = 53/356 (14%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +      E      P+E +       E         + +
Sbjct: 1751 TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1810

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S    +      P      S   +   +   +         T + 
Sbjct: 1811 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSE 1870

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
               +              +     D           D+          I +         
Sbjct: 1871 TPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 1930

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                          +           +
Sbjct: 1931 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT 1990

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +                 P      T   +     G   + 
Sbjct: 1991 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPTPTTTPTPTPSTTPTSGSGGSG 2050

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
                G        P               +     +   S       G     ++G
Sbjct: 2051 GSGGGGGGGGGTVPTSPTPTPTSKPTSTPAPTEIEEPTPSDVPGAIGGEHRAYLRG 2106



 Score = 65.4 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/253 (5%), Positives = 36/253 (14%)

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                   +         ++      + T    D           D+              
Sbjct: 1354 DWYLNRISGYVVIQPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPT 1413

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            P+ +    +     +         +   E                          +    
Sbjct: 1414 PSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDE 1473

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
                   +                P  +    E            P  +   +      +
Sbjct: 1474 PTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSD 1533

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 +  T     +E    +    E               S +   S +   S      
Sbjct: 1534 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1593

Query: 363  VIKGDIPMIDNAF 375
                     +   
Sbjct: 1594 DEPTPSETPEEPI 1606


>gi|281416568|ref|ZP_06247588.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum JW20]
 gi|281407970|gb|EFB38228.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum JW20]
          Length = 1790

 Score = 88.9 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/350 (8%), Positives = 63/350 (18%), Gaps = 3/350 (0%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEIL--ERQFNKLEQAILQVEKQNQKSLH 73
             E TP       E     +     S +P    E    +      E    +  ++   +  
Sbjct: 1142 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 1201

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNK-HKKLANILSVQGKSRTNTNLS 132
             S +   SD P  S     +    P      S            +         T ++  
Sbjct: 1202 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEP 1261

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
              +      +  + S   +    +          D+              P+     S  
Sbjct: 1262 TPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1321

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                  T       +   E                         +            +  
Sbjct: 1322 PEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPS 1381

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                          P  +       +  +  P+  P  +   +      +     E    
Sbjct: 1382 DEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSETPEE 1441

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 E    +               + +           +E +   +  
Sbjct: 1442 PTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPTPSDEPT 1491



 Score = 87.0 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/353 (7%), Positives = 60/353 (16%), Gaps = 1/353 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E           +    + +  P       +      E         ++ 
Sbjct: 1059 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1118

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNK-HKKLANILSVQGKSRTNT 129
                   D  SD P  S     +    P      S            +         T +
Sbjct: 1119 PEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPS 1178

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
            +    +      E     + T    D           D+              P+ +   
Sbjct: 1179 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 1238

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
             +     +         +   E                          +           
Sbjct: 1239 PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 1298

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +                P  +    E            P  +   +      +     + 
Sbjct: 1299 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1358

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             T     +E    +    E               S +   S +   S+  +  
Sbjct: 1359 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1411



 Score = 86.6 bits (212), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/359 (8%), Positives = 62/359 (17%), Gaps = 3/359 (0%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEIL--ERQFNKLEQAILQVEKQNQKSLH 73
             E TP       E     +     S +P    E    +      E    +  ++   +  
Sbjct: 1105 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 1164

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILR-SNKHKKLANILSVQGKSRTNTNLS 132
             S +   SD P  S     +    P       I   +   +   +         T ++  
Sbjct: 1165 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1224

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
              +      E     + T    D           D+              P+ +    + 
Sbjct: 1225 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIP 1284

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +         +   E                          +           +  
Sbjct: 1285 TDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPS 1344

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                          P  +    E            P  +   +      +     +  T 
Sbjct: 1345 DEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTP 1404

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                +E    +    E               S         ++                
Sbjct: 1405 SETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEP 1463



 Score = 84.7 bits (207), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/336 (5%), Positives = 55/336 (16%)

Query: 27   YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKS 86
               +         +      + I     +       +    ++ +        E+     
Sbjct: 990  PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1049

Query: 87   SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
               +  +        + S     +     +        + T ++    +      +  + 
Sbjct: 1050 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTP 1109

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFY 206
            S                   D+              P+     S        T       
Sbjct: 1110 SDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEP 1169

Query: 207  SALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR 266
            +   E                          +           +                
Sbjct: 1170 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1229

Query: 267  PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI 326
            P  +    E            P  +   +      +     +  T     +E    +   
Sbjct: 1230 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPS 1289

Query: 327  GEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             E               S +   S +   S+  +  
Sbjct: 1290 DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1325



 Score = 83.9 bits (205), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/345 (5%), Positives = 56/345 (16%), Gaps = 1/345 (0%)

Query: 27   YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKS 86
               +         +      + I     +       +    ++ +        E+     
Sbjct: 1027 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1086

Query: 87   SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
               +  +        + S     +     +        + T ++    +      +  + 
Sbjct: 1087 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTP 1146

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFY 206
            S                   D+              P+     S        T       
Sbjct: 1147 SDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEP 1206

Query: 207  SALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR 266
            +   E                         +            +                
Sbjct: 1207 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1266

Query: 267  PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI 326
            P  +       +  +  P+  P  +   +      +     +  T        E     I
Sbjct: 1267 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1326

Query: 327  GEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                             S +   S  +             + P+ 
Sbjct: 1327 PTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1370



 Score = 82.4 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/319 (5%), Positives = 52/319 (16%)

Query: 44   RLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSI 103
              P +    +    +    +    ++ +        +   P  +              + 
Sbjct: 964  PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 1023

Query: 104  SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
            S     +     ++  +              +      +  + S       + + S    
Sbjct: 1024 SDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1083

Query: 164  IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                               P+     S            +   +   E            
Sbjct: 1084 EPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1143

Query: 224  LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                         +            +                P  +    E        
Sbjct: 1144 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPS 1203

Query: 284  PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                P  +   +      +     +  T     +E    +    E               
Sbjct: 1204 DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTP 1263

Query: 344  SGKILWSLQQEKSQGLKGL 362
            S +   S +   S+  +  
Sbjct: 1264 SDEPTPSDEPTPSETPEEP 1282



 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/320 (5%), Positives = 52/320 (16%)

Query: 37   RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96
            +   +K    + I     +       +    ++ +        E+        +  +   
Sbjct: 963  QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1022

Query: 97   EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
                 + S     +     +        + T ++    +      +  + S         
Sbjct: 1023 PSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1082

Query: 157  SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
                      D+              P+     S        T       +   E     
Sbjct: 1083 EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1142

Query: 217  YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLED 276
                                 +           +                P+        
Sbjct: 1143 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1202

Query: 277  GSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKG 336
              E        P  +   +      +     E     +      +      E        
Sbjct: 1203 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1262

Query: 337  RGQSSILSGKILWSLQQEKS 356
                   S +   S   E+ 
Sbjct: 1263 PSDEPTPSDEPTPSETPEEP 1282



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 14/289 (4%), Positives = 39/289 (13%)

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
                K +        +  +        + S     +     +        + T ++    
Sbjct: 964  PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 1023

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
            +      +  + S                   D+              P+     S    
Sbjct: 1024 SDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 1083

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                T       +   E                          +           +    
Sbjct: 1084 EPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1143

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                        P+          E        P  +   +              +    
Sbjct: 1144 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPS 1203

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
             +    +      E               S      +  +         
Sbjct: 1204 DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPS 1252



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/273 (7%), Positives = 51/273 (18%), Gaps = 2/273 (0%)

Query: 28   EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
            E   +      E+ +  +P +    +    ++     E         S +   S+ P+  
Sbjct: 1223 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1282

Query: 88   VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
            + +  +   +    S                 S +              +       S  
Sbjct: 1283 IPT--DTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDE 1340

Query: 148  VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
                 E   S  P  + E   S      +         +                 +   
Sbjct: 1341 PTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1400

Query: 208  ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
              +     +  +                   + + +      +                P
Sbjct: 1401 EPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETP 1460

Query: 268  KITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
            +      E     +  PS  P     +      
Sbjct: 1461 EEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPS 1493



 Score = 68.5 bits (165), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/354 (9%), Positives = 61/354 (17%), Gaps = 7/354 (1%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEIL--ERQFNKLEQAILQVEKQNQKSLH 73
             E TP                   S +P    E    +      E    +  ++   +  
Sbjct: 1228 DEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 1287

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
             S +   SD P  S     +    P      S                            
Sbjct: 1288 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT----- 1342

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
             +      +  + S                   D+              P+     S   
Sbjct: 1343 PSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1402

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                     +   +   E                      +              E+ + 
Sbjct: 1403 TPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEE 1462

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV 313
                 +   S              S+          ++                   T  
Sbjct: 1463 PTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPTPTTTPTPTPSTTPTSG 1522

Query: 314  LGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
             G      G    G G V  +     +S  +     +  +E +       I G+
Sbjct: 1523 SGGSGGSGGGGGGGGGTVPTSPTPTPTSKPTSTPAPTEIEEPTPSDVPGAIGGE 1576



 Score = 63.9 bits (153), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/247 (4%), Positives = 32/247 (12%)

Query: 117  NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
                ++  S         +      +  + S       + + S                 
Sbjct: 963  QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1022

Query: 177  AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
                  P+     S            +   +   E                         
Sbjct: 1023 PSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1082

Query: 237  KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
            +            +                P  +    E            P  +   + 
Sbjct: 1083 EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1142

Query: 297  NIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
                 +     E     +      +      E               S      +  +  
Sbjct: 1143 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1202

Query: 357  QGLKGLV 363
                   
Sbjct: 1203 SDEPTPS 1209



 Score = 63.5 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/253 (4%), Positives = 33/253 (13%)

Query: 111  KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
            +   +         + T ++    +      +  + S                   D+  
Sbjct: 963  QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1022

Query: 171  LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
                        P+     S        T       +   E                   
Sbjct: 1023 PSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1082

Query: 231  VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
                   +           +                P+          E        P  
Sbjct: 1083 EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1142

Query: 291  DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
            +   +              +     +    +      E          ++          
Sbjct: 1143 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1202

Query: 351  LQQEKSQGLKGLV 363
              +          
Sbjct: 1203 SDEPTPSDEPTPS 1215


>gi|195426379|ref|XP_002061312.1| GK20794 [Drosophila willistoni]
 gi|194157397|gb|EDW72298.1| GK20794 [Drosophila willistoni]
          Length = 1416

 Score = 88.5 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/361 (9%), Positives = 79/361 (21%), Gaps = 11/361 (3%)

Query: 19  TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
           TPE ++         +   LE+     P    E +     +   + E +++ S     + 
Sbjct: 316 TPECKNFPLVRDIGDLITTLEAGSAPEPSSEPESKSEPSSEPKSEPETKSEPSSEPKSEP 375

Query: 79  KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
           +    P S   S+     EP     S      K +  +   S         +      S 
Sbjct: 376 ETKSEPSSEPKSEPETKSEPSSEPKSEPSAEPKSEPTSEPSSEPSSEPKTKSEPTSEPSS 435

Query: 139 RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +           E  S  S     + +                      +       K
Sbjct: 436 EPKSEPESKSEPTSEPSSEPSSEPKTKSE-PSAEPTSEPSSEPSSEPKSEPTSEPSSDPK 494

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
           T+   +                       +             I       +     V  
Sbjct: 495 TKSEPTAEPTSEPTSEPSAEPTSEPSSEPSAKTKRVANHDDHLIDGVQSVATSVSYRVSS 554

Query: 259 KNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKE 318
           K+  S  +    +   E  +      S++  +    +   +       + ++T     K 
Sbjct: 555 KSGRSRRQAPEPKSEPEAAAPEPEPESSVKTSPEPKSEPESAAPEPEPEASATTSPEPKS 614

Query: 319 IEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK--GDIPMIDNAFS 376
             E +                S   S +     +    +      +K   ++   +    
Sbjct: 615 EPESSAP--------EPEPEASVKNSPEPKSEPKSSAPEPEPESSVKKSANLEAPERKLK 666

Query: 377 A 377
            
Sbjct: 667 L 667



 Score = 42.3 bits (97), Expect = 0.18,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 25/93 (26%), Gaps = 1/93 (1%)

Query: 51  ERQFNKLEQAILQVEKQN-QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRS 109
               ++ E A  + E +    +    K + ES  P+    +      EP+    SS    
Sbjct: 587 PEPKSEPESAAPEPEPEASATTSPEPKSEPESSAPEPEPEASVKNSPEPKSEPKSSAPEP 646

Query: 110 NKHKKLANILSVQGKSRTNTNLSPKNFSCRLRE 142
                +    +++   R                
Sbjct: 647 EPESSVKKSANLEAPERKLKLNPYTPRHDFNPM 679



 Score = 38.1 bits (86), Expect = 3.6,   Method: Composition-based stats.
 Identities = 10/95 (10%), Positives = 23/95 (24%)

Query: 59  QAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
               + E ++       +    +     S         EP     +S    ++ K  A  
Sbjct: 586 SPEPKSEPESAAPEPEPEASATTSPEPKSEPESSAPEPEPEASVKNSPEPKSEPKSSAPE 645

Query: 119 LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHE 153
              +   + + NL       +L            +
Sbjct: 646 PEPESSVKKSANLEAPERKLKLNPYTPRHDFNPMD 680


>gi|315611788|ref|ZP_07886710.1| alpha-L-fucosidase FucA [Streptococcus sanguinis ATCC 49296]
 gi|315316203|gb|EFU64233.1| alpha-L-fucosidase FucA [Streptococcus sanguinis ATCC 49296]
          Length = 2041

 Score = 86.6 bits (212), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 37/402 (9%), Positives = 103/402 (25%), Gaps = 11/402 (2%)

Query: 1    MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVAR-RLESMKPRLPK--EILERQFNKL 57
            M      I++ V  L  N  E +  + E A  ++A  +    +  + +  E    Q +KL
Sbjct: 1612 MASLTEAIEKKVGELGSNN-EAKKKLVEIADQAIAAIQEAKTQEAVNQALETALEQISKL 1670

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
            E A  +   + +      K  +     +    ++     +P   +        +      
Sbjct: 1671 EAAQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQPAQPEKPAQPETPAQPE 1730

Query: 118  ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL----RR 173
              +   +       +      +  + ++ S   +   +   +  +    +K       RR
Sbjct: 1731 TPAQPEQPAQPEQPAQPEKPAQPEKPITSSSPEEGVKNLVFTLPSLEIVNKPVPFKTIRR 1790

Query: 174  GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                                          +     +E    +  V  +     ++G   
Sbjct: 1791 ENAQLDKGKEQVLSEGKDGILVEYVEVDGDNRKVVKTETTPAQDRVIEVGTKQSSVGTEA 1850

Query: 234  SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
                +        + E     +  ++ V   +    +  ++                D  
Sbjct: 1851 PPVVTLPEHPLPAQPEKPITSSSPEEGVKDLVFTLPSLEIVNKPVPFKTIRRENAQLDKG 1910

Query: 294  NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                ++        E        +++ +      + RV     +  S       + +L +
Sbjct: 1911 KEQVLSEGKDGILVEYVEVDGDNRKVVQTEITPAQDRVIEVGSKQSSVGTEAPPVVTLPE 1970

Query: 354  ---EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
                +        +  +    D     + T+K + +  L  T
Sbjct: 1971 YVLPRETEKPAPAVTDNSSAKDEKAPVTATVKEDKERELPAT 2012


>gi|158294235|ref|XP_315475.4| AGAP005471-PA [Anopheles gambiae str. PEST]
 gi|157015470|gb|EAA11731.4| AGAP005471-PA [Anopheles gambiae str. PEST]
          Length = 5295

 Score = 86.6 bits (212), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/390 (8%), Positives = 80/390 (20%), Gaps = 9/390 (2%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRL---PKEILERQFNKLEQAILQVEKQNQKSLHT 74
             T E ++   + A     +    ++ +     K+ +       EQA      +   S   
Sbjct: 950  KTSEVKAAEIKSAEAVKVQETVKVEQKEVKESKKKIPEPIKLTEQATKTAGDKGPDSPKK 1009

Query: 75   SKQDKESDIPKSSVTSKE--NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             K  K    P     +        EP+     +     K  +          S+    + 
Sbjct: 1010 GKTPKTPKSPSPKKEAVPFKPKPEEPKKIVEPAKTVPAKPAEPTKPEKSVEASKPAEPIK 1069

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                  + +   +   +   E    V      E  K+         +    T        
Sbjct: 1070 VDKPVEQSKLAETVKTSKPVESPKPVETPKPAEPVKTVKPAEPAKPVEPVKTTKSSEEAK 1129

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG----SITHFLRR 248
                             +E                                 S    +  
Sbjct: 1130 KPAEPAKTVKPVESPKAAEPLPEPTKPSKPAEPIAKPVEQAKATPEPPKKVVSEPVKVEA 1189

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                      + V +    K T               T P+A+    S    +     ++
Sbjct: 1190 PKATQPAKAPEPVKAPEPTKPTETPKPVQEPAKPAEPTKPLANKPAESPKVAEPAKVEEQ 1249

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
             +      K  ++ +           K   +  +       +   +  +  K       +
Sbjct: 1250 PARRPDSPKSAKKASSPKKTSPPKEPKKVPEPVVPKPVEKKTESVKVQEQKKTETTTATV 1309

Query: 369  PMIDNAFSASMTLKCNADISLSITHVMEIM 398
                 +F    T+      +       ++ 
Sbjct: 1310 QKASESFKQVETVTTRKGRTTPAAVSEDVS 1339



 Score = 64.6 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/256 (7%), Positives = 51/256 (19%), Gaps = 5/256 (1%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
            P  TP+    +        A+ +E +K     E         E A      ++ K+    
Sbjct: 1094 PVETPKPAEPVKTVKPAEPAKPVEPVKTTKSSEEA---KKPAEPAKTVKPVESPKAAEPL 1150

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             +  +   P   +                 +    K +        +           K 
Sbjct: 1151 PEPTKPSKPAEPIAKPVEQAKATPEPPKKVVSEPVKVEAPKATQPAKAPEPVKAPEPTKP 1210

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                             +  ++    +    + +++         S  +     S     
Sbjct: 1211 TETPKPVQEPAKPAEPTKPLANKPAESPKVAEPAKVEEQPARRPDSPKSAKKASSPKKTS 1270

Query: 196  FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
              K    +               V +          + +  +        +   +   G 
Sbjct: 1271 PPKEPKKVPEPVVPKPVEKKTESVKVQEQK--KTETTTATVQKASESFKQVETVTTRKGR 1328

Query: 256  VDKKNVFSGIRPKITR 271
                 V   + P    
Sbjct: 1329 TTPAAVSEDVSPVEGA 1344



 Score = 63.9 bits (153), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/356 (8%), Positives = 70/356 (19%), Gaps = 12/356 (3%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
             + E      E A+             LP+    +     E     VE+         K 
Sbjct: 1123 KSSEEAKKPAEPAKTVKPVESPKAAEPLPE--PTKPSKPAEPIAKPVEQAKATPEPPKKV 1180

Query: 78   DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
              E    ++   ++     EP      +                +         +     
Sbjct: 1181 VSEPVKVEAPKATQPAKAPEPVKAPEPTKPTETPKPVQEPAKPAEPTKPLANKPAESPKV 1240

Query: 138  CRLREILSFSVNTQHEYDSSVSPVAA----------IEHDKSRLRRGKLAGIFSFPTGSI 187
                ++            S+    +              +    +  +            
Sbjct: 1241 AEPAKVEEQPARRPDSPKSAKKASSPKKTSPPKEPKKVPEPVVPKPVEKKTESVKVQEQK 1300

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                      K          ++          +   +    G      + +        
Sbjct: 1301 KTETTTATVQKASESFKQVETVTTRKGRTTPAAVSEDVSPVEGAVEQKSREEALNRKLEE 1360

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
              + +   + +      +  +  RR  E  S  ++        +F               
Sbjct: 1361 IYAREKATLAEAKRIRELEEQEIRRKFEQRSIREIQQIKETATEFLQQIAATRNLVQSVL 1420

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
            E ST     +  +        G    N      +   G    S Q+  S G +G  
Sbjct: 1421 ETSTEPRVPQVTKAATSAAASGGEGNNSQPNSGAGQEGSSDQSAQEAGSGGDQGAA 1476



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/327 (7%), Positives = 77/327 (23%), Gaps = 7/327 (2%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            I + V+   + TPE    +       V     +   + P+ +   +  K  +    V++ 
Sbjct: 1163 IAKPVE-QAKATPEPPKKVVSE-PVKVEAPKATQPAKAPEPVKAPEPTKPTETPKPVQEP 1220

Query: 68   NQKSLHT-----SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
             + +  T        +       + V  +     +    +  +                +
Sbjct: 1221 AKPAEPTKPLANKPAESPKVAEPAKVEEQPARRPDSPKSAKKASSPKKTSPPKEPKKVPE 1280

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                       ++   + ++    +  T  +   S   V  +   K R     ++   S 
Sbjct: 1281 PVVPKPVEKKTESVKVQEQKKTETTTATVQKASESFKQVETVTTRKGRTTPAAVSEDVSP 1340

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
              G++         N+    +      +     +        +             +   
Sbjct: 1341 VEGAVEQKSREEALNRKLEEIYAREKATLAEAKRIRELEEQEIRRKFEQRSIREIQQIKE 1400

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
            T     + +       ++V          ++ +  +           +   + +     +
Sbjct: 1401 TATEFLQQIAATRNLVQSVLETSTEPRVPQVTKAATSAAASGGEGNNSQPNSGAGQEGSS 1460

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEG 329
                 E  +         +     GE 
Sbjct: 1461 DQSAQEAGSGGDQGAAPNQSEQSAGEQ 1487



 Score = 41.5 bits (95), Expect = 0.35,   Method: Composition-based stats.
 Identities = 37/326 (11%), Positives = 73/326 (22%), Gaps = 14/326 (4%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P   PE               +       L  +  E           +VE+Q  +
Sbjct: 1196 AKAPEPVKAPEPTKPTETPKPVQEPAKPAEPTKPLANKPAESPKVAE---PAKVEEQPAR 1252

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + K  K++  PK   +  +     P       + +  +  K+      +  + T   
Sbjct: 1253 RPDSPKSAKKASSPK-KTSPPKEPKKVPEPVVPKPVEKKTESVKVQEQKKTETTTATVQK 1311

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             S                      +       A+E         +          +    
Sbjct: 1312 ASESFKQVETVTTRKGRTTPAAVSEDVSPVEGAVEQKSREEALNRKLEEIYAREKATLAE 1371

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE- 249
                   + + +   +   S   + +        L         +     + T     + 
Sbjct: 1372 AKRIRELEEQEIRRKFEQRSIREIQQIKETATEFLQQIAATRNLVQSVLETSTEPRVPQV 1431

Query: 250  ---------SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                     S   GN  + N  +G      +   E GS  D G +       A     + 
Sbjct: 1432 TKAATSAAASGGEGNNSQPNSGAGQEGSSDQSAQEAGSGGDQGAAPNQSEQSAGEQGGSA 1491

Query: 301  KNYIGGDENSTFVLGKKEIEEGNPLI 326
             +  G D N      K+         
Sbjct: 1492 GSNNGNDGNGDREDKKRTPPPLQLPT 1517


>gi|71421620|ref|XP_811847.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70876557|gb|EAN89996.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 503

 Score = 86.2 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/346 (7%), Positives = 65/346 (18%), Gaps = 4/346 (1%)

Query: 24  SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
           + +      SV     +  P  P   +         A             +      + +
Sbjct: 156 ASVPAPPTASVPAPPTTSVPAPPTASVPAPPTASVPAPPTA-SVPAPPTTSVPAPPTASV 214

Query: 84  PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
           P     S             ++ + +     +    +    +   T++     +      
Sbjct: 215 PAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPP 274

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLL 203
            +           +    +      + +       + + PT S+               +
Sbjct: 275 TTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTTSVPAPPTTSVPAPPTASVPAPPTASV 334

Query: 204 SFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG---SITHFLRRESLDGGNVDKKN 260
                 S        V       +    + S+                 +    +V    
Sbjct: 335 PAPPTTSVPAPPTTSVPAPPTASVPAPPTASVPAPPTTSLPAPPTASVPAPPTASVPAPP 394

Query: 261 VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
             S   P  T       + V   P+T   A    +        +     ++         
Sbjct: 395 TTSVPAPPTTSVPAPPTASVPAPPTTSLPAPPTTSVPAPPTTSLPAPPTASVPAPPTASV 454

Query: 321 EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
              P                +        +       G +    K 
Sbjct: 455 PAPPTASVPAPPTASVPAPPTASVPAPPTTSVPAPPTGPRSGGAKA 500



 Score = 85.4 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/350 (6%), Positives = 54/350 (15%), Gaps = 4/350 (1%)

Query: 26  IYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPK 85
           +      SV     +  P  P   +         A             +      + +P 
Sbjct: 150 VPAPPTASVPAPPTASVPAPPTTSVPAPPTASVPAPPTA-SVPAPPTASVPAPPTTSVPA 208

Query: 86  SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ-GKSRTNTNLSPKNFSCRLREIL 144
               S             ++ + +     +    +       T +  +P   S       
Sbjct: 209 PPTASVPAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTA 268

Query: 145 SFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLS 204
           S          +  +         S       +      T        +     T  + +
Sbjct: 269 SVPAPPTTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTTSVPAPPTTSVPAPPTASVPA 328

Query: 205 FYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSG 264
             +A                   A   +        S+                    + 
Sbjct: 329 PPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTASVPAPPTTSLPAPPTASVPAPPTA 388

Query: 265 IRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP 324
             P      +       V            T+++            T  L          
Sbjct: 389 SVPAPPTTSVPAPPTTSVPAPPTASVPAPPTTSLPAPPTTSVPAPPTTSLPAPPTASVPA 448

Query: 325 LIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                                  + +             +        + 
Sbjct: 449 PPTASV--PAPPTASVPAPPTASVPAPPTASVPAPPTTSVPAPPTGPRSG 496



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/276 (5%), Positives = 39/276 (14%), Gaps = 4/276 (1%)

Query: 26  IYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPK 85
           +      SV     +  P  P   +         A             +      + +P 
Sbjct: 230 VPAPPTTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTA-SVPAPPTTSVPAPPTASVPA 288

Query: 86  SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILS 145
              TS             ++ + +     +    +    +      +             
Sbjct: 289 PPTTSVPAPPTTSVPAPPTTSVPAPPTTSVPAPPTASVPAP---PTASVPAPPTTSVPAP 345

Query: 146 FSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
            + +      +SV                      S P             +      + 
Sbjct: 346 PTTSVPAPPTASVPAPPTASVPAPPTTSLPAPPTASVPAPPTASVPAPPTTSVPAPPTTS 405

Query: 206 YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
             A     +       +         +          T  +                   
Sbjct: 406 VPAPPTASVPAPPTTSLPAPPTTSVPAPPTTSLPAPPTASVPAPPTASVPAPPTASVPAP 465

Query: 266 RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
                              S         +      
Sbjct: 466 PTASVPAPPTASVPAPPTTSVPAPPTGPRSGGAKAS 501



 Score = 58.9 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/235 (7%), Positives = 46/235 (19%), Gaps = 1/235 (0%)

Query: 24  SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
           + +      SV     +  P  P   +         A             +      + +
Sbjct: 268 ASVPAPPTTSVPAPPTASVPAPPTTSVPAPPTTSVPAPPTT-SVPAPPTTSVPAPPTASV 326

Query: 84  PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
           P     S             ++ + +     +    +    +   T+L     +      
Sbjct: 327 PAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTASVPAPPTTSLPAPPTASVPAPP 386

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLL 203
            +           +    +      + +       + + PT S+               +
Sbjct: 387 TASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTTSLPAPPTTSVPAPPTTSLPAPPTASV 446

Query: 204 SFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
                 S        V       +    + S+     +           GG    
Sbjct: 447 PAPPTASVPAPPTASVPAPPTASVPAPPTASVPAPPTTSVPAPPTGPRSGGAKAS 501



 Score = 41.5 bits (95), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/181 (7%), Positives = 39/181 (21%), Gaps = 1/181 (0%)

Query: 24  SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
           + +      SV     +  P  P   +         A             +      + +
Sbjct: 324 ASVPAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTA-SVPAPPTTSLPAPPTASV 382

Query: 84  PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
           P     S             ++ + +     +    +    +   T++     +      
Sbjct: 383 PAPPTASVPAPPTTSVPAPPTTSVPAPPTASVPAPPTTSLPAPPTTSVPAPPTTSLPAPP 442

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLL 203
            +           +    +      + +     A + + PT S+            +   
Sbjct: 443 TASVPAPPTASVPAPPTASVPAPPTASVPAPPTASVPAPPTTSVPAPPTGPRSGGAKASF 502

Query: 204 S 204
           S
Sbjct: 503 S 503


>gi|329123013|ref|ZP_08251584.1| IgA-specific serine endopeptidase [Haemophilus aegyptius ATCC 11116]
 gi|327471944|gb|EGF17384.1| IgA-specific serine endopeptidase [Haemophilus aegyptius ATCC 11116]
          Length = 1802

 Score = 85.8 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/374 (5%), Positives = 94/374 (25%), Gaps = 11/374 (2%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDK 79
            PE                  +M+   P      +       I +VE         +  + 
Sbjct: 992  PEVEKRNLTTVDTPSIATPNNMQADAPSVPSNNEE------IARVEAPVPLPAPATPSET 1045

Query: 80   ESDIPKSSVTSKENIFLEPRLRSISSIL---RSNKHKKLANILSVQGKSRTNTNLSPKNF 136
               + ++S    + I    +  + ++      + + K      +   +   + + + +  
Sbjct: 1046 TETVSENSPQESKTIAKNEQDATETTAQNGEVAQEAKPSVEANTQTNEVAQSGSETEETQ 1105

Query: 137  SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
            +         +   +   ++ ++       + + + + ++       + +          
Sbjct: 1106 TTETARQPEINSTEETAVENGLTSSEPRTEETATVEKDEIQEAPQMASQAS-PKQAEPAP 1164

Query: 197  NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
             K            +         +      +     +        T+      +   N 
Sbjct: 1165 EKVSTDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKTNAEPVTPVVSENQ 1224

Query: 257  DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
             +K V      + T ++  + ++     ++        +  +  +  +  ++  T     
Sbjct: 1225 AEKKVSQPTETEKTAKVETEKTQEAPKVTSQVSPKQEQSETVQPQAELESEKVPTV-NNA 1283

Query: 317  KEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFS 376
            +   +  P               ++  +  I  + ++      + +    D    +    
Sbjct: 1284 EAQPQTQPSATVSTEQPAPENSINTGSATAIKETAEKSDKPKTETVATTEDDRQPEANTV 1343

Query: 377  ASMTLKCNADISLS 390
            A  ++  N+     
Sbjct: 1344 ADNSVANNSTSVKP 1357



 Score = 63.1 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/351 (7%), Positives = 67/351 (19%), Gaps = 24/351 (6%)

Query: 32   NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH-----TSKQDKESDIPKS 86
             +V   L S +PR  +                VEK   +         S +  E    K 
Sbjct: 1121 TAVENGLTSSEPRTEET-------------ATVEKDEIQEAPQMASQASPKQAEPAPEKV 1167

Query: 87   SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
            S  +K                 +       N    +         +              
Sbjct: 1168 STDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKTNAEPVTPVVSENQAEK 1227

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRG-KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
             V+   E + +         +  ++          S                        
Sbjct: 1228 KVSQPTETEKTAKVETEKTQEAPKVTSQVSPKQEQSETVQPQAELESEKVPTVNNAEAQP 1287

Query: 206  YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
             +  S     +       +   +        +            + D    +   V    
Sbjct: 1288 QTQPSATVSTEQPAPENSINTGSATAIKETAEKSDKPKTETVATTEDDRQPEANTVADNS 1347

Query: 266  RPKITRRLLEDGSEVDVGPSTIPVADFANT-----SNIAFKNYIGGDENSTFVLGKKEIE 320
                +  +    +        +  +   NT      N         +  S+    +++  
Sbjct: 1348 VANNSTSVKPTENSSTKAERPVTESTTVNTGNSVVENPENTTQPAVNSKSSEPKSRRKRS 1407

Query: 321  EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
               P              ++++ S +        +S        +  I   
Sbjct: 1408 ISQPQETSTEETTVTSTEKTTVTSTEKTTIADNSESSNKPNNRRRRSISQP 1458


>gi|319775076|ref|YP_004137564.1| Iga1 protease type 2 [Haemophilus influenzae F3047]
 gi|317449667|emb|CBY85873.1| Iga1 protease type 2 [Haemophilus influenzae F3047]
          Length = 1802

 Score = 85.8 bits (210), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/374 (5%), Positives = 94/374 (25%), Gaps = 11/374 (2%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDK 79
            PE                  +M+   P      +       I +VE         +  + 
Sbjct: 992  PEVEKRNLTTVDTPSIATPNNMQADAPSVPSNNEE------IARVEAPVPLPAPATPSET 1045

Query: 80   ESDIPKSSVTSKENIFLEPRLRSISSIL---RSNKHKKLANILSVQGKSRTNTNLSPKNF 136
               + ++S    + I    +  + ++      + + K      +   +   + + + +  
Sbjct: 1046 TETVSENSPQESKTIAKNEQDATETTAQNGEVAQEAKPSVEANTQTNEVAQSGSETEETQ 1105

Query: 137  SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
            +         +   +   ++ ++       + + + + ++       + +          
Sbjct: 1106 TTETARQPEINSTEETAVENGLTSSEPRTEETATVEKDEIQEAPQMASQAS-PKQAEPAP 1164

Query: 197  NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
             K            +         +      +     +        T+      +   N 
Sbjct: 1165 EKVSTDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKTNAEPVTPVVSENQ 1224

Query: 257  DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
             +K V      + T ++  + ++     ++        +  +  +  +  ++  T     
Sbjct: 1225 AEKKVSQPTETEKTAKVETEKTQEAPKVTSQVSPKQEQSETVQPQAELESEKVPTV-NNA 1283

Query: 317  KEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFS 376
            +   +  P               ++  +  I  + ++      + +    D    +    
Sbjct: 1284 EAQPQTQPSATVSTEQPAPENSINTGSATAIKETAEKSDKPKTETVATTEDDRQPEANTV 1343

Query: 377  ASMTLKCNADISLS 390
            A  ++  N+     
Sbjct: 1344 ADNSVANNSTSVKP 1357



 Score = 63.1 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/351 (7%), Positives = 67/351 (19%), Gaps = 24/351 (6%)

Query: 32   NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH-----TSKQDKESDIPKS 86
             +V   L S +PR  +                VEK   +         S +  E    K 
Sbjct: 1121 TAVENGLTSSEPRTEET-------------ATVEKDEIQEAPQMASQASPKQAEPAPEKV 1167

Query: 87   SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
            S  +K                 +       N    +         +              
Sbjct: 1168 STDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKTNAEPVTPVVSENQAEK 1227

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRG-KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
             V+   E + +         +  ++          S                        
Sbjct: 1228 KVSQPTETEKTAKVETEKTQEAPKVTSQVSPKQEQSETVQPQAELESEKVPTVNNAEAQP 1287

Query: 206  YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
             +  S     +       +   +        +            + D    +   V    
Sbjct: 1288 QTQPSATVSTEQPAPENSINTGSATAIKETAEKSDKPKTETVATTEDDRQPEANTVADNS 1347

Query: 266  RPKITRRLLEDGSEVDVGPSTIPVADFANT-----SNIAFKNYIGGDENSTFVLGKKEIE 320
                +  +    +        +  +   NT      N         +  S+    +++  
Sbjct: 1348 VANNSTSVKPTENSSTKAERPVTESTTVNTGNSVVENPENTTQPAVNSKSSEPKSRRKRS 1407

Query: 321  EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
               P              ++++ S +        +S        +  I   
Sbjct: 1408 ISQPQETSTEETTVTSTEKTTVTSTEKTTIADNSESSNKPNNRRRRSISQP 1458


>gi|331220085|ref|XP_003322718.1| hypothetical protein PGTG_04255 [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
 gi|309301708|gb|EFP78299.1| hypothetical protein PGTG_04255 [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
          Length = 3279

 Score = 85.1 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/363 (6%), Positives = 75/363 (20%), Gaps = 3/363 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                  E  P+      + A         + +        + Q    E      E +   
Sbjct: 2394 TAPQESEPAPQESESAPQEADPVPQESEPAPQEPEST-PHDSQPAPQEAETAPQESEPAP 2452

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEP-RLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                S   +    P+ S T+ +     P   +      +S            +   + + 
Sbjct: 2453 QETESAPQEAESAPQESETAHQEPQSAPQDTQPAPQEAKSAPQDSQPAPQEAESAPQESE 2512

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
            +   +  S       +         +S  +P  +    +      + + +      S   
Sbjct: 2513 SAPQEPESAPQEAESAPQDPQPAPQESEPAPQESESAPQEAEPVPQESELAPQEPESTPQ 2572

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                              A  E                 +     +   +   T    + 
Sbjct: 2573 DSQPAPQEAEAAPQESEPAPQESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQP 2632

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +        +      +         + +  +  P+   +      +  A +      ++
Sbjct: 2633 APQEAEAAPQESEPAPQESEPAPQEPESAPQEAEPAPQELDPAPQDTQPAPQEAESAPQD 2692

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
            S       +                    + +    +     + E +    G   +   P
Sbjct: 2693 SQPAPQDSQPAPQEAETAPQESESAPQESEPASQEPETAPR-EAESAPQESGPAPQESKP 2751

Query: 370  MID 372
            + +
Sbjct: 2752 VPE 2754



 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/381 (5%), Positives = 71/381 (18%), Gaps = 8/381 (2%)

Query: 19   TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
             P+      + A  +      + +        E +    +      E +           
Sbjct: 2346 APQESEPAPQEAETAPQESESAPQEPES-APQEAESAPQDPQPALQESETAPQESEPAPQ 2404

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISS---ILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            +    P+ +    +     P+    +         + +          +   +     ++
Sbjct: 2405 ESESAPQEADPVPQESEPAPQEPESTPHDSQPAPQEAETAPQESEPAPQETESAPQEAES 2464

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                         +   +   +     +   D     +   +      +           
Sbjct: 2465 APQESETAHQEPQSAPQDTQPAPQEAKSAPQDSQPAPQEAESAPQESESAPQEPESAPQE 2524

Query: 196  FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
                          SE    +          +      +  + + +              
Sbjct: 2525 AESAPQDPQPAPQESEPAPQESESAPQEAEPVPQESELAPQEPESTPQDSQPAPQEAEAA 2584

Query: 256  VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
              +            +       E +  P    +A     S          +  +     
Sbjct: 2585 PQESEPAPQESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQES 2644

Query: 316  KKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS----LQQEKSQGLKGLVIKGDIPMI 371
            +   +E  P   E      +       L      +     + E +        +   P  
Sbjct: 2645 EPAPQESEPAPQEPESAPQEAEPAPQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAP 2704

Query: 372  DNAFSASMTLKCNADISLSIT 392
              A +A    +     S   +
Sbjct: 2705 QEAETAPQESESAPQESEPAS 2725



 Score = 80.8 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/423 (6%), Positives = 78/423 (18%), Gaps = 1/423 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                  E  P+      + A         + +   P         +  +   Q  +   +
Sbjct: 2303 TAPQESEPAPQESESAPQEAEPVPQESEPAPQEPEPAPQEPETAPQESEPAPQEAETAPQ 2362

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               ++ Q+ ES   ++    ++         +          +  +         + +  
Sbjct: 2363 ESESAPQEPESAPQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEADPVPQESEP 2422

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
               +  S       +         +S  +P       +      + +        S    
Sbjct: 2423 APQEPESTPHDSQPAPQEAETAPQESEPAPQETESAPQEAESAPQESETAHQEPQSAPQD 2482

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                             A  E                +                     +
Sbjct: 2483 TQPAPQEAKSAPQDSQPAPQEAESAPQESESAPQEPESAPQEAESAPQDPQPAPQESEPA 2542

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                    +      +         + +  D  P+          S  A +      + +
Sbjct: 2543 PQESESAPQEAEPVPQESELAPQEPESTPQDSQPAPQEAEAAPQESEPAPQESEPAPQET 2602

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                 + E       +            Q +    +     + E +        +     
Sbjct: 2603 KSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQ-ESEPAPQESEPAPQEPESA 2661

Query: 371  IDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDS 430
               A  A   L      +       E      + +        + +      S S   +S
Sbjct: 2662 PQEAEPAPQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAPQEAETAPQESESAPQES 2721

Query: 431  NIF 433
               
Sbjct: 2722 EPA 2724



 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/360 (5%), Positives = 68/360 (18%), Gaps = 1/360 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
             P++ P+      + A+++      + +        E +    E      E ++      
Sbjct: 2475 EPQSAPQDTQPAPQEAKSAPQDSQPAPQEAES-APQESESAPQEPESAPQEAESAPQDPQ 2533

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
                +    P+ S ++ +     P+   ++     +  +           +   +  +P+
Sbjct: 2534 PAPQESEPAPQESESAPQEAEPVPQESELAPQEPESTPQDSQPAPQEAEAAPQESEPAPQ 2593

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
                  +E  S     +     S       +      +        +             
Sbjct: 2594 ESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQESEPAPQESEP 2653

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               +            +                      S    + S       E+    
Sbjct: 2654 APQEPESAPQEAEPAPQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAPQEAETAPQE 2713

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
            +            +      E  S           +        +               
Sbjct: 2714 SESAPQESEPASQEPETAPREAESAPQESGPAPQESKPVPEVPESASQEAESAPQEAEPA 2773

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
             ++     +      +   +  +              + E +        +        A
Sbjct: 2774 PQESKPAHHEPESASQEPESAPQDPQPAPQDPQPALEEPESTPQESEPAPQEAESAPQEA 2833



 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/370 (5%), Positives = 68/370 (18%), Gaps = 3/370 (0%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
             + V    E+ P+      + ++ +      + +   P     +   +  ++  +  +  
Sbjct: 1925 SKPVPEESESAPQEPEPAPQDSQPAPQEPESAPQDPQPALQEAQTAPQQSESAPREAEPV 1984

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +    + Q+ ES   +   T +++        +      S   +        +   +  
Sbjct: 1985 PQESEPAPQEPESAPQEPKSTPQDSQPAPQEAETAPQPSESAPREAEPFPQESEPAPQEP 2044

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                 +  +       +         +S  +P       +      +        + +  
Sbjct: 2045 EPAPQEPETAPQESEPAPQETESALQESESAPQEPESVPQEAESAPQDPQPALQESETAP 2104

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                                                              + +       
Sbjct: 2105 QESEPAPQESESAPQEANPVPQASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQESETA 2164

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                                  +       E +  P     A                + 
Sbjct: 2165 PQEPQSAPPDTQPAPQEAESAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQESESAPQEP 2224

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
             S     K   ++  P + E      +                + E          +   
Sbjct: 2225 ESAPQEAKSAPQDSQPALQEFETAPQESEPAPQESESAPQ---EAESVPQESESAPQEPE 2281

Query: 369  PMIDNAFSAS 378
                 A SA 
Sbjct: 2282 SAPQEAESAP 2291



 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/423 (5%), Positives = 72/423 (17%), Gaps = 3/423 (0%)

Query: 12   VDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
            V    E  P+        ++ +      +     P+E                    +  
Sbjct: 2124 VPQASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPPDTQPAPQEAE 2183

Query: 72   LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                         +++    E    E       S     + +          +       
Sbjct: 2184 SAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQESESAPQEPESAPQEAKSAPQDSQPALQ 2243

Query: 132  SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
              +            S +   E +S      +   +     +   +           +  
Sbjct: 2244 EFETAPQESEPAPQESESAPQEAESVPQESESAPQEPESAPQEAESAPQDPQPALQEFET 2303

Query: 192  HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                              +E    +                 +  +S+ +          
Sbjct: 2304 APQESEPAPQESESAPQEAEPVPQESEPAPQEPEPAPQEPETAPQESEPAPQEAETAPQE 2363

Query: 252  DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
                  +            +       E +  P     A   + S     + +  +    
Sbjct: 2364 SESAPQEPESAPQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEADPVPQESEPA 2423

Query: 312  FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                +    +  P   E      +                + E +        +      
Sbjct: 2424 PQEPESTPHDSQPAPQEAETAPQESEPAPQETESAPQ---EAESAPQESETAHQEPQSAP 2480

Query: 372  DNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSN 431
             +   A    K     S       E      + +        + +     +      +S 
Sbjct: 2481 QDTQPAPQEAKSAPQDSQPAPQEAESAPQESESAPQEPESAPQEAESAPQDPQPAPQESE 2540

Query: 432  IFV 434
               
Sbjct: 2541 PAP 2543



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/370 (5%), Positives = 69/370 (18%), Gaps = 5/370 (1%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
             ++     +  P+      + + ++  +  ES          + Q    E      E ++
Sbjct: 2490 AKSAPQDSQPAPQEAESAPQESESAP-QEPESAPQEAESAPQDPQPAPQESEPAPQESES 2548

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS---ILRSNKHKKLANILSVQGKS 125
                      +    P+   ++ ++    P+    +         + +          + 
Sbjct: 2549 APQEAEPVPQESELAPQEPESTPQDSQPAPQEAEAAPQESEPAPQESEPAPQETKSAPQE 2608

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                    +      +     S     E +++         +     +   +        
Sbjct: 2609 AEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQESEPAPQESEPAPQEPESAPQEAEPA 2668

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                    S+                      +  +S+ +    
Sbjct: 2669 PQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAPQEAETAPQESESAPQESEPASQEP 2728

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                        +          +         E +  P     A   +           
Sbjct: 2729 ETAPREAESAPQESGPAPQESKPVPEVPESASQEAESAPQEAEPAPQESKPAHHEPESAS 2788

Query: 306  GDENSTFVLGKKEIEEGNPLIGE-GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
             +  S     +   ++  P + E                S       + E +        
Sbjct: 2789 QEPESAPQDPQPAPQDPQPALEEPESTPQESEPAPQEAESAPQEAEQESESAPQEAEPSP 2848

Query: 365  KGDIPMIDNA 374
            +        A
Sbjct: 2849 QEPKSAPQEA 2858



 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/381 (6%), Positives = 69/381 (18%), Gaps = 1/381 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A     E  P  +          ++ +     P   +   +   +  +++    E+    
Sbjct: 1876 AEPAPQEAEPVPQESKPAPQETELSPQESESAPLEAESAPQESGSAPQESKPVPEESESA 1935

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
                    ++S        S           + ++  +S    + A  +  + +      
Sbjct: 1936 PQEPEPAPQDSQPAPQEPESAPQDPQPALQEAQTAPQQSESAPREAEPVPQESEPAPQEP 1995

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             S         +    +                      +            P       
Sbjct: 1996 ESAPQEPKSTPQDSQPAPQEAETAPQPSESAPREAEPFPQESEPAPQEPEPAPQEPETAP 2055

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
              +    +        S  +                           +        +   
Sbjct: 2056 QESEPAPQETESALQESESAPQEPESVPQEAESAPQDPQPALQESETAPQESEPAPQESE 2115

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  +     S   P+       D         T P       S  A +       ++
Sbjct: 2116 SAPQEANPVPQASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPPDT 2175

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                 + E    +               + +    + +   + E +        +     
Sbjct: 2176 QPAPQEAESAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQ-ESESAPQEPESAPQEAKSA 2234

Query: 371  IDNAFSASMTLKCNADISLSI 391
              ++  A    +     S   
Sbjct: 2235 PQDSQPALQEFETAPQESEPA 2255



 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/369 (5%), Positives = 67/369 (18%), Gaps = 4/369 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPK-EILERQFNKLEQAILQVEKQNQ 69
            A     +  P  +        +  A +     P+  +    E +    +      E +  
Sbjct: 2525 AESAPQDPQPAPQESEPAPQESESAPQEAEPVPQESELAPQEPESTPQDSQPAPQEAEAA 2584

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                     +    P+ + ++ +     P+   ++     +  +           +   +
Sbjct: 2585 PQESEPAPQESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQES 2644

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
              +P+      +E  S     +             +               +        
Sbjct: 2645 EPAPQESEPAPQEPESAPQEAEPAPQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAP 2704

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                    ++          S+                +                  +  
Sbjct: 2705 QEAETAPQESESAPQESEPASQEPETAPREA-ESAPQESGPAPQESKPVPEVPESASQEA 2763

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                   +     S           ++       P   P                     
Sbjct: 2764 ESAPQEAEPAPQESKPAHHEPESASQEPESAPQDPQPAPQDPQPALEEPESTPQESEPAP 2823

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
                   +E E+ +    +      +    +   +       + E +        +    
Sbjct: 2824 QEAESAPQEAEQESESAPQEAEPSPQEPKSAPQEAEPAPQ--ESEPAPQEAESAPQESES 2881

Query: 370  MIDNAFSAS 378
                + SA 
Sbjct: 2882 GPQESESAP 2890



 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/331 (6%), Positives = 66/331 (19%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
             PE+ P+      + ++ +      + +P          F +  +   Q  +   +   T
Sbjct: 1994 EPESAPQEPKSTPQDSQPAPQEAETAPQPSESAPREAEPFPQESEPAPQEPEPAPQEPET 2053

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            + Q+ E    ++    +E+        S+     S        +   +   + +     +
Sbjct: 2054 APQESEPAPQETESALQESESAPQEPESVPQEAESAPQDPQPALQESETAPQESEPAPQE 2113

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
            + S           +     +   +P  +    +               T          
Sbjct: 2114 SESAPQEANPVPQASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPP 2173

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                           S+    +                    +S+ +             
Sbjct: 2174 DTQPAPQEAESAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQESESAPQEPESAPQEAKS 2233

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                            +       E +  P         + S          +  S    
Sbjct: 2234 APQDSQPALQEFETAPQESEPAPQESESAPQEAESVPQESESAPQEPESAPQEAESAPQD 2293

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSG 345
             +  ++E      E      +          
Sbjct: 2294 PQPALQEFETAPQESEPAPQESESAPQEAEP 2324



 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/357 (5%), Positives = 66/357 (18%), Gaps = 3/357 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
             PE+ P+      +  + ++     + +   P         +    + Q  +   +   +
Sbjct: 2078 EPESVPQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEANPVPQASEPAPQEPES 2137

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            +  D +    ++     +    E               +          +         +
Sbjct: 2138 TPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPPDTQPAPQEAESAPQDSQPAPQEAE 2197

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
                        +     E +S+     +   +     +     +  F T          
Sbjct: 2198 AAPQESEPAPQEAEPVPQESESAPQEPESAPQEAKSAPQDSQPALQEFETAPQESEPAPQ 2257

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                           SE    +                 ++ + + +             
Sbjct: 2258 ESESAPQEAESVPQESESAPQEPESAPQEAESAPQDPQPALQEFETAPQESEPAPQESES 2317

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               +            +       E +  P     A     +          +  S    
Sbjct: 2318 APQEAEPVPQESEPAPQEPEPAPQEPETAPQESEPAPQEAETAPQESESAPQEPESAPQE 2377

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             +   ++  P + E      +                + +          +      
Sbjct: 2378 AESAPQDPQPALQESETAPQESEPAPQESESAPQ---EADPVPQESEPAPQEPESTP 2431



 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/368 (5%), Positives = 70/368 (19%), Gaps = 16/368 (4%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKE----ILERQFNKLEQAILQVEK 66
                  E  P+      + A         + +             ++           E 
Sbjct: 2102 TAPQESEPAPQESESAPQEANPVPQASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQES 2161

Query: 67   QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
            +       S        P+ + ++ ++    P+    +        ++   +      + 
Sbjct: 2162 ETAPQEPQSAPPDTQPAPQEAESAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQESESAP 2221

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA------------AIEHDKSRLRRG 174
                 +P+      ++        +     S                   E + +     
Sbjct: 2222 QEPESAPQEAKSAPQDSQPALQEFETAPQESEPAPQESESAPQEAESVPQESESAPQEPE 2281

Query: 175  KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS 234
                           ++  +         +   + S     +               +  
Sbjct: 2282 SAPQEAESAPQDPQPALQEFETAPQESEPAPQESESAPQEAEPVPQESEPAPQEPEPAPQ 2341

Query: 235  IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
              ++    +    +E+       +                    +  +  S     +   
Sbjct: 2342 EPETAPQESEPAPQEAETAPQESESAPQEPESAPQEAESAPQDPQPALQESETAPQESEP 2401

Query: 295  TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
                +       D          +  E  P   +      +   Q S  + +   S  QE
Sbjct: 2402 APQESESAPQEADPVPQESEPAPQEPESTPHDSQPAPQEAETAPQESEPAPQETESAPQE 2461

Query: 355  KSQGLKGL 362
                 +  
Sbjct: 2462 AESAPQES 2469



 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/433 (6%), Positives = 83/433 (19%), Gaps = 13/433 (3%)

Query: 15   LPENTPERRSHIYEHARNSVA------RRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
             PE+ P+      + ++ ++       +  E           E +    E      E ++
Sbjct: 2223 EPESAPQEAKSAPQDSQPALQEFETAPQESEPAPQESESAPQEAESVPQESESAPQEPES 2282

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
                  S         +   T+ +     P+    +        ++          +   
Sbjct: 2283 APQEAESAPQDPQPALQEFETAPQESEPAPQESESAPQEAEPVPQESEPAPQEPEPAPQE 2342

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +P+      +E  +    ++       S     E      +        +       
Sbjct: 2343 PETAPQESEPAPQEAETAPQESESAPQEPESAPQEAESAPQDPQPALQESETAPQESEPA 2402

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKY---FVFLIILLGMAIGVSYSIGKSKGSITHF 245
                     +   +        +                         +  +++ +    
Sbjct: 2403 PQESESAPQEADPVPQESEPAPQEPESTPHDSQPAPQEAETAPQESEPAPQETESAPQEA 2462

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                        +            +       +    P     A   + S         
Sbjct: 2463 ESAPQESETAHQEPQSAPQDTQPAPQEAKSAPQDSQPAPQEAESAPQESESAPQEPESAP 2522

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSS----ILSGKILWSLQQEKSQGLKG 361
             +  S     +   +E  P   E      +                      + +     
Sbjct: 2523 QEAESAPQDPQPAPQESEPAPQESESAPQEAEPVPQESELAPQEPESTPQDSQPAPQEAE 2582

Query: 362  LVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTD 421
               +   P    +  A    K     +  +    E+    PK +        + +     
Sbjct: 2583 AAPQESEPAPQESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQ 2642

Query: 422  NSPSVLIDSNIFV 434
             S     +S    
Sbjct: 2643 ESEPAPQESEPAP 2655



 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/356 (5%), Positives = 59/356 (16%), Gaps = 10/356 (2%)

Query: 19   TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
             P+      +   +++     + +        E +    +      E +           
Sbjct: 2054 APQESEPAPQETESALQESESAPQEPES-VPQEAESAPQDPQPALQESETAPQESEPAPQ 2112

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
            +    P+ +    +     P          S  H         +           +    
Sbjct: 2113 ESESAPQEANPVPQASEPAP------QEPESTPHDSQPAPQEAETAPHQPAPQESETAPQ 2166

Query: 139  RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
              +     +     E +S+         +     +                         
Sbjct: 2167 EPQSAPPDTQPAPQEAESAPQDSQPAPQEAEAAPQESEPAPQEAEPVPQESESAPQEPES 2226

Query: 199  TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
                       S+  L ++                +  +++                  +
Sbjct: 2227 APQEAKSAPQDSQPALQEFETAPQESEPAPQESESAPQEAESVPQESESAPQEPESAPQE 2286

Query: 259  KNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKE 318
                        +       E +  P     A                +        +  
Sbjct: 2287 AESAPQDPQPALQEFETAPQESEPAPQESESAPQEAEPVPQESEPAPQEPEPAPQEPETA 2346

Query: 319  IEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
             +E  P   E      +                + E +       ++        +
Sbjct: 2347 PQESEPAPQEAETAPQESESAPQEPESAPQ---EAESAPQDPQPALQESETAPQES 2399



 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/424 (6%), Positives = 79/424 (18%), Gaps = 4/424 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
              E  P+        A         + +   P         +  +   Q  +   +   +
Sbjct: 2015 EAETAPQPSESAPREAEPFPQESEPAPQEPEPAPQEPETAPQESEPAPQETESALQESES 2074

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            + Q+ ES   ++    ++         +          +  +         + +     +
Sbjct: 2075 APQEPESVPQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEANPVPQASEPAPQE 2134

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
              S       +        +  +         +                +          
Sbjct: 2135 PESTPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPPDTQPAPQEAESAPQDSQPAPQ 2194

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                           +E    +                 +   S+ ++  F         
Sbjct: 2195 EAEAAPQESEPAPQEAEPVPQESESAPQEPESAPQEAKSAPQDSQPALQEFETAPQESEP 2254

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               +          + +       E +  P     A       +        +       
Sbjct: 2255 APQESESAPQEAESVPQESESAPQEPESAPQEAESAPQDPQPALQEFETAPQESEPAPQE 2314

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL----QQEKSQGLKGLVIKGDIPM 370
             +   +E  P+  E      +              S     + E +        +     
Sbjct: 2315 SESAPQEAEPVPQESEPAPQEPEPAPQEPETAPQESEPAPQEAETAPQESESAPQEPESA 2374

Query: 371  IDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDS 430
               A SA    +     S +     E      + +      + + S        S   DS
Sbjct: 2375 PQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEADPVPQESEPAPQEPESTPHDS 2434

Query: 431  NIFV 434
                
Sbjct: 2435 QPAP 2438



 Score = 73.1 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/347 (6%), Positives = 61/347 (17%), Gaps = 6/347 (1%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLP------KEILERQFNKLEQAILQVEKQN 68
              E  P+      + A         + +              E +    E      E + 
Sbjct: 2594 ESEPAPQETKSAPQEAEPVPQESELAPQEPKSTPQDSQPAPQEAEAAPQESEPAPQESEP 2653

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
                  S   +    P+    + ++    P+    +        +           +   
Sbjct: 2654 APQEPESAPQEAEPAPQELDPAPQDTQPAPQEAESAPQDSQPAPQDSQPAPQEAETAPQE 2713

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            +  +P+      +E  +     +     S       +               +       
Sbjct: 2714 SESAPQESEPASQEPETAPREAESAPQESGPAPQESKPVPEVPESASQEAESAPQEAEPA 2773

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    ++         +  +            L         S    + + +     
Sbjct: 2774 PQESKPAHHEPESASQEPESAPQDPQPAPQDPQPALEEPESTPQESEPAPQEAESAPQEA 2833

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E        +            +       E +  P     A   + S          + 
Sbjct: 2834 EQESESAPQEAEPSPQEPKSAPQEAEPAPQESEPAPQEAESAPQESESGPQESESAPQEL 2893

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
            + T          G       +                   S+ Q  
Sbjct: 2894 DPTPQEPLVNAAVGMKPALTPKTLSELHLATFLSTPPVSSTSVPQPP 2940



 Score = 70.4 bits (170), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/349 (5%), Positives = 60/349 (17%), Gaps = 3/349 (0%)

Query: 17   ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
            E   +      E           S +        + +   ++      E +         
Sbjct: 1827 EQALQLPRSPEELESKPTTDLEVSREGVPHDGTQDSESTSIDAEAAPQEAEPAPQEAEPV 1886

Query: 77   QDKESDIPKSSVTSKENIFLEP---RLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
              +    P+ +  S +     P         S     + K +        +         
Sbjct: 1887 PQESKPAPQETELSPQESESAPLEAESAPQESGSAPQESKPVPEESESAPQEPEPAPQDS 1946

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
            +                  E  ++     +   +   + +          +         
Sbjct: 1947 QPAPQEPESAPQDPQPALQEAQTAPQQSESAPREAEPVPQESEPAPQEPESAPQEPKSTP 2006

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                            SE    +   F             +  + + +            
Sbjct: 2007 QDSQPAPQEAETAPQPSESAPREAEPFPQESEPAPQEPEPAPQEPETAPQESEPAPQETE 2066

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV 313
              + +          + +       +          A   +            + N    
Sbjct: 2067 SALQESESAPQEPESVPQEAESAPQDPQPALQESETAPQESEPAPQESESAPQEANPVPQ 2126

Query: 314  LGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
              +   +E      + +    +        + +   +  QE        
Sbjct: 2127 ASEPAPQEPESTPHDSQPAPQEAETAPHQPAPQESETAPQEPQSAPPDT 2175



 Score = 55.8 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/315 (6%), Positives = 62/315 (19%)

Query: 43   PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
            P     +  +     E      E +  K   + + D             ++        S
Sbjct: 1721 PESKASVAPQDIPIPESKASMTEPETGKQDDSLRLDLGHADTAPPSPLDKSSPEGHESIS 1780

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                  S      A   +    ++T      +     +  + +  +    +   S   + 
Sbjct: 1781 ALGSSESVVAPVDATETTSASVAQTIQPSGDRQLQIEIESLDNHDMEQALQLPRSPEELE 1840

Query: 163  AIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI 222
            +       + R  +    +  + S                        E         L 
Sbjct: 1841 SKPTTDLEVSREGVPHDGTQDSESTSIDAEAAPQEAEPAPQEAEPVPQESKPAPQETELS 1900

Query: 223  ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDV 282
                 +  +       +        +   +      +      +         + +  D 
Sbjct: 1901 PQESESAPLEAESAPQESGSAPQESKPVPEESESAPQEPEPAPQDSQPAPQEPESAPQDP 1960

Query: 283  GPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
             P+          S  A +      + S     + E     P              +++ 
Sbjct: 1961 QPALQEAQTAPQQSESAPREAEPVPQESEPAPQEPESAPQEPKSTPQDSQPAPQEAETAP 2020

Query: 343  LSGKILWSLQQEKSQ 357
               +      +   Q
Sbjct: 2021 QPSESAPREAEPFPQ 2035



 Score = 41.5 bits (95), Expect = 0.35,   Method: Composition-based stats.
 Identities = 11/325 (3%), Positives = 60/325 (18%), Gaps = 1/325 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
              E   +        A ++      + +   P   +  +    E      E +       
Sbjct: 2720 ESEPASQEPETAPREAESAPQESGPAPQESKPVPEVP-ESASQEAESAPQEAEPAPQESK 2778

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
                +     +   ++ ++    P+    +     +  ++          +        +
Sbjct: 2779 PAHHEPESASQEPESAPQDPQPAPQDPQPALEEPESTPQESEPAPQEAESAPQEAEQESE 2838

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
            +             +   E + +         +     +   +G     +          
Sbjct: 2839 SAPQEAEPSPQEPKSAPQEAEPAPQESEPAPQEAESAPQESESGPQESESAPQELDPTPQ 2898

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                   +    +   +     +    +    ++         +  +             
Sbjct: 2899 EPLVNAAVGMKPALTPKTLSELHLATFLSTPPVSSTSVPQPPINLSANGKAWPAAPAVSN 2958

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               +  + + ++   T       +      +T                       ++   
Sbjct: 2959 VHREVILPARMKKISTISTSSARTLFMKDLATFAFPFSPPQPLTRKPVINSEAPTTSPTG 3018

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQ 339
                         +        R +
Sbjct: 3019 PTSPPPRAPQPHHQNTSSSPSTRAK 3043


>gi|195342490|ref|XP_002037833.1| GM18084 [Drosophila sechellia]
 gi|194132683|gb|EDW54251.1| GM18084 [Drosophila sechellia]
          Length = 14551

 Score = 85.1 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/309 (8%), Positives = 59/309 (19%), Gaps = 28/309 (9%)

Query: 91    KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNT 150
                    P    + +I    +    +    V   +   T +S +     +         T
Sbjct: 11157 PSPQPANPEKPGVVNIPSVPQPVYPSPQPPVYHVNYATTPVSQQPGVVNIPSAHRPVPPT 11216

Query: 151   QHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALS 210
                     SP       +  +          +PT        NY   ++           
Sbjct: 11217 SQRPVFVTSPGNPTPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNI 11276

Query: 211   EHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKIT 270
                    +      +      S       G I                  + S   P   
Sbjct: 11277 PSLPSPAYPAPNPPVNYPTPPSPQKPVQPGVINIPSAPHPATPPQHPPVFIPSPESPSTA 11336

Query: 271   RRLLEDGSEVDVGPSTIPVADFANTSN------------------IAFKNYIGGDENS-- 310
              +      +V+       +       N                   +  +   G +    
Sbjct: 11337 PKPGAPVYDVNYPTPPSAIPHQPGVVNIPSVPPPPPPVMQRPVFVPSPAHPTPGPQPGVV 11396

Query: 311   --TFVLGKKEIEEGNPLIGEGR---VFINKGRGQSSILSGKILWSLQQEKSQGL---KGL 362
                 V+        +P++       V+      +  +++            Q        
Sbjct: 11397 NIPSVVQPVHPTYQSPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPSP 11456

Query: 363   VIKGDIPMI 371
             V+    P  
Sbjct: 11457 VLHIPAPRP 11465



 Score = 83.1 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/328 (6%), Positives = 48/328 (14%), Gaps = 10/328 (3%)

Query: 45    LPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS 104
                +    +   +       +               +  P S      NI    R    +
Sbjct: 11157 PSPQPANPEKPGVVNIPSVPQPVYPSPQPPVYHVNYATTPVSQQPGVVNIPSAHRPVPPT 11216

Query: 105   SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
             S              + Q       ++S   +      I   +  T          V  I
Sbjct: 11217 SQRPVFVTSPGNPTPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNI 11276

Query: 165   EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
                 S         +      S    V     N                           
Sbjct: 11277 PSLPSPAYPAPNPPVNYPTPPSPQKPVQPGVINIPSAPHPATPPQHPPVFIPSPESPSTA 11336

Query: 225   LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                   V      +  S                           +               
Sbjct: 11337 PKPGAPVYDVNYPTPPSAIPHQPGVVNIPSVPPPPPPVMQRPVFVPSPAHPTPGPQPGVV 11396

Query: 285   STIPVADFANTSNIAFKNYIGG------DENSTFVLGKKEIEEGNP--LIGEGRVFINKG 336
             +   V    + +  +                 +            P   + +  +++   
Sbjct: 11397 NIPSVVQPVHPTYQSPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPSP 11456

Query: 337   RGQSSILSG--KILWSLQQEKSQGLKGL 362
                          + S+ Q         
Sbjct: 11457 VLHIPAPRPVIHNIPSVPQPTYTHRNPP 11484



 Score = 65.8 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/318 (7%), Positives = 56/318 (17%), Gaps = 25/318 (7%)

Query: 18    NTPERRSHIYEHARNSVARRLESMKPRLP--KEILERQFNKLEQAILQVEKQNQKSL--- 72
              +P+   +   +A   V+++   +             Q      +        Q  +   
Sbjct: 11181 PSPQPPVYHVNYATTPVSQQPGVVNIPSAHRPVPPTSQRPVFVTSPGNPTPTPQPGVINI 11240

Query: 73    HTSKQDKESDIPKSS-----VTSKENIFLEPR----LRSISSILRSNKHKKLANILSVQG 123
              +  Q                T++  I  +P         S    +       N  +   
Sbjct: 11241 PSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSLPSPAYPAPNP--PVNYPTPPS 11298

Query: 124   KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
               +          S                                +         +  P
Sbjct: 11299 PQKPVQPGVINIPSAPHPATPPQHPPVFIP-------SPESPSTAPKPGAPVYDVNYPTP 11351

Query: 184   TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
               +I                                      G+    S          +
Sbjct: 11352 PSAIPHQPGVVNIPSVPPPPPPVMQRPVFVPSPAHPTPGPQPGVVNIPSVVQPVHPTYQS 11411

Query: 244   HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
               + R ++            G+              V   P  +P       +     + 
Sbjct: 11412 PVVERPAIYDVYYPPPPSRPGV--INIPSPPRPVYPVPQQPIYVPSPVLHIPAPRPVIHN 11469

Query: 304   IGGDENSTFVLGKKEIEE 321
             I      T+      I++
Sbjct: 11470 IPSVPQPTYTHRNPPIQD 11487


>gi|161086926|ref|NP_067375.3| proteoglycan 4 isoform 1 [Mus musculus]
          Length = 1221

 Score = 84.7 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/376 (6%), Positives = 54/376 (14%), Gaps = 5/376 (1%)

Query: 18  NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
             PE  +               + K   P    E +   L++      K+ + +     +
Sbjct: 450 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPE 509

Query: 78  DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
                 P+ +   +            +         K     + +    T          
Sbjct: 510 PTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 569

Query: 138 CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS-----VH 192
                            +   +     E    +             T             
Sbjct: 570 KEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTLKEPE 629

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +     +     +     +                 +  K     T      +  
Sbjct: 630 PTTPKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 689

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                                          P                K           
Sbjct: 690 KEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 749

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMID 372
              +KE E   P   E                                   +      I 
Sbjct: 750 PTTRKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQ 809

Query: 373 NAFSASMTLKCNADIS 388
           N    +     ++D S
Sbjct: 810 NKPEETTPASEDSDDS 825



 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/346 (6%), Positives = 52/346 (15%), Gaps = 3/346 (0%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
              PE  +               + K   P    E +    ++      K+ + +     
Sbjct: 473 PKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP 532

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
           +      P+ +   +            +         K     + +    T         
Sbjct: 533 EPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTT 592

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                     +                 +  +    +         P  +      +   
Sbjct: 593 PKEPEP---TTPKEPEPTTLKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTTKEPESTTR 649

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
            +           +     +                 +  K     T      +      
Sbjct: 650 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 709

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
                                      P                K               
Sbjct: 710 PTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPEPTTPKEPEPTTP 769

Query: 317 KEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
           KE E   P   E      K     +      + +  +E     +  
Sbjct: 770 KEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQNKPEET 815



 Score = 70.8 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 16/310 (5%), Positives = 49/310 (15%), Gaps = 3/310 (0%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
              PE  +               + K   P    E +    ++      K+ + +     
Sbjct: 513 PKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP 572

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
           +      P+ +   +            +         K     + +    T         
Sbjct: 573 EPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTLKEPEPTT 632

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                   +    +    +         +  +    +         P  +          
Sbjct: 633 PKEPEPTTTKEPESTTRKE---PEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 689

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
            +           +     +                 +  K     T      +      
Sbjct: 690 KEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 749

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
                                      P        +  +       +     +     +
Sbjct: 750 PTTRKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQ 809

Query: 317 KEIEEGNPLI 326
            + EE  P  
Sbjct: 810 NKPEETTPAS 819



 Score = 67.7 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/312 (6%), Positives = 51/312 (16%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
              PE  +               + K   P    E +    ++      K+ + +     
Sbjct: 521 PKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP 580

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
           +      P+ +   +            +         K     +++    T         
Sbjct: 581 EPTTLKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTT 640

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
           +                 +   +     E    +             T            
Sbjct: 641 TKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP 700

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
             T       +   +                    +    +                   
Sbjct: 701 EPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPEPTT 760

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
            K+   +  +        +         +T   A        A    I      T    +
Sbjct: 761 PKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQNKPEETTPASE 820

Query: 317 KEIEEGNPLIGE 328
              +    L  +
Sbjct: 821 DSDDSKTTLKPQ 832



 Score = 67.3 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/282 (7%), Positives = 43/282 (15%), Gaps = 4/282 (1%)

Query: 85  KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREIL 144
            ++    E    +    +          K+       + +  T     P           
Sbjct: 446 STTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTP 505

Query: 145 SFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLS 204
                T  +     +P                             +        T     
Sbjct: 506 KEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 565

Query: 205 FYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSG 264
             +                L             +          +  +     +    + 
Sbjct: 566 PTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTL 625

Query: 265 IRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF----VLGKKEIE 320
             P+ T     + +      ST        T            E +T         KE E
Sbjct: 626 KEPEPTTPKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE 685

Query: 321 EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
              P   E                       +    +  +  
Sbjct: 686 PTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPEPT 727



 Score = 57.3 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/350 (6%), Positives = 60/350 (17%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
              PE  +               + K   P  + E +    ++      K+ + +     
Sbjct: 577 PKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTLKEPEPTTPKEP 636

Query: 77  QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136
           +   +  P+S+   +            +         K     + +    T         
Sbjct: 637 EPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTT 696

Query: 137 SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                                 +     E    +             T            
Sbjct: 697 PKEPEPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEP 756

Query: 197 NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
             T       +   E                      +   +          ++      
Sbjct: 757 EPTTPKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQNKPEETT 816

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
                    +  +  +      +    P+  P    +       K        S      
Sbjct: 817 PASEDSDDSKTTLKPQKPTKAPKPTKKPTKAPKKPTSTKKPKTPKTRKPKTTPSPLKTTS 876

Query: 317 KEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
              E     +          +   +  + ++    +       +  +I G
Sbjct: 877 ATPELNTTPLEVMLPTTTIPKQTPNPETAEVNPDHEDADGGEGEKPLIPG 926



 Score = 52.7 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/340 (4%), Positives = 47/340 (13%)

Query: 23  RSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESD 82
           +       + + A+   S +    K++          A    +K    +        +  
Sbjct: 291 KQSSASKKKTTSAKETRSAEKTSDKDVEPTSTTPKNSAPTTTKKPVTTTKEPVPTTPKEP 350

Query: 83  IPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLRE 142
            P +                      + K  +       +  +      +         +
Sbjct: 351 EPTTPKEPPPTTKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPPPTTK 410

Query: 143 ILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGL 202
               +   + E  +   P      +       +                      K    
Sbjct: 411 KPEPTTPKEPEPTTPKEPEPTTTKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEP 470

Query: 203 LSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
            +                L                 +   T     E       +     
Sbjct: 471 TTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPK 530

Query: 263 SGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEG 322
                           E +      P                             +  E 
Sbjct: 531 EPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTLKEPEP 590

Query: 323 NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                       +    +            +  +      
Sbjct: 591 TTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTLKEPEP 630



 Score = 46.9 bits (109), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/302 (5%), Positives = 53/302 (17%), Gaps = 2/302 (0%)

Query: 6   LVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE 65
               +  ++     PE  +               + K   P    E +    ++      
Sbjct: 638 PTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP 697

Query: 66  KQNQKSLHTSKQDKESDIPKSSVTSKENI--FLEPRLRSISSILRSNKHKKLANILSVQG 123
           K+ + +     +      P+ +   +       EP   +      +   +          
Sbjct: 698 KEPEPTTPKEPEPTTPKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPE 757

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
            +                        T     +++          +     +     + P
Sbjct: 758 PTTPKEPEPTTPKEPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAPAEEIQNKPEETTP 817

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                         +        +        K                 +    K +  
Sbjct: 818 ASEDSDDSKTTLKPQKPTKAPKPTKKPTKAPKKPTSTKKPKTPKTRKPKTTPSPLKTTSA 877

Query: 244 HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                 +     +    +        T  +  D  + D G    P+              
Sbjct: 878 TPELNTTPLEVMLPTTTIPKQTPNPETAEVNPDHEDADGGEGEKPLIPGPPVLFPTAIPG 937

Query: 304 IG 305
             
Sbjct: 938 TD 939



 Score = 38.4 bits (87), Expect = 2.5,   Method: Composition-based stats.
 Identities = 16/327 (4%), Positives = 43/327 (13%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
               +  P+            L       ++ +  S   +  + +     +  +S     
Sbjct: 240 HSKVTTSPKTTAAKPVTPKPSLAPNSETSKEASLASNKETTVETKETTATNKQSSASKKK 299

Query: 96  LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
                 + S+   S+K  +  +         T                      T  E  
Sbjct: 300 TTSAKETRSAEKTSDKDVEPTSTTPKNSAPTTTKKPVTTTKEPVPTTPKEPEPTTPKEPP 359

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
            +          +      K     +                      +           
Sbjct: 360 PTTKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPPPTTKKPEPTTPKE 419

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
                                  +   T     E       +                  
Sbjct: 420 PEPTTPKEPEPTTTKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPT 479

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
              E +      P                             +  E             +
Sbjct: 480 TPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKE 539

Query: 336 GRGQSSILSGKILWSLQQEKSQGLKGL 362
               +            +  +      
Sbjct: 540 PEPTTPKEPEPTTPKEPEPTTPKEPEP 566


>gi|218658407|ref|ZP_03514337.1| hypothetical protein RetlI_01427 [Rhizobium etli IE4771]
          Length = 50

 Score = 84.7 bits (207), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 458 LEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSN 502
           +    +IDIPITYR+G++ L T++KG  G D F +AI +W    +
Sbjct: 1   MSTRNWIDIPITYRNGRRALLTMEKGGTGTDAFNTAIKEWTALGD 45


>gi|316939674|gb|ADU73708.1| cellulosome anchoring protein cohesin region [Clostridium
            thermocellum DSM 1313]
          Length = 1615

 Score = 84.3 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 18/352 (5%), Positives = 55/352 (15%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 873  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 932

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +         T ++
Sbjct: 933  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 992

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                + +           +     D           D+                      
Sbjct: 993  EPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1052

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                         +            +
Sbjct: 1053 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1112

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +              +
Sbjct: 1113 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEPIPT 1172

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 +    +      E               S +   S +   S+  +  
Sbjct: 1173 DTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1224



 Score = 84.3 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 18/353 (5%), Positives = 52/353 (14%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 830  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 889

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 890  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 949

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           D+                      
Sbjct: 950  PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1009

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                    + S   +           +
Sbjct: 1010 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1069

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1070 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1129

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
            T        E     I                 S      +  +         
Sbjct: 1130 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPS 1182



 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/352 (6%), Positives = 60/352 (17%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +      E      P+E +       E         + +
Sbjct: 965  TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1024

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S    +      P      S   +   +   +         T ++
Sbjct: 1025 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1084

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                +      E     + T    D           D+              P+ +    
Sbjct: 1085 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1144

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +     +         +                    +   + S   +           +
Sbjct: 1145 IPTDTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPT 1204

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P+          E        P  +   +      +     E  
Sbjct: 1205 PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1264

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                   E    +               + +           +E +   +  
Sbjct: 1265 EEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPTPSDEPT 1316



 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/349 (8%), Positives = 60/349 (17%), Gaps = 1/349 (0%)

Query: 28   EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
            E   +      E+ +  +P +    +    ++     E         S +   SD P  S
Sbjct: 797  EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 856

Query: 88   VTSKENIFLE-PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
             T +E I  + P      S   +   +   +         T +    +            
Sbjct: 857  ETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 916

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFY 206
              +     D           D+          I +               +         
Sbjct: 917  PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 976

Query: 207  SALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR 266
            +   E                          +           +                
Sbjct: 977  TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1036

Query: 267  PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI 326
            P  +    E            P  +   +      +     +  T        +E  P  
Sbjct: 1037 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSE 1096

Query: 327  GEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAF 375
                             S +   S +   S               +   
Sbjct: 1097 TPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1145



 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 16/335 (4%), Positives = 49/335 (14%), Gaps = 1/335 (0%)

Query: 37   RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96
            +  S +P       +      E         + +   +   ++       S     +   
Sbjct: 770  KAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 829

Query: 97   EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
             P      S   +   +   +      ++      +                +     D 
Sbjct: 830  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 889

Query: 157  SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
                      +                             +         +         
Sbjct: 890  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 949

Query: 217  YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLED 276
                       +   + S   +           +                P+        
Sbjct: 950  PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1009

Query: 277  GSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKG 336
              E        P  +   +      +     E     +      +      E        
Sbjct: 1010 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1069

Query: 337  RGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                   S +   S  +             + P+ 
Sbjct: 1070 PSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1103



 Score = 79.3 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/350 (6%), Positives = 49/350 (14%), Gaps = 2/350 (0%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEIL--ERQFNKLEQAILQVEKQNQKSLH 73
             E TP       E     +     S +P    E    +      E         ++    
Sbjct: 845  DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 904

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
                D  SD P  S     +    P      S   +        I +         +  P
Sbjct: 905  PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 964

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                           +     D           +                          
Sbjct: 965  TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1024

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
               +         +                    +   + S   +           +   
Sbjct: 1025 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1084

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV 313
                         P+          E        P  +   +      +     E     
Sbjct: 1085 EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEP 1144

Query: 314  LGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
            +      +      E            +           +          
Sbjct: 1145 IPTDTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS 1194



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 17/318 (5%), Positives = 47/318 (14%)

Query: 45   LPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS 104
                                   + +   + +     +   S    +      P      
Sbjct: 766  PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 825

Query: 105  SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
            S   +   +   +         T ++    + +           +     D         
Sbjct: 826  SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 885

Query: 165  EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
              D+                            +         +   E             
Sbjct: 886  PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 945

Query: 225  LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                   + S   +           +                P  +       +  +  P
Sbjct: 946  EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIP 1005

Query: 285  STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
            +  P  +   +      +     +  T        E     I                 S
Sbjct: 1006 TDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPS 1065

Query: 345  GKILWSLQQEKSQGLKGL 362
             +   S +   S      
Sbjct: 1066 DEPTPSDEPTPSDEPTPS 1083



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/284 (5%), Positives = 39/284 (13%), Gaps = 1/284 (0%)

Query: 88   VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
                +    EP      S   +   +   +         T +    +             
Sbjct: 766  PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 825

Query: 148  VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
             +     D           D+                            +         +
Sbjct: 826  SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 885

Query: 208  ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
               E                    + S   +           +                P
Sbjct: 886  PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 945

Query: 268  KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
            +          E        P  +   +      +     +  T        E     I 
Sbjct: 946  EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIP 1005

Query: 328  EGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                            S +   S  +             + P+ 
Sbjct: 1006 TDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1048



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/269 (5%), Positives = 38/269 (14%)

Query: 32   NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSK 91
            ++ +          P +                  +   S   +  +   +   +   S 
Sbjct: 1050 DTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSD 1109

Query: 92   ENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQ 151
            E    +    S                 S   +    T+      +       S +    
Sbjct: 1110 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEP 1169

Query: 152  HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
               D+        +                    +                         
Sbjct: 1170 IPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 1229

Query: 212  HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                                       + + +      +                P+   
Sbjct: 1230 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPT 1289

Query: 272  RLLEDGSEVDVGPSTIPVADFANTSNIAF 300
               E     +  PS  P     +      
Sbjct: 1290 PSDEPTPSDEPTPSETPEEPTPSDEPTPS 1318



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/253 (5%), Positives = 32/253 (12%)

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                   +         ++      + T    D           D+              
Sbjct: 752  DWYLNRISGYVVIQPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE 811

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                          +         +   E                          +    
Sbjct: 812  EPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDE 871

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
                   +                P  +    E            P  +   +      +
Sbjct: 872  PTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSD 931

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 +  T     +E    +    E               S +   S +   S      
Sbjct: 932  EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 991

Query: 363  VIKGDIPMIDNAF 375
                     +   
Sbjct: 992  DEPTPSETPEEPI 1004



 Score = 60.4 bits (144), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/265 (6%), Positives = 40/265 (15%), Gaps = 1/265 (0%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHT 74
             E TP       +    S             +     +    E     +           
Sbjct: 1054 DEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 1113

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            S +   SD P  S     +    P       I       +                +   
Sbjct: 1114 SDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEPIPTD 1173

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
              S         + + +       +P              +     +        +  + 
Sbjct: 1174 TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDE 1233

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                     S     S+                           + + +      +    
Sbjct: 1234 PTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPTPSDE 1293

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSE 279
                        P+      E    
Sbjct: 1294 PTPSDEPTPSETPEEPTPSDEPTPS 1318


>gi|296881|emb|CAA47841.1| S-layer protein [Clostridium thermocellum]
          Length = 1664

 Score = 84.3 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/361 (6%), Positives = 59/361 (16%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 869  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 928

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +         T ++
Sbjct: 929  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 988

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                + +           +     D           D+              P+     S
Sbjct: 989  EPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1048

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                    T       +   E                         +            +
Sbjct: 1049 ETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1108

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1109 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1168

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1169 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1227

Query: 371  I 371
             
Sbjct: 1228 P 1228



 Score = 83.5 bits (204), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/361 (6%), Positives = 62/361 (17%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 912  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 971

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S   +      EP      S   +   +   +         T ++
Sbjct: 972  PTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1031

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                +      +  + S   +    +          D+              P+     S
Sbjct: 1032 EPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1091

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                    T       +   E                         +            +
Sbjct: 1092 ETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1151

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1152 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1211

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1212 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1270

Query: 371  I 371
             
Sbjct: 1271 P 1271



 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/361 (5%), Positives = 54/361 (14%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 826  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 885

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 886  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 945

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           D+                      
Sbjct: 946  PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1005

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                         +            +
Sbjct: 1006 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1065

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1066 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1125

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1126 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1184

Query: 371  I 371
             
Sbjct: 1185 P 1185



 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/361 (5%), Positives = 55/361 (15%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 783  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 842

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 843  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 902

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           +                       
Sbjct: 903  PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTP 962

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                    + S   +           +
Sbjct: 963  SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1022

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +       +  +  P+  P  +   +      +     +  
Sbjct: 1023 PSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEP 1082

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        E     I                 S +   S  +             + P+
Sbjct: 1083 TPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1141

Query: 371  I 371
             
Sbjct: 1142 P 1142



 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/361 (5%), Positives = 56/361 (15%), Gaps = 1/361 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 967  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1026

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S   +      EP      S   +   +   +         T ++
Sbjct: 1027 PTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1086

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                + +           +     D           D+                      
Sbjct: 1087 EPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1146

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                    + S   +           +
Sbjct: 1147 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 1206

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P+          E        P  +   +      +     E  
Sbjct: 1207 PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 1266

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
               +      +      E               S +   S  +             + P+
Sbjct: 1267 EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPI 1325

Query: 371  I 371
             
Sbjct: 1326 P 1326



 Score = 80.8 bits (197), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/335 (5%), Positives = 49/335 (14%), Gaps = 1/335 (0%)

Query: 37   RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96
            +  S +P       +      E         + +   + +        +   T   +   
Sbjct: 766  KAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEP 825

Query: 97   EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
             P      S   +   +   +      ++      +                +     D 
Sbjct: 826  TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 885

Query: 157  SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
                      +                             +         +         
Sbjct: 886  PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 945

Query: 217  YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLED 276
                       +   + S   +           +                P+        
Sbjct: 946  PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 1005

Query: 277  GSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKG 336
              E        P  +   +      +     +  T        E     I          
Sbjct: 1006 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPT 1065

Query: 337  RGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                   S +   S  +             + P+ 
Sbjct: 1066 PSDEPTPSDEPTPS-DEPTPSDEPTPSETPEEPIP 1099



 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/342 (6%), Positives = 53/342 (15%), Gaps = 3/342 (0%)

Query: 24   SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
                            S +P    E    +  +          +   S   +  D+ +  
Sbjct: 1020 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS 1079

Query: 84   PKSSV---TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
             + +     +      EP      S   +   +   +         T ++    + +   
Sbjct: 1080 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 1139

Query: 141  REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR 200
                    +     D           D+                            +   
Sbjct: 1140 PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 1199

Query: 201  GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                  +   E                    + S   +           +          
Sbjct: 1200 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1259

Query: 261  VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                  P+          E        P  +   +      +     +  T        E
Sbjct: 1260 PTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSE 1319

Query: 321  EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 I                 S +   S +   S      
Sbjct: 1320 TPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1361



 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/304 (6%), Positives = 53/304 (17%), Gaps = 3/304 (0%)

Query: 24   SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
                            S +P    E    +  +          +   S   +  D+ +  
Sbjct: 1063 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPS 1122

Query: 84   PKSSVTSKENI---FLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
             + + + +        EP      S   +   +   +         T ++    + +   
Sbjct: 1123 DEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEE 1182

Query: 141  REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR 200
                    +     D           D+                            +   
Sbjct: 1183 PIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEP 1242

Query: 201  GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                  +   E                    + S   +           +          
Sbjct: 1243 TPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDE 1302

Query: 261  VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIE 320
                  P  +       +  +  P+  P  +   +      +     +  T        +
Sbjct: 1303 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1362

Query: 321  EGNP 324
            E  P
Sbjct: 1363 EPTP 1366



 Score = 72.0 bits (174), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 13/303 (4%), Positives = 43/303 (14%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +         +P       +      E         + +
Sbjct: 1065 TPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDE 1124

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +        +   T   +    P      S   +   +   +      ++     
Sbjct: 1125 PTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1184

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +                +     D           +                       
Sbjct: 1185 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTP 1244

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +                    +   + S   +           +
Sbjct: 1245 SDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPT 1304

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P+          E        P  +   +      +     +  
Sbjct: 1305 PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEP 1364

Query: 311  TFV 313
            T  
Sbjct: 1365 TPS 1367



 Score = 70.0 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/275 (6%), Positives = 39/275 (14%)

Query: 88   VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
                +    EP      S   +   +   +         T ++    + +          
Sbjct: 762  PAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTP 821

Query: 148  VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
             +     D           D+                            +         +
Sbjct: 822  SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPT 881

Query: 208  ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
               E                    + S   +           +                P
Sbjct: 882  PSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETP 941

Query: 268  KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
            +          E        P  +   +      +     +  T        E     I 
Sbjct: 942  EEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIP 1001

Query: 328  EGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                            S +   S +   S      
Sbjct: 1002 TDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 1036



 Score = 68.1 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/270 (5%), Positives = 39/270 (14%)

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQH 152
                            +   +   +         T ++    +      E     + T  
Sbjct: 761  QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDT 820

Query: 153  EYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEH 212
              D           D+              P+ +    +     +         +   E 
Sbjct: 821  PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEP 880

Query: 213  HLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRR 272
                                     +           +                P  +  
Sbjct: 881  TPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 940

Query: 273  LLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVF 332
              E            P  +   +      +     +  T        +E  P        
Sbjct: 941  PEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPI 1000

Query: 333  INKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                       S +   S +   S      
Sbjct: 1001 PTDTPSDEPTPSDEPTPSDEPTPSDEPTPS 1030



 Score = 65.0 bits (156), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/356 (6%), Positives = 53/356 (14%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
               + P  + E          +      E      P+E +       E         + +
Sbjct: 1102 TPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDE 1161

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               + +     +   S    +      P      S   +   +   +         T + 
Sbjct: 1162 PTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSE 1221

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
               +              +     D           D+          I +         
Sbjct: 1222 TPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTP 1281

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +         +   E                          +           +
Sbjct: 1282 SDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPT 1341

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                            P  +                 P      T   +     G   + 
Sbjct: 1342 PSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPTPTTTPTPTPSTTPTSGSGGSG 1401

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
                G        P               +     +   S       G     ++G
Sbjct: 1402 GSGGGGGGGGGTVPTSPTPTPTSKPTSTPAPTEIEEPTPSDVPGAIGGEHRAYLRG 1457



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/253 (5%), Positives = 36/253 (14%)

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                   +         ++      + T    D           D+              
Sbjct: 748  DWYLNRISGYVVIQPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPT 807

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            P+ +    +     +         +   E                          +    
Sbjct: 808  PSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDE 867

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
                   +                P  +    E            P  +   +      +
Sbjct: 868  PTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSD 927

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 +  T     +E    +    E               S +   S +   S      
Sbjct: 928  EPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPS 987

Query: 363  VIKGDIPMIDNAF 375
                     +   
Sbjct: 988  DEPTPSETPEEPI 1000


>gi|281209568|gb|EFA83736.1| argonaut-like protein [Polysphondylium pallidum PN500]
          Length = 1301

 Score = 84.3 bits (206), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 16/291 (5%), Positives = 33/291 (11%), Gaps = 11/291 (3%)

Query: 83  IPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLRE 142
            P  +              S      S    +     S              +       
Sbjct: 86  PPPPAYYDSRGPPPPSHYDSRGPPPPSPYDNRGPPPPSPYDNRGPPPPSPYDSRGPPPPS 145

Query: 143 ILSFSVNTQHEYDSSVSPVAAI---EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT 199
                      YD    P+++                 G                    +
Sbjct: 146 PYDRPPPPASPYDRPPPPLSSSYDGRGPPPPAPPYDSRGPPPPSPYDGRGPPPPASPYDS 205

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
           RG        +         +                                  N    
Sbjct: 206 RGPPPPSPYDARGPPPPASPYDSRGPPPPSPYDSRGPPPPSPYDSRGPPPPSYYDNRGPP 265

Query: 260 NVF----SGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
                   G  P  +             P++   +         +        +      
Sbjct: 266 PPSYYDNRGPPPPASSYYGGGYDRRPPPPASPYDSRGPPPPASPYDRPPPPHGSYGPPPP 325

Query: 316 KKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL----WSLQQEKSQGLKGL 362
                +       G                 +          E        
Sbjct: 326 SSPYHDNRGPPSSGYYGDYGRPSGYYSQPPPVAGGDSPPYGSEPRGLPPPP 376



 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/305 (5%), Positives = 32/305 (10%), Gaps = 7/305 (2%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
                             +S  P             P           + +         
Sbjct: 86  PPPPAYYDSRGPPPPSHYDSRGPPPPSPYDNRGPPPPSPYDNRGPPPPSPYDSRGPPPPS 145

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS-----SVSPVAAIEHDKSRLRRGKL 176
                             L                                         
Sbjct: 146 PYDRPPPPASPYDRPPPPLSSSYDGRGPPPPAPPYDSRGPPPPSPYDGRGPPPPASPYDS 205

Query: 177 AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA--IGVSYS 234
            G                    +RG        S                 +        
Sbjct: 206 RGPPPPSPYDARGPPPPASPYDSRGPPPPSPYDSRGPPPPSPYDSRGPPPPSYYDNRGPP 265

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
                 +        S  GG  D++                        P          
Sbjct: 266 PPSYYDNRGPPPPASSYYGGGYDRRPPPPASPYDSRGPPPPASPYDRPPPPHGSYGPPPP 325

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
           +S                           P +  G         +      +   S ++E
Sbjct: 326 SSPYHDNRGPPSSGYYGDYGRPSGYYSQPPPVAGGDSPPYGSEPRGLPPPPRASSSHREE 385

Query: 355 KSQGL 359
                
Sbjct: 386 IEGQG 390



 Score = 70.0 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/314 (7%), Positives = 52/314 (16%), Gaps = 4/314 (1%)

Query: 44  RLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSI 103
            + K     + + L     ++E     +          D        + + +  P     
Sbjct: 6   PITKRPYGEELDPLNDKKQRIED----APPGYDNKHSYDRGAPPPPPQSSYYDAPPPPPY 61

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
            +    +   +          +R     +  +           S                
Sbjct: 62  RNNSPPSYDSRGPPPPPSSYDNRGPPPPAYYDSRGPPPPSHYDSRGPPPPSPYDNRGPPP 121

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                +R            P     +       +         S+  +            
Sbjct: 122 PSPYDNRGPPPPSPYDSRGPPPPSPYDRPPPPASPYDRPPPPLSSSYDGRGPPPPAPPYD 181

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
             G      Y         + +  R        D +       P  +R           G
Sbjct: 182 SRGPPPPSPYDGRGPPPPASPYDSRGPPPPSPYDARGPPPPASPYDSRGPPPPSPYDSRG 241

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
           P      D       ++ +  G    S +          +   G                
Sbjct: 242 PPPPSPYDSRGPPPPSYYDNRGPPPPSYYDNRGPPPPASSYYGGGYDRRPPPPASPYDSR 301

Query: 344 SGKILWSLQQEKSQ 357
                 S       
Sbjct: 302 GPPPPASPYDRPPP 315



 Score = 67.0 bits (161), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/280 (7%), Positives = 39/280 (13%), Gaps = 5/280 (1%)

Query: 70  KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                S  D     P S   ++          S      S    +     S         
Sbjct: 196 PPPPASPYDSRGPPPPSPYDARGPPPPASPYDSRGPPPPSPYDSRGPPPPSPYDSRGPPP 255

Query: 130 NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL----RRGKLAGIFSFPTG 185
                N                                 +           A  +  P  
Sbjct: 256 PSYYDNRGPPPPSYYDNRGPPPPASSYYGGGYDRRPPPPASPYDSRGPPPPASPYDRPPP 315

Query: 186 SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                      +         S+       +   +      +A G S   G     +   
Sbjct: 316 PHGSYGPPPPSSPYHDNRGPPSSGYYGDYGRPSGYYSQPPPVAGGDSPPYGSEPRGLPPP 375

Query: 246 LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
            R  S     ++ +       P                          +  +    + I 
Sbjct: 376 PRASSSHREEIEGQGQSQSQLPPPPPPPPPPPPPPPPQQQQQHQQSELSPPHYRSNDDIR 435

Query: 306 GD-ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
                              P+  +                
Sbjct: 436 VPIPVKQEPNDLHGSSSSVPVSKDPHYDYEHEERSRKREE 475



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/255 (7%), Positives = 32/255 (12%), Gaps = 13/255 (5%)

Query: 112 HKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL 171
                       K R        +                  YD+   P        S  
Sbjct: 11  PYGEELDPLNDKKQRIEDAPPGYDNKHSYDRGAPPPPPQSSYYDAPPPPPYRNNSPPSYD 70

Query: 172 RRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
            RG      S+         +                      +              G 
Sbjct: 71  SRGPPPPPSSYDNRGPPPPAYYDSRGPPPPSHYDSRGPPPPSPYDNRGPPPPSPYDNRGP 130

Query: 232 SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEV--DVGPSTIPV 289
                            +               +      R     +      GP     
Sbjct: 131 PPPSPYDSRGPPPPSPYDRPPPPASPYDRPPPPLSSSYDGRGPPPPAPPYDSRGPPPPSP 190

Query: 290 ADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL---SGK 346
            D       A      G    +    +      +P         +             G 
Sbjct: 191 YDGRGPPPPASPYDSRGPPPPSPYDARGPPPPASP--------YDSRGPPPPSPYDSRGP 242

Query: 347 ILWSLQQEKSQGLKG 361
              S    +      
Sbjct: 243 PPPSPYDSRGPPPPS 257


>gi|319897498|ref|YP_004135695.1| iga1 protease type 2 [Haemophilus influenzae F3031]
 gi|317433004|emb|CBY81375.1| Iga1 protease type 2 [Haemophilus influenzae F3031]
          Length = 1764

 Score = 83.9 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/388 (7%), Positives = 96/388 (24%), Gaps = 14/388 (3%)

Query: 13   DNLPENTPERRSHIYEHARNSVAR-RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
              + +  P+ R    E A+ ++   +  +     PK     Q +        V  +  ++
Sbjct: 1035 SAMAKEQPKTRPA--ETAQPTMEETKAANSTETAPKSDTTTQADTSNS--ESVPSETTET 1090

Query: 72   LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
            +  +   + + + K++  + E       +   +      K +      S    +      
Sbjct: 1091 VAENSPQESASVEKNAEEATETTPQNDEVAKEAKPTVETKDQTNEMTQSGSENTTETQAE 1150

Query: 132  SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
            +  +      +I +         +   + VA+    K                     + 
Sbjct: 1151 NKVSQPTETDKIATVETEETARVEKEETQVASQTFPKQEEPEMTKQQAEPETRNVPIVNN 1210

Query: 192  HNYFFNKTRGL--LSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                  +T+ +   +  +  S     +            +           +       +
Sbjct: 1211 LEEAQPQTKPITVATAETPTSNSKSAEKTQPSGETNAEPVTPVVVSENQPENTISQPTED 1270

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            ++     ++         K   ++    S     P T+         N    N +   + 
Sbjct: 1271 TVVKVETEETPKVETGGTKEAPQVASQTSPKQEEPETVQPQAEPAQENSPTVNNVEEAQP 1330

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ---EKSQGLKGLVIKG 366
             T        E   P   +      +           +  S +    E  +      +  
Sbjct: 1331 QTQPTIVAAKEITAPNSAQKET--AQSVANPKTAEQPVTVSTENPVVENPENTTQPAVNS 1388

Query: 367  DIPMIDNAFSASMTLKC--NADISLSIT 392
            +    + A + +++     + D +   +
Sbjct: 1389 EAVQPETATTGTVSQPKEASTDETTVAS 1416



 Score = 60.8 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/309 (7%), Positives = 63/309 (20%), Gaps = 9/309 (2%)

Query: 49   ILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILR 108
             +ER+   ++     VE      +    Q      P ++          P     +    
Sbjct: 983  EVERRHQTVDT--PSVE------MPNDMQADAPSAPSNNEEIARVDAPVPPPAPPAPATG 1034

Query: 109  SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
            S   K+       +    T       N +    +  + +       +S  S       + 
Sbjct: 1035 SAMAKEQPKTRPAETAQPTMEETKAANSTETAPKSDTTTQADTSNSESVPSETTETVAEN 1094

Query: 169  SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
            S      +       T +   +       K        +        +          ++
Sbjct: 1095 SPQESASVEKNAEEATETTPQNDEVAKEAKPTVETKDQTNEMTQSGSENTTETQAENKVS 1154

Query: 229  IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
                 +   +        R E  +     +            ++   +   V +  +   
Sbjct: 1155 QPTE-TDKIATVETEETARVEKEETQVASQTFPKQEEPEMTKQQAEPETRNVPIVNNLEE 1213

Query: 289  VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                     +A       +  S             P+              S      ++
Sbjct: 1214 AQPQTKPITVATAETPTSNSKSAEKTQPSGETNAEPVTPVVVSENQPENTISQPTEDTVV 1273

Query: 349  WSLQQEKSQ 357
                +E  +
Sbjct: 1274 KVETEETPK 1282


>gi|14210081|gb|AAK56925.1|AF369907_1 Iga1 protease type 2 [Haemophilus influenzae biotype aegyptius]
          Length = 1764

 Score = 83.9 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/388 (7%), Positives = 96/388 (24%), Gaps = 14/388 (3%)

Query: 13   DNLPENTPERRSHIYEHARNSVAR-RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
              + +  P+ R    E A+ ++   +  +     PK     Q +        V  +  ++
Sbjct: 1035 SAMAKEQPKTRPA--ETAQPTMEETKAANSTETAPKSDTTTQADTSNS--ESVPSETTET 1090

Query: 72   LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
            +  +   + + + K++  + E       +   +      K +      S    +      
Sbjct: 1091 VAENSPQESASVEKNAEEATETTPQNDEVAKEAKPTVETKDQTNEMTQSGSENTTETQAE 1150

Query: 132  SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
            +  +      +I +         +   + VA+    K                     + 
Sbjct: 1151 NKVSQPTETDKIATVETEETARVEKEETQVASQTFPKQEEPEMTKQQAEPETRNVPIVNN 1210

Query: 192  HNYFFNKTRGL--LSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                  +T+ +   +  +  S     +            +           +       +
Sbjct: 1211 LEEAQPQTKPITVATAETPTSNSKSAEKTQPSGETNAEPVTPVVVSENQPENTISQPTED 1270

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            ++     ++         K   ++    S     P T+         N    N +   + 
Sbjct: 1271 TVVKVETEETPKVETGGTKEAPQVASQTSPKQEEPETVQPQAEPAQENSPTVNNVEEAQP 1330

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ---EKSQGLKGLVIKG 366
             T        E   P   +      +           +  S +    E  +      +  
Sbjct: 1331 QTQPTIVAAKEITAPNSAQKET--AQSVANPKTAEQPVTVSTENPVVENPENTTQPAVNS 1388

Query: 367  DIPMIDNAFSASMTLKC--NADISLSIT 392
            +    + A + +++     + D +   +
Sbjct: 1389 EAVQPETATTGTVSQPKEASTDETTVAS 1416



 Score = 60.8 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/309 (7%), Positives = 63/309 (20%), Gaps = 9/309 (2%)

Query: 49   ILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILR 108
             +ER+   ++     VE      +    Q      P ++          P     +    
Sbjct: 983  EVERRHQTVDT--PSVE------MPNDMQADAPSAPSNNEEIARVDAPVPPPAPPAPATG 1034

Query: 109  SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
            S   K+       +    T       N +    +  + +       +S  S       + 
Sbjct: 1035 SAMAKEQPKTRPAETAQPTMEETKAANSTETAPKSDTTTQADTSNSESVPSETTETVAEN 1094

Query: 169  SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
            S      +       T +   +       K        +        +          ++
Sbjct: 1095 SPQESASVEKNAEEATETTPQNDEVAKEAKPTVETKDQTNEMTQSGSENTTETQAENKVS 1154

Query: 229  IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
                 +   +        R E  +     +            ++   +   V +  +   
Sbjct: 1155 QPTE-TDKIATVETEETARVEKEETQVASQTFPKQEEPEMTKQQAEPETRNVPIVNNLEE 1213

Query: 289  VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                     +A       +  S             P+              S      ++
Sbjct: 1214 AQPQTKPITVATAETPTSNSKSAEKTQPSGETNAEPVTPVVVSENQPENTISQPTEDTVV 1273

Query: 349  WSLQQEKSQ 357
                +E  +
Sbjct: 1274 KVETEETPK 1282


>gi|308500844|ref|XP_003112607.1| hypothetical protein CRE_31104 [Caenorhabditis remanei]
 gi|308267175|gb|EFP11128.1| hypothetical protein CRE_31104 [Caenorhabditis remanei]
          Length = 13106

 Score = 83.5 bits (204), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/360 (6%), Positives = 83/360 (23%), Gaps = 2/360 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE  +      + +   +   ++    ++ +  Q    EQA    E  
Sbjct: 2616 VQETPAEQAAPVPETPAEQAVPVQETPVEQPVPVQETPAEQAVPVQETPAEQAAPVQETP 2675

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++++   +   E   P     +++ + ++      +  +     ++ A++     +   
Sbjct: 2676 AEQAVPVPETPAEQAAPVQETPAEQAVPVQETPAEQAVPVPETPAEQAASVQETPAEQAA 2735

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E          E  +  +        +      +     + P    
Sbjct: 2736 PVPETPVEQPVPVQETPVEQAAPVQETPAEQAVPVQETPAEQAAPVQETPAEQAAPVQET 2795

Query: 188  FWSVHNYFFNKTRGLLSF--YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                 +   +    +              V   +   +      
Sbjct: 2796 PAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQA 2855

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +P   +    + +           A    T          
Sbjct: 2856 APVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVQE 2915

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +  +E+  P+           +   +  +  +  +  ++ +   +  V +
Sbjct: 2916 TPVEQPVPVQETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQAAPVPETPVEQ 2975



 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/360 (5%), Positives = 80/360 (22%), Gaps = 2/360 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE  +      + + A +   ++    ++         EQA    E  
Sbjct: 3211 VQETPAEQAAPVPETPAEQAAPVQETPAEQPVPVQEASAEQAAPVPETPAEQAAPVQETP 3270

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
              ++    +   E  +P     +++   ++      ++ +     ++   +     +   
Sbjct: 3271 AVQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQAAPVPETPVEQPVPVQQTPAEQAA 3330

Query: 128  NTNLSPKNFSCRLREIL--SFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                +P   +  + E          +   + +           + +    +         
Sbjct: 3331 PIKETPAEQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQVAPVTETPVEQPVPVQEA 3390

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                +         + +    +   +    K              V   +   +      
Sbjct: 3391 PAEQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQAAPVPETPVEQPVPVQETPAEQA 3450

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +P   +    + +           A    T          
Sbjct: 3451 APVQETPAEQAAPAPETPVEQPVPVQETPAEQAAPVKETPAEQAAPVTETPVEQPVPVQE 3510

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +   E+  P+           +   +  +  +  +  ++ +   +  V +
Sbjct: 3511 TPVEQPVPVQEAPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQ 3570



 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/358 (6%), Positives = 77/358 (21%), Gaps = 2/358 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q A        PE  +      + + A +   +     ++ +  Q    EQA    E  
Sbjct: 3244 VQEASAEQAAPVPETPAEQAAPVQETPAVQAAPVPETPVEQPVPVQETPAEQAAPVKETP 3303

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +++    +   E  +P     +++   ++      ++ +     ++   +     +   
Sbjct: 3304 AEQAAPVPETPVEQPVPVQQTPAEQAAPIKETPAEQAAPVPETPVEQPVPVQETPAEQAA 3363

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      + E          E  +  +        +  +   +     + P    
Sbjct: 3364 PVKETPAEQVAPVTETPVEQPVPVQEAPAEQAAPVPETPVEQPVPVQETPAEQAAPVKET 3423

Query: 188  FWSVHNYFFNKTRGLLSF--YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                 +   +    +              V   +   +      
Sbjct: 3424 PAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPAPETPVEQPVPVQETPAEQA 3483

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +P   +    +             A    T          
Sbjct: 3484 APVKETPAEQAAPVTETPVEQPVPVQETPVEQPVPVQEAPAEQAAPVPETPVEQPVPVQE 3543

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                    + +   E+  P+           +   +  S  +  +  ++ +       
Sbjct: 3544 TPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQSAPVQETPAEQAAPSDDSRA 3601



 Score = 80.1 bits (195), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/358 (6%), Positives = 77/358 (21%), Gaps = 2/358 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                     PE         + + A +   ++    K+    Q    EQA    E   ++
Sbjct: 1271 TPAEQAAPVPETPVEQSAPVQETPAEQAVPVQETPAKQATPVQETPAEQAAPVPETPTEQ 1330

Query: 71   SLHTSKQDKESDIP--KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +    +   E  +P  ++      ++   P  + +       +        S +  +   
Sbjct: 1331 AAPVPETPVEQPVPVQETPAEQAASVPETPAEQPVPVQETPAEQAAPVQETSTEQAAPVP 1390

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                 +    +       +   +   +  V            ++        S P   + 
Sbjct: 1391 ETPVEQPVPVQETPAEQAAPVQETPVEQPVPVQETPSEQPVPVQETPAEQAASVPETPVE 1450

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
              V        +      +   +    +              V   +   +         
Sbjct: 1451 QPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAAPVPETPVEQPVPVQETPAEQAAPV 1510

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            +                +P   +    + +           A    TS            
Sbjct: 1511 QETPAEQAAPVPETPVEQPVPVQETPAEQAAPVRETPAEQAASVQETSTEQAAPVPETPV 1570

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
                 + +   E+  P+           +   +  +  +  +  ++ +   +    + 
Sbjct: 1571 EQPVPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQA 1628



 Score = 79.7 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/364 (4%), Positives = 76/364 (20%), Gaps = 2/364 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE  +      + + A +   ++    ++ +       EQA    E  
Sbjct: 2671 VQETPAEQAVPVPETPAEQAAPVQETPAEQAVPVQETPAEQAVPVPETPAEQAASVQETP 2730

Query: 68   NQKSLHTSKQDKESDIP--KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
             +++    +   E  +P  ++ V     +   P  +++       +          +  +
Sbjct: 2731 AEQAAPVPETPVEQPVPVQETPVEQAAPVQETPAEQAVPVQETPAEQAAPVQETPAEQAA 2790

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                  + +        +       +   + +           + +    +         
Sbjct: 2791 PVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQET 2850

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                +         +      + + +    +                 +    +      
Sbjct: 2851 PAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVQETPAEQA 2910

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +P   +    + +           A    T          
Sbjct: 2911 APVQETPVEQPVPVQETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQAAPVPE 2970

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +   E+  P+                     +  +  ++ +   +  V +
Sbjct: 2971 TPVEQPVPVQETPAEQAVPVPETPAEQAAPVIETPVEQPVPVKETPAEQAAPVTETPVEQ 3030

Query: 366  GDIP 369
              + 
Sbjct: 3031 RPVQ 3034



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/366 (6%), Positives = 74/366 (20%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + +   +   ++    ++ +  Q    EQA    E  
Sbjct: 2726 VQETPAEQAAPVPETPVEQPVPVQETPVEQAAPVQETPAEQAVPVQETPAEQAAPVQETP 2785

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +++    +   E   P      ++ + ++      ++ ++    ++ A +     +   
Sbjct: 2786 AEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPV 2845

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P   +  ++E  +       E              +      +     + P    
Sbjct: 2846 PVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVQET 2905

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                                                                        
Sbjct: 2906 PAEQAAPVQETPVEQPVPVQETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQA 2965

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                +        V      +          +      T            A +     +
Sbjct: 2966 APVPETPVEQPVPVQETPAEQAVPVPETPAEQAAPVIETPVEQPVPVKETPAEQAAPVTE 3025

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
                    ++   E    + E  V       ++       +     E+   ++    +  
Sbjct: 3026 TPVEQRPVQETPAEQPVPVQETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQA 3085

Query: 368  IPMIDN 373
             P+ + 
Sbjct: 3086 APVQET 3091



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/361 (5%), Positives = 76/361 (21%), Gaps = 2/361 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   ++    ++    Q    EQA    E  
Sbjct: 2031 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAASVQKTPTEQAAPVPETP 2090

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P     +++   +          ++    ++   +     +   
Sbjct: 2091 VEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVSVQETPSEQPVPVQENPAEQAA 2150

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
            +   +P      ++E  +    +  E  +  +        +      +     + P    
Sbjct: 2151 SVPETPVEQPVPVQETPAEQAASVQETPTKQAAPVPETPVEQAAPVQETPAEQAAPVQET 2210

Query: 188  FWSVHNYFFNKTRGLLSF--YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                            +    +   +    +              V   +   +      
Sbjct: 2211 PAKQAAPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQA 2270

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +         +             A    T          
Sbjct: 2271 ASVQETPSEQPVPVQENPAEQAASVPETPVEQPVPVQETPAEQAASVQETPTKQAAPVQE 2330

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +   ++  P+           +   +  +  +  +  ++ +   +    +
Sbjct: 2331 TPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAEQ 2390

Query: 366  G 366
             
Sbjct: 2391 A 2391



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/360 (5%), Positives = 76/360 (21%), Gaps = 2/360 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +     ++ +  Q    EQA    E  
Sbjct: 2572 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETP 2631

Query: 68   NQKSLHTSKQDKESDIP--KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
             ++++   +   E  +P  ++       +   P  ++        +          +  +
Sbjct: 2632 AEQAVPVQETPVEQPVPVQETPAEQAVPVQETPAEQAAPVQETPAEQAVPVPETPAEQAA 2691

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                  + +    +           +   + + S         + +    +         
Sbjct: 2692 PVQETPAEQAVPVQETPAEQAVPVPETPAEQAASVQETPAEQAAPVPETPVEQPVPVQET 2751

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
             +  +         + +    +   +    +                 +    +  +   
Sbjct: 2752 PVEQAAPVQETPAEQAVPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQP 2811

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
            +  +                +         +             A    T          
Sbjct: 2812 VPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPE 2871

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +   E+  P+           +   +  +  +  +  ++     +  V +
Sbjct: 2872 TPVEQPVPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVQETPVEQPVPVQETPVEQ 2931



 Score = 77.4 bits (188), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/372 (5%), Positives = 75/372 (20%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE  +      + + A +   +     ++ +  Q   +EQA    E  
Sbjct: 2704 VQETPAEQAVPVPETPAEQAASVQETPAEQAAPVPETPVEQPVPVQETPVEQAAPVQETP 2763

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++++   +   E   P     +++   ++      ++ +     ++   +     +   
Sbjct: 2764 AEQAVPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAA 2823

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P   +  + E          E  +  +        +      +       P    
Sbjct: 2824 PVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQET 2883

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                            +                 +                         
Sbjct: 2884 PAEQAAPVQETPAEQAAPVQETPAEQAAPVQETPVEQPVPVQETPVEQPVPVQETPAEQA 2943

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                +        V      +          +      T            A +     +
Sbjct: 2944 ASVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAVPVPETPAEQAAPVIE 3003

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
                  +  KE                +   ++       +     E+   ++    +  
Sbjct: 3004 TPVEQPVPVKETPAEQAAPVTETPVEQRPVQETPAEQPVPVQETPVEQPVPVQETPAEQA 3063

Query: 368  IPMIDNAFSASM 379
             P+ +      +
Sbjct: 3064 APVPETPVEQPV 3075



 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/345 (5%), Positives = 67/345 (19%), Gaps = 2/345 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   ++    ++    Q    EQA    E  
Sbjct: 4855 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAAPVPETP 4914

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ ++    ++ A++     +   
Sbjct: 4915 VEQPVPVQETPTEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAA 4974

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P       +E  +       E              +      +     + P    
Sbjct: 4975 PVPETPVEQPVPDQEAPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAGQAAPAPET 5034

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM--AIGVSYSIGKSKGSITHF 245
                            +                 +          V   +   +      
Sbjct: 5035 PVEQPVPVQETPAEQAAPVKETPAEQAAPVTETPVEQPVPVQETPVEQPVPVQEAPAEQA 5094

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                                +    +    + +                T          
Sbjct: 5095 APVPETPVEQPVPVQEAPAEQAAPVQETPAEQAAPVPETPIEQPVPVQETPAEQSAPVQE 5154

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                    + +    +  P              ++ +L   +   
Sbjct: 5155 TPAEQAAPVQETPAVQAAPSDDSRAEEPVPAVKEAEMLDQAVKTE 5199



 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 77/361 (21%), Gaps = 2/361 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +K    ++    Q    EQA    E  
Sbjct: 1965 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQAASVQETSTEQAAPVPETP 2024

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ ++    ++ A++     +   
Sbjct: 2025 VEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAASVQKTPTEQAA 2084

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E  +       E  +  +        +  +   +       P    
Sbjct: 2085 PVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVSVQETPSEQPVPVQEN 2144

Query: 188  FWSVHNYFFNKTRGLLSF--YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                 +   +    +              V  +    +      
Sbjct: 2145 PAEQAASVPETPVEQPVPVQETPAEQAASVQETPTKQAAPVPETPVEQAAPVQETPAEQA 2204

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +    +    + +           A    T          
Sbjct: 2205 APVQETPAKQAAPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQE 2264

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                    + +   E+  P+                     +  +  ++ +   +    +
Sbjct: 2265 TPAEQAASVQETPSEQPVPVQENPAEQAASVPETPVEQPVPVQETPAEQAASVQETPTKQ 2324

Query: 366  G 366
             
Sbjct: 2325 A 2325



 Score = 74.3 bits (180), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 19/338 (5%), Positives = 71/338 (21%), Gaps = 2/338 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                 PE         + + A +  S+     ++ +  Q    EQA    E   +++   
Sbjct: 1330 QAAPVPETPVEQPVPVQETPAEQAASVPETPAEQPVPVQETPAEQAAPVQETSTEQAAPV 1389

Query: 75   SKQDKESDIPKSSVTSKENIFLE--PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             +   E  +P     +++   ++  P  + +      ++          +  +       
Sbjct: 1390 PETPVEQPVPVQETPAEQAAPVQETPVEQPVPVQETPSEQPVPVQETPAEQAASVPETPV 1449

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
             +    +       +   +   + + S         + +    +             +  
Sbjct: 1450 EQPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAAPVPETPVEQPVPVQETPAEQAAP 1509

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                   +      + + +    +                 +    + S           
Sbjct: 1510 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVRETPAEQAASVQETSTEQAAPVPETP 1569

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                         +    +      +           A    T                 
Sbjct: 1570 VEQPVPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQAA 1629

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
             + +  +E+  P+             ++ +L   +   
Sbjct: 1630 PVPETPVEQPVPVQETPAEQPVAAVKEAEMLDQAVKTE 1667



 Score = 70.4 bits (170), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/331 (5%), Positives = 63/331 (19%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
                 + PE         + + A +  S++    K+        +EQA    E   +++ 
Sbjct: 2146 AEQAASVPETPVEQPVPVQETPAEQAASVQETPTKQAAPVPETPVEQAAPVQETPAEQAA 2205

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
               +   +   P     +++   ++      ++ ++    ++ A +     +       +
Sbjct: 2206 PVQETPAKQAAPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQET 2265

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            P   +  ++E  S       E  +  +        +  +   +     +           
Sbjct: 2266 PAEQAASVQETPSEQPVPVQENPAEQAASVPETPVEQPVPVQETPAEQAASVQETPTKQA 2325

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                       +                                               +
Sbjct: 2326 APVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQE 2385

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                    V      +          +      T              +     +  +  
Sbjct: 2386 TPAEQAAPVPETPVEQPVPVQETPAEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQ 2445

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                KE         +               
Sbjct: 2446 AAPVKETPAEQAAPSDDSRAEEPVPAVKEAE 2476



 Score = 65.8 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/345 (5%), Positives = 71/345 (20%), Gaps = 2/345 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +     ++ +  Q    EQA   +E  
Sbjct: 6799 VQETPAEQAAPVPETPVEQPVPVQETPAGQAVPVLETPVEQPVPVQETHAEQAAPVLETP 6858

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIF--LEPRLRSISSILRSNKHKKLANILSVQGKS 125
             +++    +   E         +K+ +     P  + +       +         V+   
Sbjct: 6859 AEQAAPVQEIPAEQAATVQETPAKQAVPVLETPVEQPVPVQETHAEQAAPVQETPVEQPV 6918

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                 L+ +        +       +   + +           + +    +         
Sbjct: 6919 PVQETLAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQAAPVPETPVEHPVPVQET 6978

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
             +   V        +      + + +    +                 +    +      
Sbjct: 6979 PVEQPVAVPETLAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPAEQAAPVQEIPAEQA 7038

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +                +P   +    + +           A               
Sbjct: 7039 APVQETPAKQAVPVLETIVEQPVPVQETQAEQAAPVQEIPAEQAAPVQEIPAEQAATVQE 7098

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                    + +  +E+  P+           +   +  +  +  +
Sbjct: 7099 TPAKQAVPVLETIVEQPVPVQETQAEQAAPVQETPAEQAAPVPET 7143



 Score = 63.9 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/374 (6%), Positives = 79/374 (21%), Gaps = 15/374 (4%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +  S++    ++    Q    EQA    E  
Sbjct: 3763 VQETPAEQAAPVPETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQAAPVQETP 3822

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ ++    ++ A +     +   
Sbjct: 3823 VEQPVPVQETPAEQAGPVPETPVEQPVPVQETPAEQAASVQETPAEQAAPVPETPAEQAA 3882

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P   +  + E          E  +  +        +              P    
Sbjct: 3883 PVQETPAEQAAPVPENPVEQPVPVQETPAEQAAPVQQTPAEQAAPSDDSRAEEPVPAVKE 3942

Query: 188  FWSVHNYFFNK---------------TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
               +      +                         L           +       + + 
Sbjct: 3943 AEMLDQAVKTEKVLLTDVDVDLFFCKAEVFSGLELDLLMECSEFITENVPQKGREQVQIE 4002

Query: 233  YSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF 292
              +   +      +  +                +P   +    +             A  
Sbjct: 4003 QPVPVQETPAEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQPVPVPETPAEQAAPV 4062

Query: 293  ANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
              T                  + +   E+  P+           +   +  +  +  +  
Sbjct: 4063 QETPAEQPVPVQETPAEQAASVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPV 4122

Query: 353  QEKSQGLKGLVIKG 366
            ++     +    + 
Sbjct: 4123 EQPVPVQEIPAEQA 4136



 Score = 63.5 bits (152), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/301 (6%), Positives = 69/301 (22%), Gaps = 10/301 (3%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   ++    ++    Q    EQA    E  
Sbjct: 2858 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAEQAAPVQETPAEQAAPVQETP 2917

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E  +P     +++   ++      ++ ++    ++ A +     +   
Sbjct: 2918 VEQPVPVQETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQAAPVPETPVEQPV 2977

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                               +V          +PV     ++    +   A   +  T + 
Sbjct: 2978 ----------PVQETPAEQAVPVPETPAEQAAPVIETPVEQPVPVKETPAEQAAPVTETP 3027

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                        + +    + + +    +              V   +   +        
Sbjct: 3028 VEQRPVQETPAEQPVPVQETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAP 3087

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             +                +P   +    +             A   ++        +   
Sbjct: 3088 VQETPAEQAAPVPETPVEQPLPVQETPVEQPVSVQETPAEQAAPSDDSRAEEPVPAVKEA 3147

Query: 308  E 308
            E
Sbjct: 3148 E 3148



 Score = 63.1 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/359 (6%), Positives = 73/359 (20%), Gaps = 4/359 (1%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   ++    ++ +  +    EQA    E  
Sbjct: 6300 VQETPAEQAAPVPETPVEQPVPVQETPAEQAVPVQETSAEQPVPVKETPAEQAAPVTETP 6359

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLR----SISSILRSNKHKKLANILSVQG 123
             ++ +   +   E   P     ++E +           ++ +         +        
Sbjct: 6360 VEQPVPVQETPAEQAAPSDDSRAEEPVPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCKAE 6419

Query: 124  KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
                         S  + E +      Q + +  V          + +    +       
Sbjct: 6420 VFSGLELDLLMECSEFITENVPQKRREQVQIEQPVPVQETPTEQAAPVPETPVEQPVPVQ 6479

Query: 184  TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                  +         + +    +   +    +                 +    +    
Sbjct: 6480 ETPTEQAAPVPETPVEQPVPVQETLAEQAAPVQETPAEQAAPVQETPAEQAAPVQETPAE 6539

Query: 244  HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                 +                +P   +    + +           A    T        
Sbjct: 6540 QAAPVQETPVEQPVPVQETPVEQPVPVQEAPAEQTAPVPETPVEQAAPVQETPAEQAVPV 6599

Query: 304  IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                      + +   E+  P+           +   +  +     S  +E    +K  
Sbjct: 6600 PETPVEQPVPVQEIPTEQTAPVPETPVEQPVPVQETPAEQAAPSDDSRAEEPVPAVKEA 6658



 Score = 62.3 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/276 (6%), Positives = 63/276 (22%), Gaps = 1/276 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q      P   PE  +      + + A +   ++    ++    Q    EQA    E  
Sbjct: 4040 VQETPAEQPVPVPETPAEQAAPVQETPAEQPVPVQETPAEQAASVQETPAEQAAPVPETP 4099

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ ++    ++   +     +   
Sbjct: 4100 VEQPVPVQETPAEQAAPVPETPVEQPVPVQEIPAEQAASVQETPAEQPVPVQETPAEQAA 4159

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E  +       E              +      +       P    
Sbjct: 4160 PVPETPVEQPVPVQETPAEQAAPVTETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQET 4219

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                                              +           +   +    T   +
Sbjct: 4220 PAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQET-PAEQAAPVPETPVEQ 4278

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
               +     ++       R       +++  ++D  
Sbjct: 4279 PVPVQETPAEQAAPSDDSRADEPVPAVKEAEKLDQA 4314



 Score = 61.6 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/373 (5%), Positives = 73/373 (19%), Gaps = 15/373 (4%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +     ++ +  Q    EQA    E  
Sbjct: 4567 VQETSAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQEIPAEQAASVQETP 4626

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ +     ++   +     +   
Sbjct: 4627 AEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAA 4686

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E  +       E              +              P    
Sbjct: 4687 PVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPSDDSRADEPVPAVKE 4746

Query: 188  FWSVHNYFFNK---------------TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
               +      +                         L           +       + + 
Sbjct: 4747 AEMLDQAVKTEKVLLTDVDVDLFFCKAEVFSGLELDLLMECSEFITENVPQKGREQVQIE 4806

Query: 233  YSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF 292
              +   +         +                +P   +    + +           A  
Sbjct: 4807 QPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQESPAEQAASVQETPAEQAAPV 4866

Query: 293  ANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
              T                  + +   E+   +                     +  +  
Sbjct: 4867 PETPVEQPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAAPVPETPVEQPVPVQETPT 4926

Query: 353  QEKSQGLKGLVIK 365
            ++ +   +  V +
Sbjct: 4927 EQAAPVPETPVEQ 4939



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/367 (3%), Positives = 59/367 (16%), Gaps = 21/367 (5%)

Query: 21   ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKE 80
            E+R      A   V  +   ++  +P +    +           +    +     +    
Sbjct: 3029 EQRPVQETPAEQPVPVQETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPV 3088

Query: 81   SDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
             + P           +E  L    + +      +            +             
Sbjct: 3089 QETPAEQAAPVPETPVEQPLPVQETPVEQPVSVQETPAEQAAPSDDSRAEEPVPAVKEAE 3148

Query: 141  R---------------------EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
                                           + +     S +      +    + ++   
Sbjct: 3149 MLDQAVMTEKVLLTDVDVDLFFCKAEVFSGLELDLLMECSELITENVPQKGREQVQIEQP 3208

Query: 180  FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
                      +         +      +   +    +                 +    +
Sbjct: 3209 VPVQETPAEQAAPVPETPAEQAAPVQETPAEQPVPVQEASAEQAAPVPETPAEQAAPVQE 3268

Query: 240  GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
                                      +    +    + +                T    
Sbjct: 3269 TPAVQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQAAPVPETPVEQPVPVQQTPAEQ 3328

Query: 300  FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
                          + +  +E+  P+           +   +     +  +  ++     
Sbjct: 3329 AAPIKETPAEQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQVAPVTETPVEQPVPVQ 3388

Query: 360  KGLVIKG 366
            +    + 
Sbjct: 3389 EAPAEQA 3395



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/367 (5%), Positives = 79/367 (21%), Gaps = 15/367 (4%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                 PE         + +   +   +     ++ +  Q    EQA    E   +++   
Sbjct: 6463 QAAPVPETPVEQPVPVQETPTEQAAPVPETPVEQPVPVQETLAEQAAPVQETPAEQAAPV 6522

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
             +   E   P     +++   ++         ++    ++   +     +       +P 
Sbjct: 6523 QETPAEQAAPVQETPAEQAAPVQETPVEQPVPVQETPVEQPVPVQEAPAEQTAPVPETPV 6582

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
              +  ++E  +       E              +      +       P           
Sbjct: 6583 EQAAPVQETPAEQAVPVPETPVEQPVPVQEIPTEQTAPVPETPVEQPVPVQETPAEQAAP 6642

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG-------------- 240
              +            +E          ++L  + + + +   +                 
Sbjct: 6643 SDDSRAEEPVPAVKEAEMLDQAVKTEKVLLTDVNVDLFFCKAEVFSGLELDLLMECSEFI 6702

Query: 241  -SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
                    RE +             ++    +    + +           A    T    
Sbjct: 6703 TENVPQKGREQVQVEQPVPVQETPAVQAAPVQEAPAEQTAPVPETPAEQAAPVQETPTEQ 6762

Query: 300  FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
                       +  + +   E+  P+           +   +  +  +  +  ++     
Sbjct: 6763 AAPVQETPAEQSVPVQEAPAEQTAPVPETPVEQAAPVQETPAEQAAPVPETPVEQPVPVQ 6822

Query: 360  KGLVIKG 366
            +    + 
Sbjct: 6823 ETPAGQA 6829



 Score = 59.6 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/375 (7%), Positives = 81/375 (21%), Gaps = 3/375 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +  S++    ++ +  Q N  EQA    E  
Sbjct: 2240 VQETPAEQAAPVPETPVEQPVPVQETPAEQAASVQETPSEQPVPVQENPAEQAASVPETP 2299

Query: 68   NQKSLH---TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
             ++ +    T  +   S     +  +           +      + +   +    + Q  
Sbjct: 2300 VEQPVPVQETPAEQAASVQETPTKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQAA 2359

Query: 125  SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
                T               +  V       ++  P   +E             +    T
Sbjct: 2360 PVQETPAKQAAPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQPVPVQET 2419

Query: 185  GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
             +   +       +    +    A     + +           +          +  +  
Sbjct: 2420 PAEQAAPVPETPVEQPVPVQETPAEQAAPVKETPAEQAAPSDDSRAEEPVPAVKEAEMLD 2479

Query: 245  FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
               +           ++F       +   L+   E     +            I     +
Sbjct: 2480 QAVKTEKVLLTDVDVDLFFCKAEVFSSLELDLLMECSEFITENVPQKGREQVQIEQPVPV 2539

Query: 305  GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
                        +   E    + E          ++       +     E+   ++    
Sbjct: 2540 QETPTEQAAPVPETPAEQAAPVQETPAEQAASVQETPAEQAAPVPETPVEQPVPVQETPA 2599

Query: 365  KGDIPMIDNAFSASM 379
            +   P+ +      +
Sbjct: 2600 EQAAPVPETPVEQPV 2614



 Score = 58.5 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/269 (6%), Positives = 61/269 (22%), Gaps = 1/269 (0%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                 PE         + +   +   +     ++ +  Q    EQA    E   +++   
Sbjct: 6131 QAAPVPETPVEQPVPVQETPTEQAAPVPETPVEQPVPVQETLAEQAAPVQETPAEQAAPV 6190

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
             +   E   P     +++   ++      ++ ++    ++ A +     +       +P 
Sbjct: 6191 QETPAEQAAPVQETPAEQAAPVQETPAEQAAPVQEAPAEQTAPVPETPVEQAAPVQETPA 6250

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
              +  ++E  +       E              +      +     + P           
Sbjct: 6251 EQAAPVQETPAVQAAPVTETPVEQPVPVQETPAEQAASVQETPAEQAAPVQETPAEQAAP 6310

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                                                   +   +  + T   +   +   
Sbjct: 6311 VPETPVEQPVPVQETPAEQAVPVQETSAEQPVPVKET-PAEQAAPVTETPVEQPVPVQET 6369

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
              ++       R +     +++   +D  
Sbjct: 6370 PAEQAAPSDDSRAEEPVPAVKEAEMLDQA 6398



 Score = 55.8 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/340 (6%), Positives = 76/340 (22%), Gaps = 4/340 (1%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                 PE         + +   +   +     ++ +  Q    EQA    E    ++   
Sbjct: 5731 QAAPVPETPVEQPVPVQETPTEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAVQASPV 5790

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            ++   E  +P     +++   ++      ++ +     ++   +     +       +P 
Sbjct: 5791 TETPVEQPVPVQEAPAEQAAPVQETPAEQAAPVPETPVEQPVPVQEAPVEQPVPVQETPA 5850

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
              +  ++E  +       +  +     A  E +           + +     +F+     
Sbjct: 5851 EQAAPVKETPAEQAAPSDDSRAEEPVPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCKAEV 5910

Query: 195  FFNKTRGLLSF----YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            F      LL       +        +       +         +    +         + 
Sbjct: 5911 FSGLELDLLMECSEFITENVPQKGREQVQIEQPVPVQETPAGQAASVQETPAEQAASVQE 5970

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                           +P   +    + +      S         T               
Sbjct: 5971 TPTEQAAPVPETPVEQPVPVQETPVEQAAPVQETSAEQPVPVKETPAEQAAPVTETPVEQ 6030

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
               + +   E+  P              ++ +L   +   
Sbjct: 6031 PVPVQETPAEQAAPSDDSRAEEPVPAVKEAEMLDQAVKTE 6070



 Score = 53.9 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/358 (5%), Positives = 71/358 (19%), Gaps = 7/358 (1%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         +     +   +     ++ +  Q    EQA    + +
Sbjct: 6588 VQETPAEQAVPVPETPVEQPVPVQEIPTEQTAPVPETPVEQPVPVQETPAEQAAPSDDSR 6647

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   K+ +  D    +                +              L +  +   
Sbjct: 6648 AEEPVPAVKEAEMLDQAVKTEKVLLTDVNVDLFFCKAE-------VFSGLELDLLMECSE 6700

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +         ++       +     +     A     + +                
Sbjct: 6701 FITENVPQKGREQVQVEQPVPVQETPAVQAAPVQEAPAEQTAPVPETPAEQAAPVQETPT 6760

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
              +         + +    +   +                      +    +  +   + 
Sbjct: 6761 EQAAPVQETPAEQSVPVQEAPAEQTAPVPETPVEQAAPVQETPAEQAAPVPETPVEQPVP 6820

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             +    G           +P   +    + +   +       A                 
Sbjct: 6821 VQETPAGQAVPVLETPVEQPVPVQETHAEQAAPVLETPAEQAAPVQEIPAEQAATVQETP 6880

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
                  + +  +E+  P+           +         +  +L ++ +   +  V +
Sbjct: 6881 AKQAVPVLETPVEQPVPVQETHAEQAAPVQETPVEQPVPVQETLAEQAAPVPETPVEQ 6938



 Score = 53.9 bits (127), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 25/332 (7%), Positives = 68/332 (20%), Gaps = 4/332 (1%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q        + PE         + + A +   ++    ++    Q    EQA    E  
Sbjct: 1433 VQETPAEQAASVPETPVEQPVPVQETPAEQAAPVQETPAEQAASVQETPTEQAAPVPETP 1492

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P     +++   +          ++    ++ A +     +   
Sbjct: 1493 VEQPVPVQETPAEQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVRETPAEQAA 1552

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
            +   +    +  + E          E  +  +        K      +     + P    
Sbjct: 1553 SVQETSTEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQET 1612

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                            +                       A+  +  + ++  +    L 
Sbjct: 1613 PAKQAAPVQETPAEQAAPVPETPVEQPVPVQETPAEQPVAAVKEAEMLDQAVKTEKVLLT 1672

Query: 248  RESLD----GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
               +D       V        +             +               T        
Sbjct: 1673 NVDVDLFFCKAEVFSGLELDLLMECSEFITKNVPQKGREQVQIEQPVPVQETPAEQPVPV 1732

Query: 304  IGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
                            EE  P + E  +    
Sbjct: 1733 PETPAEQAAPSDDSRAEEPIPAVKEAEMLDQA 1764



 Score = 52.7 bits (124), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/325 (7%), Positives = 60/325 (18%), Gaps = 4/325 (1%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                 PE         + + A +   +     ++ +  Q    EQA    E    ++   
Sbjct: 4972 QAAPVPETPVEQPVPDQEAPAEQAAPVPETPVEQPVPVQETPAEQAAPVQETPAGQAAPA 5031

Query: 75   SKQDKESDIPKSSVTSKENIF----LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             +   E  +P     +++          +   ++              +      +    
Sbjct: 5032 PETPVEQPVPVQETPAEQAAPVKETPAEQAAPVTETPVEQPVPVQETPVEQPVPVQEAPA 5091

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                       E          E  + V    A +         +               
Sbjct: 5092 EQAAPVPETPVEQPVPVQEAPAEQAAPVQETPAEQAAPVPETPIEQPVPVQETPAEQSAP 5151

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            V      +   +    +  +           +  +  A  +  ++   K  +T       
Sbjct: 5152 VQETPAEQAAPVQETPAVQAAPSDDSRAEEPVPAVKEAEMLDQAVKTEKVLLTDVDVDLF 5211

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                 V        +             +               T               
Sbjct: 5212 FCKAEVFSGLELDLLMECSEFITKNVPQKGREQVQIEQPVPVQETPAEQPVPVPETPAEQ 5271

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINK 335
                     EE  P + E  +    
Sbjct: 5272 AAPSDDSRAEEPIPAVKEAEMLDQA 5296



 Score = 51.2 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/235 (6%), Positives = 52/235 (22%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +     ++ +  Q    EQA    E  
Sbjct: 4084 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQEIPAEQAASVQETP 4143

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++ +     ++   +     +   
Sbjct: 4144 AEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVTETPVEQPVPVQETPAEQAA 4203

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E  +       E              +      +       P    
Sbjct: 4204 PVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQET 4263

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                                                    A+  +  + ++  + 
Sbjct: 4264 PAEQAAPVPETPVEQPVPVQETPAEQAAPSDDSRADEPVPAVKEAEKLDQAVKTE 4318



 Score = 48.5 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/360 (7%), Positives = 77/360 (21%), Gaps = 1/360 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   +     ++ +  Q    EQA    E  
Sbjct: 4194 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVPETP 4253

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P      ++ + ++      ++    ++  +    +    K   
Sbjct: 4254 VEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQAAPSDDSRADEPVPAVKEAEKLDQ 4313

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                     +    ++    V+  +      +   +     S                  
Sbjct: 4314 AVKTEKVLLTDVDVDLFFCKVHHNNVPQRQENKFKSSTSSSSXXXSRNSGEQPVPVQEMQ 4373

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS-ITHFL 246
              S       +T        A       K    L   +     +   +            
Sbjct: 4374 RTSCPFKRLQRTSAPSDDSRAEEPVPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCKAEVF 4433

Query: 247  RRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                LD      + +   +  K   ++  +             A    T           
Sbjct: 4434 SGLELDLLMECSEFITENVPQKGREQVQIEQPVPVQETPAEQAAPVQETPAEQAAPVKET 4493

Query: 307  DENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
                   + +  +E+  P+                     +  +  ++     +    + 
Sbjct: 4494 PAEQAAPVTETPVEQPVPVQETPAEQAAPVPETPVEQPVPVQETPAEQPVPVPETPAEQA 4553



 Score = 41.1 bits (94), Expect = 0.45,   Method: Composition-based stats.
 Identities = 17/220 (7%), Positives = 52/220 (23%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE           +       ++    ++ +       EQA    E  
Sbjct: 6942 VQETPAEQAAPVPETPVEQAAPVPETPVEHPVPVQETPVEQPVAVPETLAEQAAPVPETP 7001

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P     +++   ++      ++ ++    K+   +L    +   
Sbjct: 7002 VEQPVPVQETPAEQAAPVPETPAEQAAPVQEIPAEQAAPVQETPAKQAVPVLETIVEQPV 7061

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +    +  ++EI +       E  +  +        K  +   +       P    
Sbjct: 7062 PVQETQAEQAAPVQEIPAEQAAPVQEIPAEQAATVQETPAKQAVPVLETIVEQPVPVQET 7121

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM 227
                            +      +    +        L  
Sbjct: 7122 QAEQAAPVQETPAEQAAPVPETDDKAKKEADEKAKKDLEA 7161



 Score = 40.0 bits (91), Expect = 0.88,   Method: Composition-based stats.
 Identities = 28/365 (7%), Positives = 82/365 (22%), Gaps = 1/365 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + + A +   ++    ++    Q    EQA    E  
Sbjct: 1510 VQETPAEQAAPVPETPVEQPVPVQETPAEQAAPVRETPAEQAASVQETSTEQAAPVPETP 1569

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   +   E   P     +K+   ++      ++ ++    K+ A +     +   
Sbjct: 1570 VEQPVPVQETPAEQAAPVQETPAKQAAPVQETPAEQAAPVQETPAKQAAPVQETPAEQAA 1629

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                +P      ++E  +       +    +      E          L    +     +
Sbjct: 1630 PVPETPVEQPVPVQETPAEQPVAAVKEAEMLDQAVKTEKVLLTNVDVDLFFCKAEVFSGL 1689

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
               +           +               V                 ++  S      
Sbjct: 1690 ELDLLMECSEFITKNVPQKGREQVQIEQPVPVQETPAEQPVPVPETPAEQAAPSDDSRAE 1749

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                     +  +        +   +  D    +    +    D     +      +   
Sbjct: 1750 EPIPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCEAEVFSSLELDLLMECSEFITENVPQK 1809

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI-LSGKILWSLQQEKSQGLKGLVIKG 366
                  + +    +  P+     V     +  + +  +     +  QE S      V + 
Sbjct: 1810 GREQVQIEQPVPVQETPIEQAAPVPETPAKQAAPVQETPAEQAAPVQETSTEQAAPVPET 1869

Query: 367  DIPMI 371
             +   
Sbjct: 1870 PVEQP 1874



 Score = 38.1 bits (86), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/398 (5%), Positives = 77/398 (19%), Gaps = 39/398 (9%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +Q          PE         + +   +   ++    ++    +    EQA    + +
Sbjct: 5812 VQETPAEQAAPVPETPVEQPVPVQEAPVEQPVPVQETPAEQAAPVKETPAEQAAPSDDSR 5871

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             ++ +   K+ +  D    +                + +    +   L        ++  
Sbjct: 5872 AEEPVPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCKAEVFSGLELDLLMECSEFITENVP 5931

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                        +    + +       ++     A+++   +             P    
Sbjct: 5932 QKGREQVQIEQPVPVQETPAGQAASVQETPAEQAASVQETPTEQAAPVPETPVEQPVPVQ 5991

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
               V      +                    V    +            ++  S      
Sbjct: 5992 ETPVEQAAPVQETSAEQPVPVKETPAEQAAPVTETPVEQPVPVQETPAEQAAPSDDSRAE 6051

Query: 248  RESLDGGNVD---------------------------------------KKNVFSGIRPK 268
                     +                                        + +   +  K
Sbjct: 6052 EPVPAVKEAEMLDQAVKTEKVLLTDVDVDLFFCKAEVFSGLELDLLMECSEFITENVPQK 6111

Query: 269  ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
               ++  +         T   A    T                  + +  +E+  P+   
Sbjct: 6112 RREQVQIEQPVPVQETPTEQAAPVPETPVEQPVPVQETPTEQAAPVPETPVEQPVPVQET 6171

Query: 329  GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
                    +   +  +  +  +  ++ +   +    + 
Sbjct: 6172 LAEQAAPVQETPAEQAAPVQETPAEQAAPVQETPAEQA 6209


>gi|260467080|ref|ZP_05813260.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029189|gb|EEW30485.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 318

 Score = 83.5 bits (204), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 47/306 (15%), Positives = 89/306 (29%), Gaps = 8/306 (2%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DF+ V+++ +DNL + +PE R+ +Y+ AR+++A ++    P L      +Q   LE A
Sbjct: 1   MADFVAVLKKTIDNLSDQSPEMRARVYDKARSTIAAKIALRDPPLSPSDAAKQKRGLEDA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I  VE+   KS+  +    E +   SS+   +N     R  +                  
Sbjct: 61  ISSVERDYTKSVPETDPLAELENIFSSIDRNKNQSNHTRQPANVEPSWPAPAAAPTAKPE 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
               +      +  ++        +             +     + D             
Sbjct: 121 PYRPAPPPAAKAEPSWPKPASVQPASFNLADKNLPGMDADQEDDQPDVFPND-------D 173

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
              T   F  +      ++ G L              +   +        +     K   
Sbjct: 174 EPATADTFQRLRPAERKRSYGGLITAVVALLVVAGGGYGIWLNKDAFGKMLGLDGSKVAK 233

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
           +        +    +            K T+RL  +G E D GP+          S  A 
Sbjct: 234 TE-PVKPAPAKPATDAATPPAAGAEATKFTQRLTPEGGETDPGPAGGQSGIGEGESVAAL 292

Query: 301 KNYIGG 306
                 
Sbjct: 293 TTPPTA 298


>gi|309364132|emb|CAP25406.2| hypothetical protein CBG_04763 [Caenorhabditis briggsae AF16]
          Length = 1328

 Score = 83.5 bits (204), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/305 (10%), Positives = 69/305 (22%), Gaps = 1/305 (0%)

Query: 17  ENTPERRSHI-YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
            ++PE  S    + + +S +   E       +          E A          S  +S
Sbjct: 174 PSSPETPSSTEPDVSTSSTSAVPEVFTDLAIELPTSAPEASTESATSVHSTSEPVSTDSS 233

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             +    +P +   + E    EP   + +    + +     +       S T    +   
Sbjct: 234 TFEPPEGLPHTLPETPETSSPEPEPSTSAIEPTTLEPSTSESAALTDSSSSTFEPTATFT 293

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
           +          +           S +     +   L         + P  S   +V   F
Sbjct: 294 WPPSENPGNLSTEPEASTDTIEPSTLEPSATESITLPTQTPDSSSTEPEVSTAPTVPTTF 353

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
              T    +  +  +                            +   T     ES     
Sbjct: 354 GPSTFEPENPATLETSSSEPGPSTHPTQPTFEPSATEPFTLLPQTPETLSTEPESSTSPT 413

Query: 256 VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
                  S   P +T           + P  I  +     S+ A       + +++    
Sbjct: 414 EPTTFEPSTSGPDVTFEPSTTEPFTWLPPWAIETSSTEPGSSTAPTELNTFEPSTSGPEF 473

Query: 316 KKEIE 320
             +  
Sbjct: 474 TTDFP 478



 Score = 56.6 bits (134), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/268 (7%), Positives = 53/268 (19%), Gaps = 23/268 (8%)

Query: 13  DNLPENTPERRS-HIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
           + LP   PE       E   ++ A    +++P   +          + +    E     +
Sbjct: 239 EGLPHTLPETPETSSPEPEPSTSAIEPTTLEPSTSESAA-----LTDSSSSTFEPTATFT 293

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
              S+          + T            + S  L +      +    V          
Sbjct: 294 WPPSENPGNLSTEPEASTDTIEPSTLEPSATESITLPTQTPDSSSTEPEVSTA------- 346

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG-SIFWS 190
                      + +    +  E ++  +   +           +     S     ++   
Sbjct: 347 ---------PTVPTTFGPSTFEPENPATLETSSSEPGPSTHPTQPTFEPSATEPFTLLPQ 397

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                  +     S     +                            + S T      +
Sbjct: 398 TPETLSTEPESSTSPTEPTTFEPSTSGPDVTFEPSTTEPFTWLPPWAIETSSTEPGSSTA 457

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGS 278
               N  + +            L  D +
Sbjct: 458 PTELNTFEPSTSGPEFTTDFPTLETDAT 485


>gi|63259394|gb|AAY40355.1| IgA1 protease [Streptococcus mitis]
          Length = 2072

 Score = 83.1 bits (203), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 33/393 (8%), Positives = 75/393 (19%), Gaps = 25/393 (6%)

Query: 15  LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILE-----RQFNKLEQAI------LQ 63
            P   PE  + +         +   +++P LP+ ++           L +A+        
Sbjct: 417 EPAIQPELPAAV------VTDKGEPAVQPELPEAVVTDKGVPEVQPALPEAVVTEKGEPA 470

Query: 64  VEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQG 123
           V+ +  +++ T K + E           +    E                     ++   
Sbjct: 471 VQPELPEAVVTDKGETEVQPESPDTVVSDKGEPEQVAPLPEYKGPQAGAIVEPEQVAPLP 530

Query: 124 KSRTNTN---LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
           +         + P         +++     + +     + V        +    +     
Sbjct: 531 EYTGPQAGAVVEPAIQPELPEAVVTDKGEPEVQPALPEAVVTEKGEPAVQPELPEAVVTD 590

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
              T     S      +K                    V    +           G    
Sbjct: 591 KGETEVQPESPDTVVSDKGEPEQIAPLPEYTGVQAGAIVEPEQVEAPKEYTGVQAGAIVE 650

Query: 241 SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                   E                 PK    +           + +P         I  
Sbjct: 651 PEQVAPLPEYTGVQAGAIVEPEKVEAPKEYTGVQAGAIVEPEQIAPLPEYTGPQAGAIVE 710

Query: 301 KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
              +      T V     +E               G          +       +    +
Sbjct: 711 PEQVAPLPEYTGVQAGAIVEPEQIAPLPEYTGPQAGAIVEPEQVDPLPEYKGNIEQLKPE 770

Query: 361 GLVIKGDIPMIDNAFSASMTLKCNADISLSITH 393
             V K      +           N       +H
Sbjct: 771 TPVEKPKETDPEKTLEL-----RNVSDIELYSH 798


>gi|109488869|ref|XP_220903.4| PREDICTED: calcium binding and coiled-coil domain 2-like [Rattus
           norvegicus]
          Length = 876

 Score = 83.1 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/366 (6%), Positives = 72/366 (19%), Gaps = 1/366 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE-KQNQKS 71
               +  PE  S   +      + + ++       +          QA  + E    Q  
Sbjct: 403 SAQADVEPEVPSAQADAEPEVPSAQADAEPEVPSAQADAEPEVPSPQADAEPEVPSPQAD 462

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                   ++D      +  +     P  ++ +     +        +            
Sbjct: 463 AEPEVPSAQADAETEVPSQADAEPEVPSPQADAEPEVPSAQADAEPEVPSPHVDAEPEVP 522

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
           SP   +             +     + +                 A   + P      + 
Sbjct: 523 SPHIDAEPEAPSAQADAEPEAPSAQADAEPEVPSPHVDAEPEVPSAQADAEPEVPSAQAD 582

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                   +  +   +  ++           +                 S       E+ 
Sbjct: 583 AEPEAPSAQADVEPEAPSAQADAEPEAPSAQVAEPEVPSAQADAEPEVPSAQADAEPEAP 642

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
                + +   +    +      +  +E +V             + +  +  +   +   
Sbjct: 643 SAQVAEPEVPSAQADAEPEVPSPQADAEPEVPSPQADAEPEVPPAQVDAEPEVPSPQADA 702

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                       P +   +V            +   + S Q +    +       +  + 
Sbjct: 703 EPEVSSPQAAAEPEVSSPQVDAEPEVSSPQAAAEPEVPSPQADAEPEVPSPQADAEPEVP 762

Query: 372 DNAFSA 377
                A
Sbjct: 763 SPQVDA 768



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/361 (4%), Positives = 70/361 (19%), Gaps = 1/361 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKP-RLPKEILERQFNKLEQAILQVEKQNQKS 71
               +  PE  S   +      + + ++       +   E +      A  +V      +
Sbjct: 436 SAQADAEPEVPSPQADAEPEVPSPQADAEPEVPSAQADAETEVPSQADAEPEVPSPQADA 495

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                  +    P+      +     P     +     +                     
Sbjct: 496 EPEVPSAQADAEPEVPSPHVDAEPEVPSPHIDAEPEAPSAQADAEPEAPSAQADAEPEVP 555

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
           SP   +             +     + +   A             A   + P        
Sbjct: 556 SPHVDAEPEVPSAQADAEPEVPSAQADAEPEAPSAQADVEPEAPSAQADAEPEAPSAQVA 615

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                +          +       +     +    +    + +  +              
Sbjct: 616 EPEVPSAQADAEPEVPSAQADAEPEAPSAQVAEPEVPSAQADAEPEVPSPQADAEPEVPS 675

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              + + +   + +  +      +  +E +V           ++  +  +  +   + + 
Sbjct: 676 PQADAEPEVPPAQVDAEPEVPSPQADAEPEVSSPQAAAEPEVSSPQVDAEPEVSSPQAAA 735

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                    +  P +   +           + +     S Q      +       +  + 
Sbjct: 736 EPEVPSPQADAEPEVPSPQADAEPEVPSPQVDAESEAPSPQAAPESEVPSPQAAPESEVP 795

Query: 372 D 372
            
Sbjct: 796 S 796



 Score = 76.6 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/361 (4%), Positives = 64/361 (17%), Gaps = 1/361 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKP-RLPKEILERQFNKLEQAILQVEKQNQKS 71
               +  PE  S   +      + + ++      P+   E +    +            +
Sbjct: 425 SAQADAEPEVPSAQADAEPEVPSPQADAEPEVPSPQADAEPEVPSAQADAETEVPSQADA 484

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                  +    P+      +     P     +     + H                   
Sbjct: 485 EPEVPSPQADAEPEVPSAQADAEPEVPSPHVDAEPEVPSPHIDAEPEAPSAQADAEPEAP 544

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
           S +  +             +     + +                 A     P      + 
Sbjct: 545 SAQADAEPEVPSPHVDAEPEVPSAQADAEPEVPSAQADAEPEAPSAQADVEPEAPSAQAD 604

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                   +       +       +           A     +  +   +          
Sbjct: 605 AEPEAPSAQVAEPEVPSAQADAEPEVPSAQADAEPEAPSAQVAEPEVPSAQADAEPEVPS 664

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              + + +        +      +  +E +V           ++   A +  +   +   
Sbjct: 665 PQADAEPEVPSPQADAEPEVPPAQVDAEPEVPSPQADAEPEVSSPQAAAEPEVSSPQVDA 724

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                       P +   +             +   + S Q +            +  + 
Sbjct: 725 EPEVSSPQAAAEPEVPSPQADAEPEVPSPQADAEPEVPSPQVDAESEAPSPQAAPESEVP 784

Query: 372 D 372
            
Sbjct: 785 S 785



 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/353 (6%), Positives = 56/353 (15%), Gaps = 3/353 (0%)

Query: 28  EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
           E A        +                +   A   VE +   +   ++ +  S    + 
Sbjct: 372 ERAAEPEVPTPQVDAEPEAPTPQVDAEPEDPSAQADVEPEVPSAQADAEPEVPSAQADAE 431

Query: 88  VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
                                  +          +  S      +           +   
Sbjct: 432 PEVPSAQADAEPEVPSPQADAEPEVPSPQADAEPEVPSAQADAETEVPSQADAEPEVPSP 491

Query: 148 VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
                    S    A  E     +                  S       +     +   
Sbjct: 492 QADAEPEVPSAQADAEPEVPSPHVDAEPEVPSPHIDAEPEAPSAQADAEPEAPSAQADAE 551

Query: 208 ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR---ESLDGGNVDKKNVFSG 264
                        +      A     S            +            D +     
Sbjct: 552 PEVPSPHVDAEPEVPSAQADAEPEVPSAQADAEPEAPSAQADVEPEAPSAQADAEPEAPS 611

Query: 265 IRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP 324
            +                 PS    A+    S    +  +   +            +  P
Sbjct: 612 AQVAEPEVPSAQADAEPEVPSAQADAEPEAPSAQVAEPEVPSAQADAEPEVPSPQADAEP 671

Query: 325 LIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSA 377
            +   +         + + +   + S Q +    +       +  +      A
Sbjct: 672 EVPSPQADAEPEVPPAQVDAEPEVPSPQADAEPEVSSPQAAAEPEVSSPQVDA 724



 Score = 66.2 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/340 (4%), Positives = 58/340 (17%)

Query: 38  LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
           L++    L   +  +  +  E+A        Q          + D      +++ ++  E
Sbjct: 352 LKNENKALRSSLANKDVSSNERAAEPEVPTPQVDAEPEAPTPQVDAEPEDPSAQADVEPE 411

Query: 98  PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
                  +       +  A       ++     +               +        + 
Sbjct: 412 VPSAQADAEPEVPSAQADAEPEVPSAQADAEPEVPSPQADAEPEVPSPQADAEPEVPSAQ 471

Query: 158 VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
                 +                + P      +                           
Sbjct: 472 ADAETEVPSQADAEPEVPSPQADAEPEVPSAQADAEPEVPSPHVDAEPEVPSPHIDAEPE 531

Query: 218 FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
                         + +  + +    H      +     D +      +           
Sbjct: 532 APSAQADAEPEAPSAQADAEPEVPSPHVDAEPEVPSAQADAEPEVPSAQADAEPEAPSAQ 591

Query: 278 SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR 337
           ++V+    +          +            +         +                 
Sbjct: 592 ADVEPEAPSAQADAEPEAPSAQVAEPEVPSAQADAEPEVPSAQADAEPEAPSAQVAEPEV 651

Query: 338 GQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSA 377
             +   +   + S Q +    +       +  +      A
Sbjct: 652 PSAQADAEPEVPSPQADAEPEVPSPQADAEPEVPPAQVDA 691


>gi|306824573|ref|ZP_07457919.1| streptococcal surface protein A [Streptococcus sp. oral taxon 071
            str. 73H25AP]
 gi|304433360|gb|EFM36330.1| streptococcal surface protein A [Streptococcus sp. oral taxon 071
            str. 73H25AP]
          Length = 1558

 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 78/262 (29%), Gaps = 3/262 (1%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQKSLHTSKQ 77
            P   +  YE+      +  +  +P  P+E        LE A      E +    + T  Q
Sbjct: 864  PAPVAPSYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKTPDQ 923

Query: 78   DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
             + S   + +  +++ +   P   S  +              S   +   +   +P    
Sbjct: 924  PEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYDPLPTPPVAP 983

Query: 138  CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFN 197
               +     +V T H + + +     I  +        +          + + +      
Sbjct: 984  TPKQLPTPPAVPTVHFHYNRLFAQPQINKEIKNEDGVDIDRTLVAKQSVVKFELKTEALT 1043

Query: 198  KTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD 257
              R   +    L +     Y   L      + G   S  K+  ++T     E+L   N D
Sbjct: 1044 AGRPKTT-SFVLVDPLPTGYQFDLEATKAASKGFETSYDKASHTVTFKATDETLATYNAD 1102

Query: 258  KKNVFSGIRPKITRRLLEDGSE 279
                   + P +  R+L DG+ 
Sbjct: 1103 LTKPVETLYPTVVGRVLNDGAT 1124



 Score = 51.5 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/161 (6%), Positives = 28/161 (17%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
            +  K K    +     ++ T     P + +       +         D           
Sbjct: 835 PKITKEKPTPPVAPTAPQAPTYETEKPLDPAPVAPSYENEPTPPVKTPDQPEPSKPEEPT 894

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
            ++           S+                ++     Y                    
Sbjct: 895 YETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPT 954

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
             +        SK    ++    +       K+       P
Sbjct: 955 PPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVP 995



 Score = 51.5 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/163 (7%), Positives = 30/163 (18%), Gaps = 3/163 (1%)

Query: 103 ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
           +  I +      +A          T   L P   +       +  V T  + + S     
Sbjct: 834 VPKITKEKPTPPVAPTAPQAPTYETEKPLDPAPVAPSYENEPTPPVKTPDQPEPSKPEEP 893

Query: 163 AIEHD---KSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
             E +   +            + P  +      +     T               ++   
Sbjct: 894 TYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEP 953

Query: 220 FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
              +        S     +   +       +            
Sbjct: 954 TPPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 996


>gi|268552815|ref|XP_002634390.1| Hypothetical protein CBG04386 [Caenorhabditis briggsae]
 gi|187035763|emb|CAP25100.1| hypothetical protein CBG_04386 [Caenorhabditis briggsae AF16]
          Length = 594

 Score = 82.7 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/349 (8%), Positives = 70/349 (20%), Gaps = 3/349 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              P   P  R            +   S++P    +  +        A    E +     
Sbjct: 185 SPEPSEQPSPRPVEPSEEPEPSDKPEPSVEPSADPQPSDE---PQPSAGPSDEPEPSAKP 241

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             S++ + SD P+ S    E     P+  +  S       +   ++   +    ++    
Sbjct: 242 QPSEEPEPSDKPEPSAEPSEQPSDAPQPSAKPSDEPQPSDQPEPSVEPSKDPQPSDEPQP 301

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
               S   +       + +     S +                       P+     S  
Sbjct: 302 SAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAE 361

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +     S     S                 A   S                    
Sbjct: 362 PSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPQPSEQPEPSAEPS 421

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
               D  +       +      +    V+      P A+ +     + +       +S  
Sbjct: 422 EQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQPSAEPSDEPQPSSGP 481

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
               +  ++  P              + S    +      + +      
Sbjct: 482 EPSVEPSKDPQPSDAPQPSAEPSDEPEPSAEPSEAPQPSDKPQPSDKPQ 530



 Score = 81.6 bits (199), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/338 (10%), Positives = 74/338 (21%)

Query: 26  IYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPK 85
             E +        E   PR  +   E + +   +  ++     Q S         SD P+
Sbjct: 177 QPEPSAEPSPEPSEQPSPRPVEPSEEPEPSDKPEPSVEPSADPQPSDEPQPSAGPSDEPE 236

Query: 86  SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILS 145
            S   + +   EP  +   S   S +        +        ++    +         S
Sbjct: 237 PSAKPQPSEEPEPSDKPEPSAEPSEQPSDAPQPSAKPSDEPQPSDQPEPSVEPSKDPQPS 296

Query: 146 FSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
                  E      P    E       +   A        S      +            
Sbjct: 297 DEPQPSAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDP 356

Query: 206 YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
           + +       +           + G   S+  SK        + S +  +  + +     
Sbjct: 357 HPSAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPQPSEQPEP 416

Query: 266 RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
             + + +  +  S   VGPS  P        ++            +            P 
Sbjct: 417 SAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQPSAEPSDEPQ 476

Query: 326 IGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
              G     +              +   ++ +      
Sbjct: 477 PSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPEPSAEPS 514



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/351 (5%), Positives = 58/351 (16%), Gaps = 1/351 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              P + P+      +  + S      +     P E    +  +  +     +K      
Sbjct: 155 SEQPSDAPQPSVQPSDEPQPSDQPEPSAEPSPEPSEQPSPRPVEPSEEPEPSDKPEPSVE 214

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
            ++      +   S+  S E         S                       + +   S
Sbjct: 215 PSADPQPSDEPQPSAGPSDEPEPSAKPQPSEEPEPSDKPEPSAEPSEQPSDAPQPSAKPS 274

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            +       E            D         +  +   +  + +   S           
Sbjct: 275 DEPQPSDQPEPSVEPSKDPQPSDEPQPSAEPSDEPQPSEQP-EPSAEPSEQPSDASSPGP 333

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +         ++                  +   S     S G        +   
Sbjct: 334 VGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQ 393

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
             +  + +      P+ + +        +             +      +        + 
Sbjct: 394 PSDAPQPSAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSE 453

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                      P          +                  +  Q      
Sbjct: 454 DPHPSAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPS 504



 Score = 73.9 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/353 (5%), Positives = 61/353 (17%), Gaps = 4/353 (1%)

Query: 24  SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI 83
               E   ++                + +            E +          D     
Sbjct: 106 QPSEEPQPSAEPSDKPDPSSPPSPGPMTKGPQPPNPPEPSDEPEPSAEPSEQPSDAPQPS 165

Query: 84  PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
            + S   + +   EP              + +      +   +   ++ P        E 
Sbjct: 166 VQPSDEPQPSDQPEPSAEPSPEPSEQPSPRPVEPSEEPEPSDKPEPSVEPSADPQPSDEP 225

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLL 203
              +  +     S+    +       +                      +      +   
Sbjct: 226 QPSAGPSDEPEPSAKPQPSEEPEPSDKPEPSAEPSEQPSDAPQPSAKPSDEPQPSDQPEP 285

Query: 204 SFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFS 263
           S   +       +                                    G + + +    
Sbjct: 286 SVEPSKDPQPSDEPQPSAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDK 345

Query: 264 GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV----LGKKEI 319
                         +E    P            +   +  +   ++           +  
Sbjct: 346 PEPSVEPSEDPHPSAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPS 405

Query: 320 EEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMID 372
           +E  P            +   +   G +  S + E S   +  V   + P   
Sbjct: 406 DEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPS 458



 Score = 70.0 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 32/366 (8%), Positives = 69/366 (18%), Gaps = 15/366 (4%)

Query: 13  DNLPENTPERRS----HIYEHARNSVARRL-----------ESMKPRLPKEILERQFNKL 57
           D      PE  S     +   A +S                E  +P           +  
Sbjct: 68  DAPSSAAPEVPSSSTPEVPSEAPSSPTEEPIKSTSGPFQPSEEPQPSAEPSDKPDPSSPP 127

Query: 58  EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
               +    Q       S + + S  P    +      ++P      S       +    
Sbjct: 128 SPGPMTKGPQPPNPPEPSDEPEPSAEPSEQPSDAPQPSVQPSDEPQPSDQPEPSAEPSPE 187

Query: 118 ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                       +  P+        +   +     +     +  +      ++ +  +  
Sbjct: 188 PSEQPSPRPVEPSEEPEPSDKPEPSVEPSADPQPSDEPQPSAGPSDEPEPSAKPQPSEEP 247

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                P  S   S       +     S     S+                    S     
Sbjct: 248 EPSDKPEPSAEPSEQPSDAPQPSAKPSDEPQPSDQPEPSVEPSKDPQPSDEPQPSAEPSD 307

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
                              D  +       +      +    V+      P A+ +    
Sbjct: 308 EPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQ 367

Query: 298 IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
            + +       +S      +  ++  P              Q S          +Q    
Sbjct: 368 PSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPQPSEQPEPSAEPSEQPSDA 427

Query: 358 GLKGLV 363
              G V
Sbjct: 428 SSPGPV 433



 Score = 62.7 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/250 (8%), Positives = 52/250 (20%), Gaps = 3/250 (1%)

Query: 38  LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
             S  P+   E         E    +  + + +                S   + +   E
Sbjct: 288 EPSKDPQPSDEPQPSAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPE 347

Query: 98  PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
           P +        S +  +     +        ++    +         S +     E    
Sbjct: 348 PSVEPSEDPHPSAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDE 407

Query: 158 VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
             P    E       +   A        S      +            + +       + 
Sbjct: 408 PQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQP 467

Query: 218 FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
                     + G   S+  SK        + S +  +  + +      P+ + +     
Sbjct: 468 SAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPEPSAEPSEAPQPSDKPQPSD 527

Query: 278 SEVDVGPSTI 287
                 PS  
Sbjct: 528 K---PQPSGP 534



 Score = 56.6 bits (134), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/236 (7%), Positives = 40/236 (16%), Gaps = 3/236 (1%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              P + P+        A  S      S    +         +K E     VE       
Sbjct: 302 SAEPSDEPQPSEQPEPSAEPSEQPSDASSPGPVGPSEEPEPSDKPEP---SVEPSEDPHP 358

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                +      + S   + +   EP +        S+  +  A        S      +
Sbjct: 359 SAEPSEAPQPSAEPSDEPQPSSGPEPSVEPSKDPQPSDAPQPSAEPSDEPQPSEQPEPSA 418

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
             +              ++    S     +    +                  S      
Sbjct: 419 EPSEQPSDASSPGPVGPSEEPEPSDKPEPSVEPSEDPHPSAEPSEAPQPSAEPSDEPQPS 478

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
           +              + +     +           +     S              
Sbjct: 479 SGPEPSVEPSKDPQPSDAPQPSAEPSDEPEPSAEPSEAPQPSDKPQPSDKPQPSGP 534


>gi|146342453|ref|YP_001207501.1| hypothetical protein BRADO5612 [Bradyrhizobium sp. ORS278]
 gi|146195259|emb|CAL79284.1| hypothetical protein BRADO5612 [Bradyrhizobium sp. ORS278]
          Length = 273

 Score = 82.4 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 59/129 (45%)

Query: 2   VDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI 61
            D+ +++ RA++NLPE++ ERR+ +Y+ AR ++  +LE+M P + +  ++ +   L+ A+
Sbjct: 26  ADYFILLSRAMENLPESSAERRAEVYQSARQALVSQLEAMHPPVSRSRIKAEQRALDDAV 85

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
             +E +   +   +      D P  S +  +   +        +      H +  +  S 
Sbjct: 86  DTIETRALTAEDAADSSLVPDTPPVSSSDPDRSPMFVSTAHDEAEDPVMAHSQFQSKFSP 145

Query: 122 QGKSRTNTN 130
           +       +
Sbjct: 146 RAVEEKPMS 154


>gi|332866247|ref|XP_001160384.2| PREDICTED: protein piccolo isoform 1 [Pan troglodytes]
          Length = 5143

 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/295 (6%), Positives = 51/295 (17%)

Query: 32  NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSK 91
            SV   L+S      ++    +    +    + +    K         +    +      
Sbjct: 292 ESVKPSLQSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKP 351

Query: 92  ENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQ 151
                         +  +    +         +      L+      +            
Sbjct: 352 PVQPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPP 411

Query: 152 HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
            +   +  P+A     +S  +            G            KT    +  +    
Sbjct: 412 TQQVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPS 471

Query: 212 HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                  +                            +         K         K   
Sbjct: 472 QLPGPAKLPPQQPGPAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPS 531

Query: 272 RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLI 326
           +           PS    +   +T  ++        +  T     K+    +   
Sbjct: 532 QQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQDLPK 586



 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/347 (6%), Positives = 54/347 (15%), Gaps = 20/347 (5%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q            
Sbjct: 261 PAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQSPSKPPIQQP-----TPGKPP 315

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            Q    +  +                            +         +         + 
Sbjct: 316 AQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQ 375

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                                           +        A                  
Sbjct: 376 TGSEKPSSE---------------QPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP 420

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
             +  GL S   A               +     G   +  +  G      +        
Sbjct: 421 LAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKLP 480

Query: 256 VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
             +         +               P                       +  +    
Sbjct: 481 PQQPGPAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPSQQPGSAKPS 540

Query: 316 KKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
            ++     P   +    +++      +    +  S +Q  SQ L   
Sbjct: 541 AQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQDLPKT 587



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/361 (6%), Positives = 64/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++  Q   S   +KQ           
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKP 296

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
           + +      P  +       + +     +           + L+                
Sbjct: 297 SLQSPSKP-PIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQP 355

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
               +      P+   +    +    K +     P              +  G     + 
Sbjct: 356 PGTTKP--PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                L         P                       +  +     ++     P   +
Sbjct: 474 PGPAKLPPQQPGPAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQDLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 52.7 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 71/326 (21%), Gaps = 5/326 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P               +  + + ++       +   +Q   ++     V   +  
Sbjct: 718  AKAKQPPEADSSSKPAPPKEPSVPSEQDKA----PVADDKPKQPKMVKPTTDLVSSSSAT 773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K     +   T           +S               I      S+  ++
Sbjct: 774  TKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISH 833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P + S   +++       + +   +            +          +         
Sbjct: 834  PGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQ 893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++R       ++++    +       + G   G   SI     ++     +  
Sbjct: 894  QSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPG 953

Query: 251  LDGGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                +     +  +    +         S     P+          +       +     
Sbjct: 954  PHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAE 1013

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINK 335
                + + E E+  P I + +    +
Sbjct: 1014 QAPTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 52.7 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/300 (4%), Positives = 40/300 (13%), Gaps = 7/300 (2%)

Query: 79  KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
                 + +   ++ +  E             +          +                
Sbjct: 181 DSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPVPKQQRPGRDPLQQDGTPKSIS 240

Query: 139 RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +     S                         +   +   +     +           
Sbjct: 241 SQQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQS 300

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES--LDGGNV 256
                       +    +                 S      +      +      G   
Sbjct: 301 PSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTK 360

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
                    +P   +   E  S    GP  +        +                    
Sbjct: 361 PPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP 420

Query: 317 KEIEEG-----NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
              + G                  G G+          +  Q+         + G   + 
Sbjct: 421 LAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKLP 480



 Score = 50.8 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/376 (5%), Positives = 71/376 (18%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E              + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSSSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 47.7 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 34/349 (9%), Positives = 79/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +  P     
Sbjct: 466 PTKPPSQLPGPAKLPPQQPGPAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 SAKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQDLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD ++      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSSSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            +
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVT 814



 Score = 45.0 bits (104), Expect = 0.029,   Method: Composition-based stats.
 Identities = 15/276 (5%), Positives = 41/276 (14%), Gaps = 6/276 (2%)

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
            +       K+                   +     + +      +   +  +  S  + 
Sbjct: 183 EASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPVPKQQRPGRDPLQQDGTPKSISSQ 242

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                     G    I                        +  + +      K  +    
Sbjct: 243 QPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQSPS 302

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGSEVD 281
              +           +          +          K +                ++  
Sbjct: 303 KPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPP 362

Query: 282 VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFINKGR 337
             P          T +    +   G +      G  +     P       +         
Sbjct: 363 AQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLA 422

Query: 338 GQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
            Q  + S        +   Q      I         
Sbjct: 423 QQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 45.0 bits (104), Expect = 0.031,   Method: Composition-based stats.
 Identities = 15/363 (4%), Positives = 57/363 (15%), Gaps = 6/363 (1%)

Query: 21  ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKE 80
           +  S +   A+    +   +  P       +    +   A    ++         +    
Sbjct: 468 KPPSQLPGPAKLPPQQPGPAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSA 527

Query: 81  SDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
               +   ++K +       +  +        +  +           +    P     + 
Sbjct: 528 KPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQDLPKT 587

Query: 141 REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI------FWSVHNY 194
              L  +           +     E   +                               
Sbjct: 588 ICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRALG 647

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                          +        V                   +        ++     
Sbjct: 648 GDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPPLV 707

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                +     + K                 ++P                   + +T ++
Sbjct: 708 KQPTLHGSPSAKAKQPPEADSSSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLV 767

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                     +         + +    + +     S     +           IP   + 
Sbjct: 768 SSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASD 827

Query: 375 FSA 377
              
Sbjct: 828 SKI 830



 Score = 42.3 bits (97), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNPLSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPVPKQQRPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLQSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|71413651|ref|XP_808957.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70873262|gb|EAN87106.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 1446

 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/354 (5%), Positives = 59/354 (16%), Gaps = 3/354 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQN 68
            A     E  P              +   +  +P+  +       +           E + 
Sbjct: 835  AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEP 894

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +      ++   +P     +    +            +      
Sbjct: 895  AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKP 954

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                         +            +            K    +          +    
Sbjct: 955  AEPKSAEPKPAEPKSAEPKPAEPKSAE-PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPK 1013

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
             +       +     S     +E    +         G       S             +
Sbjct: 1014 PAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPK 1073

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             +       +        PK            +   +    A+  +      K    G +
Sbjct: 1074 PAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPK 1133

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             +       +  E      +     +     +   S +   +  +         
Sbjct: 1134 PAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEP 1187



 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/361 (5%), Positives = 56/361 (15%), Gaps = 8/361 (2%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQN 68
            A     E  P              +   +  +P+  +       +           E + 
Sbjct: 815  AEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEP 874

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +      ++   +P     +    +            +      
Sbjct: 875  AEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKP 934

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL---RRGKLAGIFSFPTG 185
                         +            +   +   + E   +              + P  
Sbjct: 935  AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKP 994

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
            +   S                   S                          + K +    
Sbjct: 995  AEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKP 1054

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +S +    + K+         +        +        P +     +         
Sbjct: 1055 AEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKP 1114

Query: 306  GDENSTFVLGKKE---IEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             +  S      K      +       G         +      K       E        
Sbjct: 1115 AEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKP 1174

Query: 363  V 363
             
Sbjct: 1175 A 1175



 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 18/387 (4%), Positives = 60/387 (15%), Gaps = 3/387 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A     E  P              +   +  +P+  +       +   +       + + 
Sbjct: 985  AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKP 1044

Query: 71   SLHTSKQDKESDI--PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +   S   K ++    +   T  ++   +P     +    +            +      
Sbjct: 1045 AEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKP 1104

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                         +                +   +     +  +  +             
Sbjct: 1105 AEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKP 1164

Query: 189  WSVHNYFFNKTRG-LLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                +               A  +    +               S     ++        
Sbjct: 1165 AEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKP 1224

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             E         +   +  +P   +    + +E             A       K+     
Sbjct: 1225 AEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEP 1284

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
                    K                      +      +                     
Sbjct: 1285 TEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKP 1344

Query: 368  IPMIDNAFSASMTLKCNADISLSITHV 394
                    +A+           S +  
Sbjct: 1345 AEPKSAELNATTPSAREGAADQSASVT 1371



 Score = 80.8 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/365 (7%), Positives = 59/365 (16%), Gaps = 5/365 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQN 68
            A     E  P              +   +  +P+  +       +           E + 
Sbjct: 965  AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEP 1024

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +      ++   +P     +    +            +      
Sbjct: 1025 AEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEP-- 1082

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    +         +     E  S+    A  +  +    + K AG       S  
Sbjct: 1083 -EPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAG 1141

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                     + +      +                        +                
Sbjct: 1142 PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAE 1201

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                     +         +               P +         S           E
Sbjct: 1202 PEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAE 1261

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
                     E +   P   E      K  G              + KS   +    K   
Sbjct: 1262 PEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAE 1321

Query: 369  PMIDN 373
            P    
Sbjct: 1322 PEPTE 1326



 Score = 80.8 bits (197), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/349 (4%), Positives = 57/349 (16%), Gaps = 3/349 (0%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
              P              +   +  +P+  +       +   +       + + +   S +
Sbjct: 802  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAE 861

Query: 78   DKESDI--PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             K ++    +      ++   +P     +    +            +             
Sbjct: 862  PKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAE 921

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                  +            +   +   + E   +  +  +                 +  
Sbjct: 922  PKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE 981

Query: 196  FNKTRGLLSFYSALSE-HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                    +            K           A   S     ++         E     
Sbjct: 982  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAE 1041

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                +   +G +P   +    + +E             A       K+            
Sbjct: 1042 PKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAG 1101

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
             K    +                 +      K                 
Sbjct: 1102 PKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSA 1150



 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/355 (5%), Positives = 55/355 (15%), Gaps = 6/355 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNK--LEQAILQVEKQN 68
            A     E  P              +   +  +P+  +       +           E + 
Sbjct: 755  AEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKP 814

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +      ++   +P     +    +            +      
Sbjct: 815  AEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEP-- 872

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    +         +     E  S+    A  +  + +    K A        S  
Sbjct: 873  -EPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAG 931

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                     + +      +                        +                
Sbjct: 932  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE 991

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                     +       +    +      +E +           A   +   K       
Sbjct: 992  PKPAEPKSAEPKPAEP-KSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSA 1050

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                   K    E       G         +      K       E         
Sbjct: 1051 GPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPA 1105



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/362 (4%), Positives = 56/362 (15%), Gaps = 5/362 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNK--LEQAILQVEKQN 68
            A     E  P              +   +  +P+  +       +           E + 
Sbjct: 1025 AEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEP 1084

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E           ++   +P     +    +            +      
Sbjct: 1085 AEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKP 1144

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL---RRGKLAGIFSFPTG 185
                         +            +   +   +     +              + P  
Sbjct: 1145 AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEP 1204

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
            +   S                   S                          + K +    
Sbjct: 1205 TEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEP 1264

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
               +S +    + K+         +                 P +     +         
Sbjct: 1265 AEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEP 1324

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
             +  S      +               +N     +   +     S+    +         
Sbjct: 1325 TEPKSAGPKPAEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVTSSGASSTDVGASS 1384

Query: 366  GD 367
             D
Sbjct: 1385 SD 1386



 Score = 77.4 bits (188), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 12/317 (3%), Positives = 46/317 (14%)

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
                   E +  +      +  E    +      ++   +P     +    +        
Sbjct: 754  PAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPK 813

Query: 118  ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                +                   +            +   +   + E   +  +  +  
Sbjct: 814  PAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPE 873

Query: 178  GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                           +          +                             +  K
Sbjct: 874  PAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPK 933

Query: 238  SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
                 +   +               S        +  E            P    +    
Sbjct: 934  PAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPK 993

Query: 298  IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
             A                 K  E  +           + +      +       +    +
Sbjct: 994  PAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPK 1053

Query: 358  GLKGLVIKGDIPMIDNA 374
              +    + +     +A
Sbjct: 1054 PAEPKSAEPEPTEPKSA 1070



 Score = 74.7 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/358 (4%), Positives = 51/358 (14%), Gaps = 1/358 (0%)

Query: 36   RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
                      P           +     +   +  S     +  E    +      ++  
Sbjct: 712  ANERVTTNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAG 771

Query: 96   LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
             +P     +    +            +                   +            +
Sbjct: 772  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE 831

Query: 156  SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE-HHL 214
               +   + E   +  +  +                 +          +           
Sbjct: 832  PEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAE 891

Query: 215  FKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLL 274
             +           A   S     ++         E    G    +   +  +P   +   
Sbjct: 892  PEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAE 951

Query: 275  EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFIN 334
               +E             A       K+             K    +             
Sbjct: 952  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE 1011

Query: 335  KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
                +      +       E                       +       + +   +
Sbjct: 1012 PKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKS 1069



 Score = 70.4 bits (170), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/345 (5%), Positives = 63/345 (18%), Gaps = 3/345 (0%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
              P              +   +  +P+  +       +   +         + +   S +
Sbjct: 1052 PKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAE 1111

Query: 78   DKESDI--PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             K ++    +   T  ++   +P     +    +            +             
Sbjct: 1112 PKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE 1171

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                  +            +   +   + E + +  +  +                ++  
Sbjct: 1172 PKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAE 1231

Query: 196  FNKTRGLLSFYSALSE-HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T    +            +           A   S     ++         E    G
Sbjct: 1232 PEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAG 1291

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                +   +  +P   +    + +E             A        +            
Sbjct: 1292 PKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAE 1351

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
                         +    +      S+ +        Q    +G 
Sbjct: 1352 LNATTPSAREGAADQSASVTSSGASSTDVGASSSDDAQTVGMEGG 1396



 Score = 68.1 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/333 (6%), Positives = 60/333 (18%), Gaps = 4/333 (1%)

Query: 17   ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQ-VEKQNQKSLHTS 75
                E +S   E A    A    +       +  E +  + + A  +  E +  K     
Sbjct: 1072 PKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAG 1131

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             +  E           ++   +P     +    +            +             
Sbjct: 1132 PKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAE 1191

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL---RRGKLAGIFSFPTGSIFWSVH 192
                  +            +   +   + E   +              + P  +   S  
Sbjct: 1192 PEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAE 1251

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                             S                          +   +       +S +
Sbjct: 1252 PEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAE 1311

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                + K+         +                 P +   N +  + +        S  
Sbjct: 1312 PEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVT 1371

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSG 345
              G    + G     + +    +G         
Sbjct: 1372 SSGASSTDVGASSSDDAQTVGMEGGDMMQADQP 1404



 Score = 59.6 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/309 (4%), Positives = 54/309 (17%), Gaps = 2/309 (0%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
              P              +   +  +P+  +       +   +         + +   S +
Sbjct: 1132 PKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAE 1191

Query: 78   DKESDI--PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             + ++    +   T  ++   EP     +    +  +         +             
Sbjct: 1192 PEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAE 1251

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                  +            +   +   + E + +  +         +          +  
Sbjct: 1252 PEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAE 1311

Query: 196  FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
               T    +                             +   +          +      
Sbjct: 1312 PEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVT 1371

Query: 256  VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
                +                    D+  +  PV     T + A       +      L 
Sbjct: 1372 SSGASSTDVGASSSDDAQTVGMEGGDMMQADQPVQFSVGTPDAANAATHNAEGKGQDGLH 1431

Query: 316  KKEIEEGNP 324
             +  E    
Sbjct: 1432 PQVKEAEAA 1440



 Score = 59.6 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/314 (5%), Positives = 56/314 (17%), Gaps = 2/314 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A     E  P +            +   +  +P+  +       +   +       + + 
Sbjct: 1115 AEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKP 1174

Query: 71   SLHTSKQDKESDI--PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +   S   K ++    +      ++   EP     +    +                   
Sbjct: 1175 AEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEP 1234

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            T            +            +   +   + E   +  +  +         G   
Sbjct: 1235 TEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKP 1294

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
               ++          +                             +  K     +  L  
Sbjct: 1295 AEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNA 1354

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             +            S      +   +   S  D     +   D          +    D 
Sbjct: 1355 TTPSAREGAADQSASVTSSGASSTDVGASSSDDAQTVGMEGGDMMQADQPVQFSVGTPDA 1414

Query: 309  NSTFVLGKKEIEEG 322
             +      +   + 
Sbjct: 1415 ANAATHNAEGKGQD 1428



 Score = 52.7 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/301 (3%), Positives = 42/301 (13%), Gaps = 2/301 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA--ILQVEKQN 68
            A     E  P              +   +  +P+          +   +       E + 
Sbjct: 1145 AEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEP 1204

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             +      +  E    +       +   EP     +    +            +      
Sbjct: 1205 TEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEP 1264

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                         +                +   + E   +  +  +             
Sbjct: 1265 AEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEP 1324

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +          +                     G A   +        S       
Sbjct: 1325 TEPKSAGPKPAEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVTSSGASSTDVGASS 1384

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                     +          +   +    +      +            +          
Sbjct: 1385 SDDAQTVGMEGGDMMQADQPVQFSVGTPDAANAATHNAEGKGQDGLHPQVKEAEAATLSS 1444

Query: 309  N 309
            +
Sbjct: 1445 S 1445


>gi|42519684|ref|NP_965614.1| hypothetical protein LJ0641 [Lactobacillus johnsonii NCC 533]
 gi|41583973|gb|AAS09580.1| hypothetical protein LJ_0641 [Lactobacillus johnsonii NCC 533]
          Length = 1563

 Score = 82.4 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/278 (7%), Positives = 50/278 (17%), Gaps = 5/278 (1%)

Query: 19   TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
            T E              +  + ++P  P     +    +E        +  +     +  
Sbjct: 1217 TAEPVKPTKPVQPIKPMQPTKPVQPTKP----VQPTKPVEPTKPVQPTKPVQPTKPVEPT 1272

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
            K     K    +K     +P   +                 +   K       +      
Sbjct: 1273 KPVQPTKPVEPTKPVQPTKPVQPTKPIEPTKPVKPTKPVEPTKPVKPTKPVKPTKPVEPI 1332

Query: 139  RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
            +  +       T+                   +   K          +            
Sbjct: 1333 KPVKPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTKPVQPTKPVKPTKPVEPT 1392

Query: 199  TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
                       ++       V     +     V  +             +       V  
Sbjct: 1393 KPVQPIKPVQPTKPVQPTKPVEPTKPVEPTKPVRPTKPVEPTKPVKPT-KPVEPTKPVQP 1451

Query: 259  KNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
                   +P    + ++    V+      P     +TS
Sbjct: 1452 TKPIEPTKPVEPTKPVQTTKPVEPTKPVQPTKLTISTS 1489


>gi|46201942|ref|ZP_00054046.2| COG3210: Large exoproteins involved in heme utilization or adhesion
           [Magnetospirillum magnetotacticum MS-1]
          Length = 1444

 Score = 82.0 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/273 (6%), Positives = 35/273 (12%), Gaps = 4/273 (1%)

Query: 59  QAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
           +A   V      +  T   D       + V           +   +              
Sbjct: 475 EAPAPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPP 534

Query: 119 LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAG 178
                   T     P              V            V                 
Sbjct: 535 ADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPP 594

Query: 179 IFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV----FLIILLGMAIGVSYS 234
               P               T         +                       +  +  
Sbjct: 595 ADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPP 654

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
              +    T      +         +    +                    T    +   
Sbjct: 655 ADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPTEDNTPP 714

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
                 ++     E +        +E G P+  
Sbjct: 715 VEPTPTEDNTPPVEPTPTEDNTPPVEPGPPVTP 747



 Score = 74.3 bits (180), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/286 (6%), Positives = 35/286 (12%), Gaps = 6/286 (2%)

Query: 26  IYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPK 85
           +   AR  V      +    P +               V      +  T   D       
Sbjct: 466 VPGTARFDVEAPAPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP 525

Query: 86  SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILS 145
           + V           +   +                      T     P            
Sbjct: 526 TPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP 585

Query: 146 FSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
             V            V                     P               T      
Sbjct: 586 TPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP 645

Query: 206 YSALSEHHLFKYFV----FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNV 261
              +                       +  +     +    T      +         + 
Sbjct: 646 TPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP 705

Query: 262 FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                   T  +    +E +  P      +                
Sbjct: 706 TPTE--DNTPPVEPTPTEDNTPPVEPTPTEDNTPPVEPGPPVTPPS 749



 Score = 62.3 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/241 (4%), Positives = 40/241 (16%), Gaps = 2/241 (0%)

Query: 123 GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
                N      N           + + + +   ++S         +     +       
Sbjct: 423 SALSANNGTITDNHDGTYTFTPDANFHGEVDLHYTISDGNGGTVPGTARFDVEAPAPVVD 482

Query: 183 PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            T     +                +                     +  +     +    
Sbjct: 483 TTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADPTPVVD 542

Query: 243 THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
           T      +         +    +             +        PV D    ++     
Sbjct: 543 TTPPADPTPVVDTTPPADPTPVVDTTPPADPTP-VVDTTPPADPTPVVDTTPPADPTPVV 601

Query: 303 YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                 + T V+      +  P++       +      +         +          +
Sbjct: 602 DTTPPADPTPVVDTTPPADPTPVVD-TTPPADPTPVVDTTPPADPTPVVDTTPPADPTPV 660

Query: 363 V 363
           V
Sbjct: 661 V 661


>gi|119597392|gb|EAW76986.1| hCG19253, isoform CRA_b [Homo sapiens]
          Length = 5314

 Score = 81.6 bits (199), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 69.3 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 58.5 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 53.9 bits (127), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 71/326 (21%), Gaps = 5/326 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P               +  + + ++       +   +Q   ++     V   +  
Sbjct: 718  AKAKQPPEADSLSKPAPPKEPSVPSEQDKA----PVADDKPKQPKMVKPTTDLVSSSSAT 773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K     +   T           +S               I      S+  ++
Sbjct: 774  TKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISH 833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P + S   +++       + +   +            +          +         
Sbjct: 834  PGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQ 893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++R       ++++    +       + G   G   SI     ++     +  
Sbjct: 894  QSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPG 953

Query: 251  LDGGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                +     +  +    +         S     P+          +       +     
Sbjct: 954  PHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAE 1013

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINK 335
                + + E E+  P I + +    +
Sbjct: 1014 QAPTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 51.5 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/376 (6%), Positives = 72/376 (19%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 47.7 bits (111), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            +
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVT 814



 Score = 42.3 bits (97), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/276 (5%), Positives = 41/276 (14%), Gaps = 6/276 (2%)

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
            +       K+                   +     + +      +   +  +  S  + 
Sbjct: 183 EASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISSQ 242

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                     G    I                        +  + +      K  +    
Sbjct: 243 QPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPS 302

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGSEVD 281
              +           +          +          K +                ++  
Sbjct: 303 KPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPP 362

Query: 282 VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFINKGR 337
             P          T +    +   G +      G  +     P       +         
Sbjct: 363 AQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLA 422

Query: 338 GQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
            Q  + S        +   Q      I         
Sbjct: 423 QQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 38.1 bits (86), Expect = 3.2,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|119597391|gb|EAW76985.1| hCG19253, isoform CRA_a [Homo sapiens]
          Length = 5305

 Score = 81.2 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 69.3 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 58.1 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 53.9 bits (127), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 71/326 (21%), Gaps = 5/326 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P               +  + + ++       +   +Q   ++     V   +  
Sbjct: 718  AKAKQPPEADSLSKPAPPKEPSVPSEQDKA----PVADDKPKQPKMVKPTTDLVSSSSAT 773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K     +   T           +S               I      S+  ++
Sbjct: 774  TKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISH 833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P + S   +++       + +   +            +          +         
Sbjct: 834  PGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQ 893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++R       ++++    +       + G   G   SI     ++     +  
Sbjct: 894  QSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPG 953

Query: 251  LDGGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                +     +  +    +         S     P+          +       +     
Sbjct: 954  PHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAE 1013

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINK 335
                + + E E+  P I + +    +
Sbjct: 1014 QAPTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 51.5 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/376 (6%), Positives = 72/376 (19%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 47.3 bits (110), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            +
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVT 814



 Score = 42.3 bits (97), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/276 (5%), Positives = 41/276 (14%), Gaps = 6/276 (2%)

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
            +       K+                   +     + +      +   +  +  S  + 
Sbjct: 183 EASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISSQ 242

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                     G    I                        +  + +      K  +    
Sbjct: 243 QPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPS 302

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGSEVD 281
              +           +          +          K +                ++  
Sbjct: 303 KPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPP 362

Query: 282 VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFINKGR 337
             P          T +    +   G +      G  +     P       +         
Sbjct: 363 AQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLA 422

Query: 338 GQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
            Q  + S        +   Q      I         
Sbjct: 423 QQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 38.1 bits (86), Expect = 3.3,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|221472639|ref|NP_787974.4| dumpy [Drosophila melanogaster]
 gi|220901944|gb|AAN10358.5| dumpy [Drosophila melanogaster]
          Length = 22971

 Score = 81.2 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/367 (8%), Positives = 69/367 (18%), Gaps = 15/367 (4%)

Query: 12    VDNLPENTPERRSH---IYEHARNSVARRLESMKPR---LPKEILERQFNKLEQAILQVE 65
             + ++P   P  +     +      + A +   +       P     +       AI  V 
Sbjct: 19165 IPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVY 19224

Query: 66    KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
                  S            P   V  +      P L   +     +    +          
Sbjct: 19225 YPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNP 19284

Query: 126   RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                    P          +    +      +  S V  I    S        GI + P+ 
Sbjct: 19285 PIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSI 19344

Query: 186   SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                              +      +          +   L        +I +        
Sbjct: 19345 PQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPPPLV 19404

Query: 246   LRR-----ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
              +       S+   +              T+R       +++   + P       S    
Sbjct: 19405 QQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQDT 19464

Query: 301   KNYIGGDENSTFVLGKKEIEEGNPLIGEGRV---FINKGRGQSSILSGKI-LWSLQQEKS 356
                    +     +                V                G I + S+ +   
Sbjct: 19465 SYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIP 19524

Query: 357   QGLKGLV 363
                +  V
Sbjct: 19525 SIPQNPV 19531



 Score = 79.3 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/402 (5%), Positives = 63/402 (15%), Gaps = 52/402 (12%)

Query: 12    VDNLPENTPERRSHI------YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE 65
             + +  +  P  R  +       + A  +    +  +       ++  Q   +   I  V 
Sbjct: 19112 IPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVN--IPSVP 19169

Query: 66    KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRS-------------NKH 112
                               P  +                 +                    
Sbjct: 19170 LPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPP 19229

Query: 113   KKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK---- 168
              +   I                 +       +       H   S   P     +      
Sbjct: 19230 SRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDV 19289

Query: 169   -----------------SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                                L +                S            +      + 
Sbjct: 19290 TYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTP 19349

Query: 212   HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                    + +  +             +  S+   L   +    N+ ++            
Sbjct: 19350 QRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPPP------- 19402

Query: 272   RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRV 331
               L     +   PS    +       I    Y       T  +             +   
Sbjct: 19403 --LVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPS 19460

Query: 332   FINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
             + +            +   +           +  G I +   
Sbjct: 19461 YQDTSYPTVQP-KPPVSGIINIPSVPQPVPSLTPGVINLPSE 19501



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/320 (6%), Positives = 57/320 (17%), Gaps = 8/320 (2%)

Query: 61    ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
             I  V +    +  +   D      +S +  +  +   P + S S    +           
Sbjct: 18920 IPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSP 18979

Query: 121   VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVS----PVAAIEHDKSRLRRGKL 176
                      N+          +     + +      +       + ++ H +    +  +
Sbjct: 18980 QIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPV 19039

Query: 177   AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
               +    T S            +       +     H F Y     +     +    S  
Sbjct: 19040 YDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYP 19099

Query: 237   KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVD-VGPSTIPVADFANT 295
                                           P + +                   +   + 
Sbjct: 19100 TPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQ 19159

Query: 296   SNIAFKNYIGGDENSTFVLGKKEIEEGNP-LIGEGRVFINKGRGQS--SILSGKILWSLQ 352
               +     +                  +P    +  V       Q         ++    
Sbjct: 19160 PGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPA 19219

Query: 353   QEKSQGLKGLVIKGDIPMID 372
                          G I +  
Sbjct: 19220 IYDVYYPPPPSRPGVINIPS 19239



 Score = 73.5 bits (178), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 20/319 (6%), Positives = 57/319 (17%), Gaps = 19/319 (5%)

Query: 58    EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
               A   V       +H         +P+       NI   P   + +         +   
Sbjct: 19061 PSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVL--NIPSYPTPVAPTPQSPIYIPSQEQP 19118

Query: 118   ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
               + +       ++    +      +   +  T          V  I          K  
Sbjct: 19119 KPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQR 19178

Query: 178   GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
              +F         +      N        +       + +  ++ +               
Sbjct: 19179 PVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIP 19238

Query: 238   SKGSITHFLRRESLDGGNV----DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
             S     + + ++ +                   P + +      +      +        
Sbjct: 19239 SPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSP 19298

Query: 294   NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                 I     +    ++          + +P I      I                    
Sbjct: 19299 PVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQ------------ 19346

Query: 354   EKSQGLKGLVIKGDIPMID 372
               +       I     +  
Sbjct: 19347 -PTPQRPSPGIINVPSVPQ 19364



 Score = 73.5 bits (178), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 40/433 (9%), Positives = 81/433 (18%), Gaps = 46/433 (10%)

Query: 18    NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
             N P     IY     +      ++    P+     Q   +       +            
Sbjct: 18815 NIPSAPQPIY----PTPQSPQYNVNYPSPQ-PANPQKPGVVNIPSVPQPVYPSPQPPVYD 18869

Query: 78    DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
                   P S      NI   PRL   +S              + Q       ++S   + 
Sbjct: 18870 VNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLSPTPQPGVINIPSVSQPGYP 18929

Query: 138   CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFN 197
                  I   +  T          V  I    S         +      S    V     N
Sbjct: 18930 TPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVIN 18989

Query: 198   KTRGLLSFYSALSEH-------------------------HLFKYFVFLIILLGMAIGVS 232
                  L                                    +      +  +  +   S
Sbjct: 18990 IPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPS 19049

Query: 233   YSIGKSKGSITHFLRRESLDGGNVDKKN---VFSGIRPKITRRLLEDGSEVDVGPSTIPV 289
                 K          +      N              P+    L        V P+    
Sbjct: 19050 PIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSP 19109

Query: 290   ADFANTSNIAFKNYI-----GGDENSTFVLGKKEIEEGNPLIGEGRVFINKG---RGQSS 341
                 +                      +   +  + + N       +    G        
Sbjct: 19110 IYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVP 19169

Query: 342   ILSGKILWSLQQEKSQGLKGLVIK-GDIPMIDNAFSASMTLKCNADISLSITHVMEIMFS 400
             + +  +        S        + G + +   A     T +    +      + ++ + 
Sbjct: 19170 LPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPV-VERPA--IYDVYYP 19226

Query: 401   FPKESQDAVVDLR 413
              P      V+++ 
Sbjct: 19227 PPPSRPG-VINIP 19238



 Score = 70.8 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/359 (5%), Positives = 57/359 (15%), Gaps = 30/359 (8%)

Query: 32    NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTS- 90
              +    +        +  + +Q   +   I  V   +  + +          P+  V   
Sbjct: 18929 PTPQSPIYDANYPTTQSPIPQQPGVVN--IPSVPSPSYPAPNPPVNYPTQPSPQIPVQPG 18986

Query: 91    ------KENIFLEPRLRSISSILRSNKH----------KKLANILSVQGKSRTNTNLSPK 134
                          P+   +      +              + +      +          
Sbjct: 18987 VINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYST 19046

Query: 135   NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
               S   ++    ++ +  +           E +                           
Sbjct: 19047 TPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTP 19106

Query: 195   FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                            +   +                  Y +           +   ++  
Sbjct: 19107 QSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIP 19166

Query: 255   NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG-------D 307
             +V         RP      +        G   IP                          
Sbjct: 19167 SVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYP 19226

Query: 308   ENSTFVLGKKEIEEGNP--LIGEGRVFINKGRGQSSILSG--KILWSLQQEKSQGLKGL 362
                +            P   + +  +++                + S+ Q         
Sbjct: 19227 PPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPP 19285



 Score = 64.3 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/371 (8%), Positives = 81/371 (21%), Gaps = 21/371 (5%)

Query: 40   SMKPRLPKEILERQFNKLEQ--AILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
            +  P   +  +  + + L           ++ ++  T   D  +       T        
Sbjct: 7632 TATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPT 7691

Query: 98   PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
             R    S+         + ++ S    +    +      +  +    +            
Sbjct: 7692 TRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPP 7751

Query: 158  VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
                  I  ++S L            +     ++ + F  +     +  S   +    + 
Sbjct: 7752 SEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTR-DVPTTRP 7810

Query: 218  FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
            F               S+     +                          ++    L   
Sbjct: 7811 FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTIRVEESTLPSR 7870

Query: 278  SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF---VLGKKEIEEGNPLIGEGRVFIN 334
            S     PS  P       S+   + ++     ST         E    +P+  E  V   
Sbjct: 7871 STDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSPVSLETTVPSV 7930

Query: 335  KGRGQSSILSGK----ILWSLQQEKSQGLKGLVIKGD-----------IPMIDNAFSASM 379
                 +++  G     +        S      ++K               +         
Sbjct: 7931 TSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEIPATRVPLES 7990

Query: 380  TLKCNADISLS 390
            T +   D ++ 
Sbjct: 7991 TTRLYTDQTIP 8001


>gi|198474572|ref|XP_002132713.1| GA25732 [Drosophila pseudoobscura pseudoobscura]
 gi|198138447|gb|EDY70115.1| GA25732 [Drosophila pseudoobscura pseudoobscura]
          Length = 1033

 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/268 (7%), Positives = 45/268 (16%), Gaps = 3/268 (1%)

Query: 70  KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
            S     Q   +   +                  +    S    +   I        +  
Sbjct: 17  PSPPPKPQRSGTSANQPGGDPLTTQPSGSPHPPPTQPHGSPPPTRPRGIPQPTQTLASLR 76

Query: 130 NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
            +         +   S      H          +    +    RG      S  +     
Sbjct: 77  PIQTLGSLRPTQAPGSPRPTQSHGSPRPTQDPGS---PRPTQSRGSSQPTQSPGSPRPTQ 133

Query: 190 SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
           S  +    +  G      +              +     I           +      R+
Sbjct: 134 SRGSSQPTQAPGSPRPTQSRGSPPPTLPRGISQVTQLRGISPLPHPRGLPPTTMPRPSRQ 193

Query: 250 SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +           +              +     PS   +A        +  +       
Sbjct: 194 YMAAPGPAPGPGPAPGSGPGPAPGPGPATRRGQPPSRAQMAQRVPVPEPSKASSPVVASP 253

Query: 310 STFVLGKKEIEEGNPLIGEGRVFINKGR 337
           +      K+       I E      + +
Sbjct: 254 TAARPEPKKPSPQKATIEESPEKPKERK 281



 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/263 (7%), Positives = 51/263 (19%), Gaps = 3/263 (1%)

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             + Q   S  P  +          PR     +   ++             ++  +   +
Sbjct: 37  PLTTQPSGSPHPPPTQPHGSPPPTRPRGIPQPTQTLASLRPIQTLGSLRPTQAPGSPRPT 96

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
             + S R  +       TQ    S  +               +       P  +      
Sbjct: 97  QSHGSPRPTQDPGSPRPTQSRGSSQPTQSPGSPRPTQSRGSSQPTQAPGSPRPTQSRGSP 156

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +    ++    +S     +      +       ++                    
Sbjct: 157 PPTLPRGISQVTQLRGISPLPHPRGLPPTTMPRPSRQYMAAPGPAPGPGPAPGSGPGPAP 216

Query: 253 GGNVDKKNVFSGIRPKITRR---LLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
           G     +      R ++ +R        +   V  S           +          E 
Sbjct: 217 GPGPATRRGQPPSRAQMAQRVPVPEPSKASSPVVASPTAARPEPKKPSPQKATIEESPEK 276

Query: 310 STFVLGKKEIEEGNPLIGEGRVF 332
                     ++  P   + +  
Sbjct: 277 PKERKRVIFGKKKEPDSSQDKPP 299



 Score = 70.0 bits (169), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/261 (7%), Positives = 37/261 (14%), Gaps = 5/261 (1%)

Query: 113 KKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR 172
            +           R+ T+ +         +          +   S  P       +    
Sbjct: 12  SQGQRPSPPPKPQRSGTSANQPGGDPLTTQPSGSPHPPPTQPHGSPPPTRPRGIPQPTQT 71

Query: 173 RGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
              L  I +  +     +  +    ++ G              +                
Sbjct: 72  LASLRPIQTLGSLRPTQAPGSPRPTQSHGSPRPTQDPGSPRPTQSRGSSQPTQSPGSPRP 131

Query: 233 YSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF 292
                S                      +  GI      R +         P T      
Sbjct: 132 TQSRGSSQPTQAPGSPRPTQSRGSPPPTLPRGISQVTQLRGISPLPHPRGLPPTTMPRPS 191

Query: 293 AN----TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                            G               G P               S   S  + 
Sbjct: 192 RQYMAAPGPAPGPGPAPGSGPGPAPGPGPATRRGQPPSRAQMAQRVPVPEPSKASSPVVA 251

Query: 349 WSLQQEKSQGLKGLVIKGDIP 369
                           K  I 
Sbjct: 252 SPTAARPEPKKPSPQ-KATIE 271



 Score = 60.0 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/181 (7%), Positives = 29/181 (16%), Gaps = 11/181 (6%)

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
                 +                          +                    GI    
Sbjct: 10  QGSQGQRPSPPPKPQRSGTSANQPGGDPLTTQPSGSPHPPPTQPHGSPPPTRPRGIPQPT 69

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
                    +                +          D  S      +   +     G  
Sbjct: 70  QTLASLRPIQTLGSLRPTQAPGSPRPTQSHGSPRPTQDPGSPRPTQSRGSSQPTQSPGSP 129

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISL 389
           R   ++G  Q +   G    +    +S+G           +     S    L+  + +  
Sbjct: 130 RPTQSRGSSQPTQAPGSPRPT----QSRGSPPP------TLP-RGISQVTQLRGISPLPH 178

Query: 390 S 390
            
Sbjct: 179 P 179



 Score = 45.0 bits (104), Expect = 0.028,   Method: Composition-based stats.
 Identities = 20/197 (10%), Positives = 42/197 (21%), Gaps = 29/197 (14%)

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
            G    + +     +   T      G  +   PS  P                 G    T
Sbjct: 10  QGSQGQRPSPPPKPQRSGTSANQPGGDPLTTQPSGSPHPPPTQPHGSPPPTRPRGIPQPT 69

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             L      +    +G  R     G  + +   G    +   +     +    +G     
Sbjct: 70  QTLASLRPIQT---LGSLRPTQAPGSPRPTQSHGSPRPT---QDPGSPRPTQSRGSSQ-- 121

Query: 372 DNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSN 431
                               +         P +S+ +    +     +   S      + 
Sbjct: 122 --------------PTQSPGS-------PRPTQSRGSSQPTQAPGSPRPTQSRGSPPPTL 160

Query: 432 IFVISKNSYLISLKGSE 448
              IS+ + L  +    
Sbjct: 161 PRGISQVTQLRGISPLP 177


>gi|261325998|emb|CBH08824.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 1425

 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/376 (5%), Positives = 69/376 (18%), Gaps = 7/376 (1%)

Query: 5   ILVIQRAVDNLPENTPERRSHIYEHARNSVA-RRLESMKPRLPKEILERQFNKLEQAILQ 63
           +    +A    P   PE                + E++KP    E  + +  K       
Sbjct: 336 VPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEP 395

Query: 64  VEKQNQKSLH-TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
            + +  K +        E+  P +     +   ++P      +   + K   +      +
Sbjct: 396 AKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAE 455

Query: 123 GKSRTNTNLS-----PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                           K  +                  +    V  +   +         
Sbjct: 456 TVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKP 515

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                P  +                +   +              +     A  V      
Sbjct: 516 VAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVP 575

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
                         +    +     +   P     +             +        + 
Sbjct: 576 EPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAEAVKPVAVPEPAK 635

Query: 298 IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
                 +   E +     K             +        ++  +    +    + ++ 
Sbjct: 636 AEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAEAVKPVAVPEPAKAETV 695

Query: 358 GLKGLVIKGDIPMIDN 373
               +       +++ 
Sbjct: 696 KPVAVPEPAKAEIVEK 711



 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/371 (7%), Positives = 77/371 (20%), Gaps = 3/371 (0%)

Query: 5   ILVIQRAVDNLPENTPERRSHIYEHARNSVA-RRLESMKPRLPKEILERQFNKLEQAILQ 63
           +    +A    P   PE                + E++KP    E  + +  K       
Sbjct: 308 VPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEP 367

Query: 64  VEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQG 123
            + +  K +   +  K   +   +V           +                   +   
Sbjct: 368 AKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAE 427

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
             +      P          +      +     +V   A  E  K              P
Sbjct: 428 AVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKP 487

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                 +             +    +    + +      +        + +      ++ 
Sbjct: 488 VAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVP 547

Query: 244 HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
              + E++    V +      ++P          +E     +    A       +A    
Sbjct: 548 EPAKAETVKPVAVPEPAKAETVKPVAV--PEPAKAETVKPVAVPEPAKAETVKPVAVPEP 605

Query: 304 IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
              +      + +    E    +        +     ++       +++           
Sbjct: 606 AKAEAVKPVAVPEPAKAEAVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAE 665

Query: 364 IKGDIPMIDNA 374
               + + + A
Sbjct: 666 AVKPVAVPEPA 676



 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/367 (7%), Positives = 76/367 (20%), Gaps = 3/367 (0%)

Query: 9   QRAVDNLPENTPERRSHIYEHARNSVA-RRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            +A    P   PE                + E++KP    E  + +  K        + +
Sbjct: 256 AKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVSVPEPAKAE 315

Query: 68  NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             K +   +  K   +   +V           +                   +     + 
Sbjct: 316 TVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKP 375

Query: 128 NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                P          +      +     +V   A  E  K              P    
Sbjct: 376 VAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVP 435

Query: 188 FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
             +             +    +    + +      +        + +      ++    +
Sbjct: 436 EPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAK 495

Query: 248 RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
            E++    V +      ++P          +E     +    A       +A       +
Sbjct: 496 AETVKPVAVPEPAKAETVKPVAV--PEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAE 553

Query: 308 ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
                 + +    E    +        +     ++       +++               
Sbjct: 554 TVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAEAVKP 613

Query: 368 IPMIDNA 374
           + + + A
Sbjct: 614 VAVPEPA 620



 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/360 (8%), Positives = 73/360 (20%), Gaps = 4/360 (1%)

Query: 5   ILVIQRAVDNLPENTPERRSHIYEHARNSVA-RRLESMKPRLPKEILERQFNKLEQAILQ 63
           +    +A    P   PE          +     + E++KP    E  + +  K       
Sbjct: 280 VPEPAKAETVKPVAVPEPAKAETVKPVSVPEPAKAETVKPVAVPEPAKAETVKPVAVPEP 339

Query: 64  VEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQG 123
            + +  K +   +  K   +   +V           +                   +   
Sbjct: 340 AKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAE 399

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
             +      P          +      +     +V   A  E  K              P
Sbjct: 400 AVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAETVKP 459

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                 +             +    +    + +      +        + +      ++ 
Sbjct: 460 VAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVP 519

Query: 244 HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
              + E++    V +      ++P     + E      V P  +P    A T        
Sbjct: 520 EPAKAETVKPVAVPEPAKAETVKPVA---VPEPAKAETVKPVAVPEPAKAETVKPVAVPE 576

Query: 304 IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
               E    V   +  +                  +   +         +  +       
Sbjct: 577 PAKAETVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAEAVKPVAVPEPAKA 636



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/371 (7%), Positives = 77/371 (20%), Gaps = 3/371 (0%)

Query: 5   ILVIQRAVDNLPENTPERRSHIYEHARNSVA-RRLESMKPRLPKEILERQFNKLEQAILQ 63
           +    +A    P   PE                + E++KP    E  + +  K       
Sbjct: 266 VPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVSVPEPAKAETVKPVAVPEP 325

Query: 64  VEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQG 123
            + +  K +   +  K   +   +V           +                   +   
Sbjct: 326 AKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAE 385

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
             +      P          +      +     +V   A  E  K              P
Sbjct: 386 TVKPVAVPEPAKAEAVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAETVKP 445

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                 +             +    +    + +      +        + +      ++ 
Sbjct: 446 VAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVP 505

Query: 244 HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
              + E++    V +      ++P          +E     +    A       +A    
Sbjct: 506 EPAKAETVKPVAVPEPAKAETVKPVAV--PEPAKAETVKPVAVPEPAKAETVKPVAVPEP 563

Query: 304 IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
              +      + +    E    +        +     ++       +++           
Sbjct: 564 AKAETVKPVAVPEPAKAETVKPVAVPEPAKAETVKPVAVPEPAKAEAVKPVAVPEPAKAE 623

Query: 364 IKGDIPMIDNA 374
               + + + A
Sbjct: 624 AVKPVAVPEPA 634


>gi|332206496|ref|XP_003252329.1| PREDICTED: protein piccolo [Nomascus leucogenys]
          Length = 5141

 Score = 81.2 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/316 (6%), Positives = 54/316 (17%), Gaps = 5/316 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 PEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSLEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGTAKPPPQQPGSAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K   +           PS    +   +T  ++        +  
Sbjct: 501 PQQPGSAKPPPQQPGSAKPPPQQPGSAKLSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPP 560

Query: 311 TFVLGKKEIEEGNPLI 326
           T     K+        
Sbjct: 561 TMSPSAKQPPSQGLPK 576



 Score = 75.0 bits (182), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/323 (5%), Positives = 62/323 (19%), Gaps = 5/323 (1%)

Query: 21  ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKE 80
           +  +   +     +  + ++ +P+  +  + R     E     ++  ++  +      K 
Sbjct: 259 QGPAQTPQTDHAKLPLQRDASRPQTKQADIVR----GESVKPSLQSPSKPPIQQPTPGKP 314

Query: 81  SDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL 140
                    S+      P   S  +   + +   +   +   G ++              
Sbjct: 315 PAQQPGPEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQ 374

Query: 141 REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH-NYFFNKT 199
           +         Q    +   P    +    +    K           +             
Sbjct: 375 QTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAP 434

Query: 200 RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
               +         +               G +    +  G+     ++         + 
Sbjct: 435 GPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGTAKPPPQQPGSAKPPPQQP 494

Query: 260 NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEI 319
                   +               P          ++           +++  V      
Sbjct: 495 GSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKLSAQQPSPAKPSAQQSTKPVSQTGSG 554

Query: 320 EEGNPLIGEGRVFINKGRGQSSI 342
           +   P            +G    
Sbjct: 555 KPLQPPTMSPSAKQPPSQGLPKT 577



 Score = 55.0 bits (130), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/300 (5%), Positives = 41/300 (13%), Gaps = 7/300 (2%)

Query: 79  KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
                 + +   ++ +  E       +   S +                     P     
Sbjct: 181 DSEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPIPKQQGPGRDPLQQDGPPKSIS 240

Query: 139 RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +     S                         +   +   +     +           
Sbjct: 241 SQQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQS 300

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES--LDGGNV 256
                       +    +                 S      +      +      G   
Sbjct: 301 PSKPPIQQPTPGKPPAQQPGPEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTK 360

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGK 316
                    +P   +   E  S    GP  +        +                    
Sbjct: 361 PPAQPLGPAKPPAQQTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP 420

Query: 317 KEIEEG-----NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
              + G                  G G+          +  Q+         + G     
Sbjct: 421 LAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGTAKPP 480



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/323 (7%), Positives = 60/323 (18%), Gaps = 10/323 (3%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
            D+L +  P +   +      ++    +  +P++ K   +   +        +     +  
Sbjct: 717  DSLSKPAPAKEPSVPSEQDKALIADNKPKQPKMVKPTTDLVSSSSATTKPDIPSSKVQLQ 776

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
               K         +  +       E      S  +                         
Sbjct: 777  AEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISHPGPSSESKGQKQV 836

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                     +     +               +          +     + PT        
Sbjct: 837  DPVQKKEEPKKAQTKM-------GPKPDAKPMPKGSPAPPGPRPTAGQTVPTPQQSPKPQ 889

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                  +  L S   A               L G    +         +           
Sbjct: 890  EQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPHSQSG 949

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
             G   K+        +         S     P+   +      +       +        
Sbjct: 950  PGAPMKQAPAPS---QPPTSQGPPKSTGQAPPAPAKIIPVKKETKAPAAEKLEPKAEQAP 1006

Query: 313  VLGKKEIEEGNPLIGEGRVFINK 335
             + + E E+  P I + +    +
Sbjct: 1007 TVKRTETEKKPPPIKDSKSLTAE 1029



 Score = 50.8 bits (119), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/376 (6%), Positives = 73/376 (19%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 633  KRALGGDLAPVPSSPQPKPKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 691

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L     +    + S +    A I   + K    
Sbjct: 692  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPAKEPSVPSEQD--KALIADNKPKQPKM 749

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 750  VKPTTDLVSSSSATTKPDIPSSKVQLQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 809

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +                 
Sbjct: 810  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMGPKPDAKPMPKGSPAPP 869

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 870  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 929

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +      +   
Sbjct: 930  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKIIPVKKE 989

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 990  TKAPAAEKLEPKAEQA 1005



 Score = 45.8 bits (106), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/374 (6%), Positives = 79/374 (21%), Gaps = 17/374 (4%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P   P ++    +        +  +  P   K  +++       A     +Q      ++
Sbjct: 407 PAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPA-----QQAGPGKTSA 461

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
           +Q   +  P     + +    +P           +         S +   +   +  P  
Sbjct: 462 QQTGPTKPPSQLPGTAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPPQQPGSAKPPP 521

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                 ++ +   +         +   +       L+   ++     P            
Sbjct: 522 QQPGSAKLSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTMSPSAKQPPSQGLPKTICPL 581

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKS------------KGSIT 243
            N T  LL      + +   +    +  L G       S  K              G + 
Sbjct: 582 CNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLSEVKEWLCLNCQMKRALGGDLA 641

Query: 244 HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                              +  +     +      +           +      +  +  
Sbjct: 642 PVPSSPQPKPKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPPLVKQPT 701

Query: 304 IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           + G  ++      +      P   +     ++        +      + +  +  +    
Sbjct: 702 LHGSPSAKAKQPPEADSLSKPAPAKEPSVPSEQDKALIADNKPKQPKMVKPTTDLVSSSS 761

Query: 364 IKGDIPMIDNAFSA 377
                 +  +    
Sbjct: 762 ATTKPDIPSSKVQL 775



 Score = 45.8 bits (106), Expect = 0.017,   Method: Composition-based stats.
 Identities = 24/330 (7%), Positives = 56/330 (16%), Gaps = 7/330 (2%)

Query: 101 RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
              S    + K K +              +          ++        Q     S+S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPIPKQQGPGRDPLQQDGPPKSISS 241

Query: 161 VAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
               +        GK     +    +    +                   E         
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQSP 301

Query: 221 LIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGS 278
               +             +          +          K +                +
Sbjct: 302 SKPPIQQPTPGKPPAQ--QPGPEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTT 359

Query: 279 EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
           +    P          T +        G +      G  +     P   +          
Sbjct: 360 KPPAQPLGPAKPPAQQTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPK 419

Query: 339 QSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIM 398
             +   G  L S  +        +   G   +         T       +   + +    
Sbjct: 420 PLAQQPG--LQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGTA 477

Query: 399 FSFPKESQDAVVDLRRI-SMRKTDNSPSVL 427
              P++   A    ++  S +     P   
Sbjct: 478 KPPPQQPGSAKPPPQQPGSAKPPPQQPGSA 507



 Score = 44.6 bits (103), Expect = 0.038,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 71/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L         +E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDFKEEHKSSMMPGFLSEVNPLSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G+    S                  
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGPPKSISSQQPEKIKSQPPGTGKPIQGPAQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLQSPSKPPIQQPTPGKPPAQQPGPEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369



 Score = 40.0 bits (91), Expect = 0.90,   Method: Composition-based stats.
 Identities = 20/266 (7%), Positives = 61/266 (22%), Gaps = 3/266 (1%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +    L  ++ +                 +++        +        ++  Q +    
Sbjct: 780  KTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISHPGPSSESKGQKQVDPV 839

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSI---SSILRSNKHKKLANILSVQGKSR 126
            +     K+ +    PK            P         ++    +  K          + 
Sbjct: 840  QKKEEPKKAQTKMGPKPDAKPMPKGSPAPPGPRPTAGQTVPTPQQSPKPQEQSRRFSLNL 899

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
             +   +PK+     +E ++  +        S +        +         G       +
Sbjct: 900  GSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPHSQSGPGAPMKQAPA 959

Query: 187  IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
                  +    K+ G      A       +        L      + ++ +++       
Sbjct: 960  PSQPPTSQGPPKSTGQAPPAPAKIIPVKKETKAPAAEKLEPKAEQAPTVKRTETEKKPPP 1019

Query: 247  RRESLDGGNVDKKNVFSGIRPKITRR 272
             ++S       +K V      K  + 
Sbjct: 1020 IKDSKSLTAEPQKAVLPTKLEKSPKP 1045


>gi|71666455|ref|XP_820186.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70885521|gb|EAN98335.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 1133

 Score = 80.8 bits (197), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/314 (6%), Positives = 53/314 (16%), Gaps = 4/314 (1%)

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
            EQA L           ++  + +S  PK +              +          +    
Sbjct: 736  EQATLNTSSVPSGGAPSTPAEPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPA 795

Query: 118  ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                          +    +         +     E   + S  A  +  + +    K A
Sbjct: 796  EPKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPA 855

Query: 178  GIFSFPTGSIFWSVHNYFFNKT-RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIG 236
               S                +          + S                          
Sbjct: 856  EPKSAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPA 915

Query: 237  KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
            + K +       +S +    +  +         +        +        P +     +
Sbjct: 916  EPKSAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA 975

Query: 297  NIAFKNYIGGDENSTFVLGKKE---IEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                      +  S      +      +                 +          S  +
Sbjct: 976  EPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPNAATSSAR 1035

Query: 354  EKSQGLKGLVIKGD 367
            E +          D
Sbjct: 1036 EGTADQPASATFSD 1049


>gi|306921613|dbj|BAJ17886.1| piccolo [synthetic construct]
          Length = 5143

 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 57.7 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 53.5 bits (126), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 71/326 (21%), Gaps = 5/326 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P               +  + + ++       +   +Q   ++     V   +  
Sbjct: 718  AKAKQPPEADSLSKPAPPKEPSVPSEQDKA----PVADDKPKQPKMVKPTTDLVSSSSAT 773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K     +   T           +S               I      S+  ++
Sbjct: 774  TKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRPASDSKIISH 833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P + S   +++       + +   +            +          +         
Sbjct: 834  PGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQ 893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++R       ++++    +       + G   G   SI     ++     +  
Sbjct: 894  QSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPG 953

Query: 251  LDGGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                +     +  +    +         S     P+          +       +     
Sbjct: 954  PHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAE 1013

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINK 335
                + + E E+  P I + +    +
Sbjct: 1014 QAPTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 50.8 bits (119), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/376 (6%), Positives = 72/376 (19%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 46.5 bits (108), Expect = 0.010,   Method: Composition-based stats.
 Identities = 34/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            S
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVS 814



 Score = 41.9 bits (96), Expect = 0.28,   Method: Composition-based stats.
 Identities = 14/223 (6%), Positives = 32/223 (14%), Gaps = 6/223 (2%)

Query: 157 SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
             S  +           G    I                        +  + +      K
Sbjct: 236 PKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVK 295

Query: 217 YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLL 274
             +       +           +          +          K +             
Sbjct: 296 PSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQP 355

Query: 275 EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGR 330
              ++    P          T +    +   G +      G  +     P       +  
Sbjct: 356 PGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQV 415

Query: 331 VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
                   Q  + S        +   Q      I         
Sbjct: 416 GTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 37.7 bits (85), Expect = 4.4,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|150378539|ref|NP_149015.2| protein piccolo isoform 1 [Homo sapiens]
          Length = 5142

 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 68.5 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 57.7 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 53.5 bits (126), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 71/326 (21%), Gaps = 5/326 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P               +  + + ++       +   +Q   ++     V   +  
Sbjct: 718  AKAKQPPEADSLSKPAPPKEPSVPSEQDKA----PVADDKPKQPKMVKPTTDLVSSSSAT 773

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K     +   T           +S               I      S+  ++
Sbjct: 774  TKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRPASDSKIISH 833

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P + S   +++       + +   +            +          +         
Sbjct: 834  PGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQ 893

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++R       ++++    +       + G   G   SI     ++     +  
Sbjct: 894  QSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPG 953

Query: 251  LDGGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                +     +  +    +         S     P+          +       +     
Sbjct: 954  PHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAE 1013

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINK 335
                + + E E+  P I + +    +
Sbjct: 1014 QAPTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 50.8 bits (119), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/376 (6%), Positives = 72/376 (19%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRL-LEDGSEVDVGPSTIPVADFANTSN---------- 297
                             +P+   R    +   +   P + P       +           
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 46.5 bits (108), Expect = 0.011,   Method: Composition-based stats.
 Identities = 34/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            S
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVS 814



 Score = 41.9 bits (96), Expect = 0.28,   Method: Composition-based stats.
 Identities = 14/223 (6%), Positives = 32/223 (14%), Gaps = 6/223 (2%)

Query: 157 SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
             S  +           G    I                        +  + +      K
Sbjct: 236 PKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVK 295

Query: 217 YFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLL 274
             +       +           +          +          K +             
Sbjct: 296 PSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQP 355

Query: 275 EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGR 330
              ++    P          T +    +   G +      G  +     P       +  
Sbjct: 356 PGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQV 415

Query: 331 VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
                   Q  + S        +   Q      I         
Sbjct: 416 GTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 37.7 bits (85), Expect = 4.4,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|149599532|ref|XP_001510669.1| PREDICTED: similar to zonadhesin, partial [Ornithorhynchus anatinus]
          Length = 1553

 Score = 80.4 bits (196), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/294 (7%), Positives = 38/294 (12%), Gaps = 1/294 (0%)

Query: 39   ESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEP 98
                P  P            +     +  ++    T           S+          P
Sbjct: 728  RPTGPTDPTADPPGTSTPTAKPPGPTDPTSKPPGPTDPTRPTGPTDPSTKPPGPTDPTRP 787

Query: 99   RLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSV 158
               +              +  +        T  +  +         +           S 
Sbjct: 788  TGPTDP-STEPPSPTDPTSRPTGPTDPTRPTGPTDPSTKPPGPTDPTRPTGPTDPSTESP 846

Query: 159  SPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYF 218
            SP                 G     T     +        T    S     +E       
Sbjct: 847  SPTDPTSRPTGPTDPTGPTGPTDPSTKPTGPTDPTANPPGTSPPTSKPPGPTEPTPRPPG 906

Query: 219  VFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGS 278
                                    T                   +               
Sbjct: 907  PTDPTSRPTGPTDPTGPTGPTDPSTEPTGPTDPTDNPPCTSTPTAKPPGPTDPSTEPPTP 966

Query: 279  EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVF 332
                   T      A+T+            +              P   E R  
Sbjct: 967  TDPTPDVTTSQTPTASTTPSPITGSTPAPGSCPPNSHYDLCVSSCPPTCEDRSP 1020


>gi|332801050|ref|NP_001193917.1| hypothetical protein LOC100140317 [Bos taurus]
          Length = 1614

 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/383 (5%), Positives = 68/383 (17%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            Q A       TPE  + +             +     P+E                    
Sbjct: 1087 QSATPAGAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSVTPADV 1146

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
              +         +        +       P   +  +       +  A   +V    ++ 
Sbjct: 1147 VPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSA 1206

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            T             +       +     + +     E               +       
Sbjct: 1207 TPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSAAPACAVST 1266

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                              +        +        +      +   G            
Sbjct: 1267 PEEPAASTGAVPTPEEPTAPACAMPTPEQSATPAGAVSTPEEPAAPAGAVPTPEQSATPA 1326

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             S+           +   P+            +   +          S     +    +E
Sbjct: 1327 GSVSTPEEPAALAGTVSTPEEPAASTGAVPTPEEPVAPAGAVPTPEQSATPAGSVSTPEE 1386

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
             +         E+     G             ++ + +   +     S   +     G +
Sbjct: 1387 PAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAV 1446

Query: 369  PMIDNAFSASMTLKCNADISLSI 391
            P  + + + + ++    + +   
Sbjct: 1447 PTPEQSATPAGSVSTPEEPAAPA 1469



 Score = 79.3 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/363 (6%), Positives = 60/363 (16%), Gaps = 7/363 (1%)

Query: 18   NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
             TP       E             +P  P   +      +  A +    +   +   +  
Sbjct: 985  VTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVP 1044

Query: 78   DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
              E     +           P     +    +     +         +            
Sbjct: 1045 TPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPAGAVPTPEEPAVL 1104

Query: 138  CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFN 197
                              +   P A      +  +    A +   P      +       
Sbjct: 1105 AGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPE 1164

Query: 198  KTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL------ 251
            +            +       V          G   +  +S          E        
Sbjct: 1165 EPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPADAVPTPEEPAVLAGA 1224

Query: 252  -DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                        +   P+            +   +             +       +E +
Sbjct: 1225 VPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPT 1284

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                     E+     G             ++ + +   +     S   +   + G +  
Sbjct: 1285 APACAMPTPEQSATPAGAVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAALAGTVST 1344

Query: 371  IDN 373
             + 
Sbjct: 1345 PEE 1347



 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/381 (4%), Positives = 62/381 (16%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A       TPE  +               +     P+E                      
Sbjct: 1037 AAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPAGAVP 1096

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +         +        +       P   +  +       + +     V         
Sbjct: 1097 TPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSVTPADVVPTPEEPAAP 1156

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                                +     + +     E               +         
Sbjct: 1157 AGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPADAVPTPE 1216

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                            +        +        +      +                 +
Sbjct: 1217 EPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSAAPACAVSTPEEPAASTGA 1276

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
            +           +   P+ +       S  +   +          S     +    +E +
Sbjct: 1277 VPTPEEPTAPACAMPTPEQSATPAGAVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPA 1336

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                     EE     G             ++ + +   +     S   +     G +P 
Sbjct: 1337 ALAGTVSTPEEPAASTGAVPTPEEPVAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPT 1396

Query: 371  IDNAFSASMTLKCNADISLSI 391
             + + + + ++    + +   
Sbjct: 1397 PEQSATPAGSVSTPEEPAAPA 1417



 Score = 77.0 bits (187), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/381 (4%), Positives = 64/381 (16%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A       TPE+     +           +     P+E                      
Sbjct: 1011 AAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVP 1070

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +         +        +       P   ++ +       +  A   +V         
Sbjct: 1071 TPEEPAAPAGAVPTPDQSATPAGAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAP 1130

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                    +           +     + +     E               +         
Sbjct: 1131 AGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPE 1190

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                            +        +    L   +      +                 +
Sbjct: 1191 EPAAPAGAVPTPDQSATPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGA 1250

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
            +           +   P+            +   +          S          +E +
Sbjct: 1251 VPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPTAPACAMPTPEQSATPAGAVSTPEEPA 1310

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                     E+     G             ++ + +   +         + +   G +P 
Sbjct: 1311 APAGAVPTPEQSATPAGSVSTPEEPAALAGTVSTPEEPAASTGAVPTPEEPVAPAGAVPT 1370

Query: 371  IDNAFSASMTLKCNADISLSI 391
             + + + + ++    + +   
Sbjct: 1371 PEQSATPAGSVSTPEEPAAPA 1391



 Score = 76.6 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/363 (4%), Positives = 58/363 (15%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A       TPE+ + +             +     P++ +                    
Sbjct: 946  AAPAGAVPTPEQSATLTGAVPTPQEPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVP 1005

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +         +        +  ++   P   +  +       +  A   +V    ++ T 
Sbjct: 1006 TPEEPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATP 1065

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                                      + +     E               +         
Sbjct: 1066 ADAVPTPEEPAAPAGAVPTPDQSATPAGAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPE 1125

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                            +        +        +      +   G            ++
Sbjct: 1126 EPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADA 1185

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
            +           +   P  +    +     +                         +E +
Sbjct: 1186 VPTPEEPAAPAGAVPTPDQSATPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPA 1245

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                     E+                   ++ + +   +         +     G +  
Sbjct: 1246 APAGAVPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPTAPACAMPTPEQSATPAGAVST 1305

Query: 371  IDN 373
             + 
Sbjct: 1306 PEE 1308



 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/383 (5%), Positives = 66/383 (17%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            Q A       TPE  +               +     P+E                    
Sbjct: 1061 QSATPADAVPTPEEPAAPAGAVPTPDQSATPAGAVPTPEEPAVLAGAVPTPEEPAAPACA 1120

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
              +         +        +  ++   P   +  +       +  A   +V    ++ 
Sbjct: 1121 VPTPEEPAAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSA 1180

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            T                           + +     E               +       
Sbjct: 1181 TPADAVPTPEEPAAPAGAVPTPDQSATPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPT 1240

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                              +        +        +      +                
Sbjct: 1241 PEEPAAPAGAVPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPTAPACAMPTPEQSATPA 1300

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             ++           +   P+ +       S  +   +             +       +E
Sbjct: 1301 GAVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAALAGTVSTPEEPAASTGAVPTPEE 1360

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
                       E+     G             ++ + +   +     S   +     G +
Sbjct: 1361 PVAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAV 1420

Query: 369  PMIDNAFSASMTLKCNADISLSI 391
            P  + + + + ++    + +   
Sbjct: 1421 PTPEQSATPAGSVSTPEEPAAPA 1443



 Score = 74.3 bits (180), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/361 (6%), Positives = 60/361 (16%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A       TPE+     +           +     P+E                      
Sbjct: 1128 AAPAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVP 1187

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +         +        +  +    P   ++ +       +  A   +V         
Sbjct: 1188 TPEEPAAPAGAVPTPDQSATPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAP 1247

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                    +           +    S+ +     E               +         
Sbjct: 1248 AGAVPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPTAPACAMPTPEQSATPAGAVSTPE 1307

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                            +        +    L   +      + S G             +
Sbjct: 1308 EPAAPAGAVPTPEQSATPAGSVSTPEEPAALAGTVSTPEEPAASTGAVPTPEEPVAPAGA 1367

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
            +           S   P+            +   +                     ++++
Sbjct: 1368 VPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSA 1427

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
            T        EE     G             S+ + +   +         +     G +P 
Sbjct: 1428 TPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGAVPT 1487

Query: 371  I 371
             
Sbjct: 1488 P 1488



 Score = 71.2 bits (172), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/358 (5%), Positives = 57/358 (15%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A+  +    PE    +   A         S+                  A         +
Sbjct: 854  AIAAVMVPFPEEHVPVVSVAAVEAHVPAASVFTLEKDGPAAAVSATERAAAPAAAVPAPE 913

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
                +     ++             +       +        ++ A +       +    
Sbjct: 914  GTAPAAAVPTTEDDTPEEPVTPTGAVSTPEEPAAPAGAVPTPEQSATLTGAVPTPQEPAA 973

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +    +       +  V T  E  +    V   E   +             P   +   
Sbjct: 974  PAGAVPTPEQSVTPADVVPTPEEPAAPAGAVPTPEEPAAPAGAVPTPEQSVTPADVVPTP 1033

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                            +A +                       +   +  +         
Sbjct: 1034 EEPAAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPAG 1093

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  +   +   +                  P+    A      ++   + +   E  
Sbjct: 1094 AVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSVTPADVVPTPEEP 1153

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
                G     E             +    +  +      +                D 
Sbjct: 1154 AAPAGAVPTPEEPAAPAGAVPTPEQSATPADAVPTPEEPAAPAGAVPTPDQSATPADA 1211



 Score = 67.3 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/330 (6%), Positives = 54/330 (16%), Gaps = 1/330 (0%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            Q A       TPE  +     A  +  +           E        +           
Sbjct: 1178 QSATPADAVPTPEEPAA-PAGAVPTPDQSATPADAVPTPEEPAVLAGAVPTPEEPAAPAC 1236

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
                          +P    ++     +       +S       ++             +
Sbjct: 1237 AVPTPEEPAAPAGAVPTPEQSAAPACAVSTPEEPAASTGAVPTPEEPTAPACAMPTPEQS 1296

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    +       + +V T  +  +    V+  E   +           +  TG++ 
Sbjct: 1297 ATPAGAVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAALAGTVSTPEEPAASTGAVP 1356

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                              +  +                     S +   S  +       
Sbjct: 1357 TPEEPVAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAP 1416

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                            +                   +T   +        A    +   E
Sbjct: 1417 AGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPE 1476

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
             S    G                   +   
Sbjct: 1477 QSATPAGAVPTPAELAAAAAVLSAPEESDT 1506



 Score = 62.3 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/351 (6%), Positives = 56/351 (15%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            Q A       TPE  + +             +     P+E                    
Sbjct: 1204 QSATPADAVPTPEEPAVLAGAVPTPEEPAAPACAVPTPEEPAAPAGAVPTPEQSAAPACA 1263

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
              +         +       T+       P   +  +   S   +  A   +V    ++ 
Sbjct: 1264 VSTPEEPAASTGAVPTPEEPTAPACAMPTPEQSATPAGAVSTPEEPAAPAGAVPTPEQSA 1323

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            T     +       +       +    S+ +     E               +       
Sbjct: 1324 TPAGSVSTPEEPAALAGTVSTPEEPAASTGAVPTPEEPVAPAGAVPTPEQSATPAGSVST 1383

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                              +        +        +      +   G            
Sbjct: 1384 PEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPA 1443

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             ++           S   P+            +   +             A       +E
Sbjct: 1444 GAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGAVPTPAELAAAAAVLSAPEE 1503

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
            + T  +     EE                  +  L                
Sbjct: 1504 SDTPTVKVFTPEEPPAAAAAVPAVEEVFPVGAPFLGDTSRADSVPVSEGTP 1554



 Score = 37.7 bits (85), Expect = 5.2,   Method: Composition-based stats.
 Identities = 16/275 (5%), Positives = 40/275 (14%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            Q A      +TPE  +               +     P+E                    
Sbjct: 1295 QSATPAGAVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAALAGTVSTPEEPAASTGA 1354

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
              +         +        +       P   +  +       +      SV       
Sbjct: 1355 VPTPEEPVAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPA 1414

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                      +           +     + +     +               +       
Sbjct: 1415 APAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPTPEQSATPAGSVSTPEEPAAPAGAVPT 1474

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                              +A +     +      + +        +          F   
Sbjct: 1475 PEQSATPAGAVPTPAELAAAAAVLSAPEESDTPTVKVFTPEEPPAAAAAVPAVEEVFPVG 1534

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                G      +V       I       G  +   
Sbjct: 1535 APFLGDTSRADSVPVSEGTPILEEASLAGMPIQEE 1569


>gi|248812|gb|AAB22073.1| type 1 immunoglobulin A1 protease, IgA1 protease [Haemophilus
            influenzae, strain HK61, Peptide, 1849 aa]
          Length = 1849

 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/359 (6%), Positives = 74/359 (20%), Gaps = 11/359 (3%)

Query: 19   TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
            T E +S   E        + E    +  ++ +  +     +   +VE +  +        
Sbjct: 1159 TAETKSEPTESV-TVSENQPEKTVSQSTEDKVVVEK----EEKAKVETEETQKAPQVTSK 1213

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
            +     + +             +++     +          + +    T       N   
Sbjct: 1214 EPPKQAEPAPEEVPTDTNAEEAQALQQTQPTTVAAAETTSPNSKPAEETQQPSEKTNAEP 1273

Query: 139  RLREILSF--SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                +     +  T+ E  + V      E  +   +        +    +          
Sbjct: 1274 VTPVVSENTATQPTETEETAKVEKEKTQEVPQVASQESPKQEQPAAKPQAQTKPQAEPAR 1333

Query: 197  NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
                   +      +         +      A     +      +               
Sbjct: 1334 ENVLTTKNVGEPQPQAQPQTQSTAVPTTGETAANSKPAAKPQAQAKPQTEPARENVSTVN 1393

Query: 257  DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPV-ADFANTSNIAFKNYIGGDENSTFVLG 315
             K+          T +  ++ S     P+        + T+           +  T    
Sbjct: 1394 TKEPQSQTSATVSTEQPAKETSSNVEQPAPENSINTGSATTMTETAEKSDKPQMETVTEN 1453

Query: 316  KKEIEEGNPL---IGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             ++ E        +            +   +S     S ++      +   +   +   
Sbjct: 1454 DRQPEANTVADNSVANNSESSESKSRRRRSVSQPKETSAEETTVASTQETTVDNSVSTP 1512



 Score = 72.3 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/305 (7%), Positives = 63/305 (20%), Gaps = 7/305 (2%)

Query: 59   QAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
            + I +VE         ++    S+ P++         +E    + S+             
Sbjct: 1028 EEIARVETPVPPPAPATESAIASEQPETRPAETAQPAMEETNTANSTETAPKSDTATQTE 1087

Query: 119  LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAG 178
                    + T         +  E ++ +     E       VA  +             
Sbjct: 1088 NPNSESVPSETTEKVAENPPQENETVAKNEQEATEPTPQNGEVAKEDQPTVEANTQTNEA 1147

Query: 179  IFS-------FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
              S           +      +   ++ +   +   +  +  + +      +        
Sbjct: 1148 TQSEGKTEETQTAETKSEPTESVTVSENQPEKTVSQSTEDKVVVEKEEKAKVETEETQKA 1207

Query: 232  SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD 291
                 K           E     N ++       +P                  T   ++
Sbjct: 1208 PQVTSKEPPKQAEPAPEEVPTDTNAEEAQALQQTQPTTVAAAETTSPNSKPAEETQQPSE 1267

Query: 292  FANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL 351
              N   +            T      ++E+               + +      +     
Sbjct: 1268 KTNAEPVTPVVSENTATQPTETEETAKVEKEKTQEVPQVASQESPKQEQPAAKPQAQTKP 1327

Query: 352  QQEKS 356
            Q E +
Sbjct: 1328 QAEPA 1332



 Score = 38.1 bits (86), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/232 (8%), Positives = 50/232 (21%), Gaps = 9/232 (3%)

Query: 15   LPENTPERR-SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ---K 70
             P   P+ +     E AR +V          + +   + Q      A+    +       
Sbjct: 1316 QPAAKPQAQTKPQAEPARENVLT-----TKNVGEPQPQAQPQTQSTAVPTTGETAANSKP 1370

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +     Q K    P     S  N        S +        +  +N+     ++  NT 
Sbjct: 1371 AAKPQAQAKPQTEPARENVSTVNTKEPQSQTSATVSTEQPAKETSSNVEQPAPENSINTG 1430

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +        +                 +   A     +     +              +
Sbjct: 1431 SATTMTETAEKSDKPQMETVTENDRQPEANTVADNSVANNSESSESKSRRRRSVSQPKET 1490

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                    +    +  +++S            +       V      ++ + 
Sbjct: 1491 SAEETTVASTQETTVDNSVSTPKPRSRRTRRSVQTNSYEPVELPTENAENAE 1542


>gi|1170517|sp|P45386|IGA4_HAEIN RecName: Full=Immunoglobulin A1 protease autotransporter; Contains:
            RecName: Full=Immunoglobulin A1 protease; Short=IGA1
            protease; Contains: RecName: Full=Immunoglobulin A1
            protease translocator; AltName: Full=Helper peptide;
            Flags: Precursor
 gi|148911|gb|AAA24968.1| IgA1 protease [Haemophilus influenzae]
          Length = 1849

 Score = 80.4 bits (196), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/359 (6%), Positives = 74/359 (20%), Gaps = 11/359 (3%)

Query: 19   TPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQD 78
            T E +S   E        + E    +  ++ +  +     +   +VE +  +        
Sbjct: 1159 TAETKSEPTESV-TVSENQPEKTVSQSTEDKVVVEK----EEKAKVETEETQKAPQVTSK 1213

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
            +     + +             +++     +          + +    T       N   
Sbjct: 1214 EPPKQAEPAPEEVPTDTNAEEAQALQQTQPTTVAAAETTSPNSKPAEETQQPSEKTNAEP 1273

Query: 139  RLREILSF--SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFF 196
                +     +  T+ E  + V      E  +   +        +    +          
Sbjct: 1274 VTPVVSENTATQPTETEETAKVEKEKTQEVPQVASQESPKQEQPAAKPQAQTKPQAEPAR 1333

Query: 197  NKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNV 256
                   +      +         +      A     +      +               
Sbjct: 1334 ENVLTTKNVGEPQPQAQPQTQSTAVPTTGETAANSKPAAKPQAQAKPQTEPARENVSTVN 1393

Query: 257  DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPV-ADFANTSNIAFKNYIGGDENSTFVLG 315
             K+          T +  ++ S     P+        + T+           +  T    
Sbjct: 1394 TKEPQSQTSATVSTEQPAKETSSNVEQPAPENSINTGSATTMTETAEKSDKPQMETVTEN 1453

Query: 316  KKEIEEGNPL---IGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             ++ E        +            +   +S     S ++      +   +   +   
Sbjct: 1454 DRQPEANTVADNSVANNSESSESKSRRRRSVSQPKETSAEETTVASTQETTVDNSVSTP 1512



 Score = 72.3 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/305 (7%), Positives = 63/305 (20%), Gaps = 7/305 (2%)

Query: 59   QAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
            + I +VE         ++    S+ P++         +E    + S+             
Sbjct: 1028 EEIARVETPVPPPAPATESAIASEQPETRPAETAQPAMEETNTANSTETAPKSDTATQTE 1087

Query: 119  LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAG 178
                    + T         +  E ++ +     E       VA  +             
Sbjct: 1088 NPNSESVPSETTEKVAENPPQENETVAKNEQEATEPTPQNGEVAKEDQPTVEANTQTNEA 1147

Query: 179  IFS-------FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGV 231
              S           +      +   ++ +   +   +  +  + +      +        
Sbjct: 1148 TQSEGKTEETQTAETKSEPTESVTVSENQPEKTVSQSTEDKVVVEKEEKAKVETEETQKA 1207

Query: 232  SYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD 291
                 K           E     N ++       +P                  T   ++
Sbjct: 1208 PQVTSKEPPKQAEPAPEEVPTDTNAEEAQALQQTQPTTVAAAETTSPNSKPAEETQQPSE 1267

Query: 292  FANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL 351
              N   +            T      ++E+               + +      +     
Sbjct: 1268 KTNAEPVTPVVSENTATQPTETEETAKVEKEKTQEVPQVASQESPKQEQPAAKPQAQTKP 1327

Query: 352  QQEKS 356
            Q E +
Sbjct: 1328 QAEPA 1332



 Score = 38.1 bits (86), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/232 (8%), Positives = 50/232 (21%), Gaps = 9/232 (3%)

Query: 15   LPENTPERR-SHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ---K 70
             P   P+ +     E AR +V          + +   + Q      A+    +       
Sbjct: 1316 QPAAKPQAQTKPQAEPARENVLT-----TKNVGEPQPQAQPQTQSTAVPTTGETAANSKP 1370

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +     Q K    P     S  N        S +        +  +N+     ++  NT 
Sbjct: 1371 AAKPQAQAKPQTEPARENVSTVNTKEPQSQTSATVSTEQPAKETSSNVEQPAPENSINTG 1430

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +        +                 +   A     +     +              +
Sbjct: 1431 SATTMTETAEKSDKPQMETVTENDRQPEANTVADNSVANNSESSESKSRRRRSVSQPKET 1490

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                    +    +  +++S            +       V      ++ + 
Sbjct: 1491 SAEETTVASTQETTVDNSVSTPKPRSRRTRRSVQTNSYEPVELPTENAENAE 1542


>gi|194757768|ref|XP_001961134.1| GF11157 [Drosophila ananassae]
 gi|190622432|gb|EDV37956.1| GF11157 [Drosophila ananassae]
          Length = 8806

 Score = 80.1 bits (195), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 42/412 (10%), Positives = 104/412 (25%), Gaps = 20/412 (4%)

Query: 12   VDNLPENTP---ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--------QA 60
            +   PE+ P   +    I    R       E    + P      +   +E         A
Sbjct: 3099 IAKKPEDKPVDVQVTETITTVTREETISEPEKPTTKEPTPEKIVEKKPVEKPAKKETTPA 3158

Query: 61   ILQVEKQNQK----SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
             +  E               Q +++  P     ++     EP+ R+              
Sbjct: 3159 PVTKETTPAPVTKEPTPEPIQKEKTPEPAPREAAQVPTKPEPQPRTAVKEEVPAFEPPFT 3218

Query: 117  NILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKL 176
              L+   + +  T ++      +     + ++ T     +++        +  +    K+
Sbjct: 3219 APLAPFEEPKAETKITEVTTEVQEPVSSTETITTITTTVTTIDQQPKEVTEVDKSEPAKI 3278

Query: 177  AGIFSFPTG---SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
              +          I     +   ++     +    + E  +      +          + 
Sbjct: 3279 TEVEVEKPAVQEPIKDDKPSEILDEVSEEPTSSIVVEERVITVEEPTITESTVTTTITTT 3338

Query: 234  SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
            +   S           +       KK+     +  +T  L+++    D            
Sbjct: 3339 TTTTSSEEQQPQETVVTEIVKEEPKKDTPQPEKTVVTEELVKEEPAKDASQPITEPTQTT 3398

Query: 294  NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
             T                  L +      +    +  V   +    +    G  +    +
Sbjct: 3399 ETVTTTTTIIQEEKPQQPGDLEQIVQPPTSTNKHQSVVDFIQAEKNTQPSEGSKVLQNVK 3458

Query: 354  EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVM-EIMFSFPKE 404
            + ++    L I G   +   A   ++T           THV+ EI+   P +
Sbjct: 3459 DAAKLGA-LAIVGAPVLAGKALVDALTSDKATKTGQPTTHVVTEIVEELPAD 3509



 Score = 63.9 bits (153), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 35/439 (7%), Positives = 96/439 (21%), Gaps = 10/439 (2%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +  +  P    +  +      R +V   + + +P     +   +  K E  I +V  + Q
Sbjct: 3182 KTPEPAPREAAQVPTKPEPQPRTAVKEEVPAFEPPFTAPLAPFEEPKAETKITEVTTEVQ 3241

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS----ILRSNKHKKLANILSVQGKS 125
            + + +++         +++  +     E      +      +     ++           
Sbjct: 3242 EPVSSTETITTITTTVTTIDQQPKEVTEVDKSEPAKITEVEVEKPAVQEPIKDDKPSEIL 3301

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
               +     +     R I            ++              +  +          
Sbjct: 3302 DEVSEEPTSSIVVEERVITVEEPTITESTVTTTITTTTTTTSSEEQQPQETVVTEIVKEE 3361

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                +        T  L+    A                +     +       +      
Sbjct: 3362 PKKDTPQPEKTVVTEELVKEEPAKDASQPITEPTQTTETVTTTTTIIQEEKPQQPGDLEQ 3421

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
            + +             F                +     + +          +A K  + 
Sbjct: 3422 IVQPPTSTNKHQSVVDFIQAEKNTQPSEGSKVLQNVKDAAKLGALAIVGAPVLAGKALVD 3481

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIK 365
               +       +        I E           + +       +      +G      +
Sbjct: 3482 ALTSDKATKTGQPTTHVVTEIVEELPADISRTTSTIVTKVTTTTTTTTTTGEGSPEDEAR 3541

Query: 366  GDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKT--DNS 423
              + +  +  SA  T+K     +L I   +      P E Q  V   ++     T     
Sbjct: 3542 DVVELPIS--SAEPTIKREVPKTLPIGDAISQKLISPDECQVIVDGEQQSQTVSTLLKEE 3599

Query: 424  PSVLIDSNIFVISKNSYLI 442
                +D     I  +  +I
Sbjct: 3600 QLSPLD--EVQIIDDKLII 3616


>gi|242033361|ref|XP_002464075.1| hypothetical protein SORBIDRAFT_01g011870 [Sorghum bicolor]
 gi|241917929|gb|EER91073.1| hypothetical protein SORBIDRAFT_01g011870 [Sorghum bicolor]
          Length = 1255

 Score = 80.1 bits (195), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/284 (8%), Positives = 61/284 (21%), Gaps = 11/284 (3%)

Query: 45  LPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS 104
                +E    ++E+ ++  E Q       S    ++  P+ ++  K      P  R   
Sbjct: 112 PTPAEVEAVRRQVERKVVVAEAQVGPR-QGSSSSSQAPAPRPAMQGKVPDQFAPVGRGSP 170

Query: 105 SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
           S    +     A  +    + +    ++P         +      T              
Sbjct: 171 SFPAQSPSSFQAPAVRPAMQGKPPGQVAPAAIPSSFPALAPVRGPTTGRPAMQQGKPPGQ 230

Query: 165 EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
               +       A            ++      +    +   S  +           + +
Sbjct: 231 VVAPAASPSSFPALAPVQGPTPGRPAMQGKPPGQVAPAVRPSSLAAPVQGPAPGRPAMQV 290

Query: 225 LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                    +   S    +  ++     G    +      + P  T   L         P
Sbjct: 291 RPPGQIAPAAASPSSLPASAPVQGPVPAGRPAMQVRSPGQVAPAATLTSL---------P 341

Query: 285 STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
           +  P          A +                   +G    G+
Sbjct: 342 APAPPVQGPVPGRPAMQVRPPAPGQVVAPA-SGPQMQGKAPAGQ 384



 Score = 73.9 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/309 (7%), Positives = 59/309 (19%), Gaps = 31/309 (10%)

Query: 84  PKSSVTSKENIFLEPRL-----------------------------RSISSILRSNKHKK 114
           P ++          P                                   + + + + + 
Sbjct: 65  PGAAQRGGHGQPPSPHPAAGPGRGGYSGVHPQQGRGQQVTAPVLPSAPTPAEVEAVRRQV 124

Query: 115 LANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
              ++  + +       S  + +   R  +   V  Q       SP    +   S     
Sbjct: 125 ERKVVVAEAQVGPRQGSSSSSQAPAPRPAMQGKVPDQFAPVGRGSPSFPAQSPSSFQAPA 184

Query: 175 KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS 234
               +   P G +  +     F     +    +        K    ++            
Sbjct: 185 VRPAMQGKPPGQVAPAAIPSSFPALAPVRGPTTGRPAMQQGKPPGQVVAPAASPSSFPAL 244

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
                 +      +    G         S   P   +        + V P        A+
Sbjct: 245 APVQGPTPGRPAMQGKPPGQVAPAVRPSSLAAP--VQGPAPGRPAMQVRPPGQIAPAAAS 302

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
            S++     + G   +     +                          + G+    ++  
Sbjct: 303 PSSLPASAPVQGPVPAGRPAMQVRSPGQVAPAATLTSLPAPAPPVQGPVPGRPAMQVRPP 362

Query: 355 KSQGLKGLV 363
               +    
Sbjct: 363 APGQVVAPA 371



 Score = 54.6 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/251 (9%), Positives = 45/251 (17%), Gaps = 19/251 (7%)

Query: 155 DSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHL 214
             +       +        G   G +S                                +
Sbjct: 65  PGAAQRGGHGQPPSPHPAAGPGRGGYSGVHPQQGRGQQVTAPVLPSAPTPAEVEAVRRQV 124

Query: 215 FKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLL 274
            +  V     +G   G S S            +              F    P   +   
Sbjct: 125 ERKVVVAEAQVGPRQGSSSSSQAPAPRPAMQGKVPDQFAPVGRGSPSFPAQSPSSFQ--A 182

Query: 275 EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFIN 334
                   G     VA  A  S+      + G       + + +                
Sbjct: 183 PAVRPAMQGKPPGQVAPAAIPSSFPALAPVRGPTTGRPAMQQGKPPGQVVAPAASPSSFP 242

Query: 335 KGRGQSSILSGKILWSLQQEKSQGLKGLVIK-----GDIPMIDNAFSASMTLKC------ 383
                     G+      Q K  G     ++       +         +M ++       
Sbjct: 243 ALAPVQGPTPGRPAM---QGKPPGQVAPAVRPSSLAAPVQGPAPG-RPAMQVRPPGQIAP 298

Query: 384 --NADISLSIT 392
              +  SL  +
Sbjct: 299 AAASPSSLPAS 309


>gi|66570962|emb|CAH10285.1| merzoite surface protein 1 [Plasmodium reichenowi]
          Length = 1739

 Score = 80.1 bits (195), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 16/206 (7%), Positives = 31/206 (15%), Gaps = 5/206 (2%)

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
                           S    S + T+           E  +          SSVS    
Sbjct: 658 EEKKTLQNVTLSGESESQANTSESPTHGRTTEIENSNPENQAVVSGGGSATPSSVSSETQ 717

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                 +  +    G    P      +        +          S             
Sbjct: 718 PAGPTGQAAQAAQEGQAVPPPQPSSATTTPPSQPSSATTTPPSQPSSATTTQPPQPSSAT 777

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
               +   S +               +               +P      L     V   
Sbjct: 778 TTPPSQPSSATTQP-----PQPSSATTTPPPQESSATTTPPSQPSSATTTLPPQPTVPQA 832

Query: 284 PSTIPVADFANTSNIAFKNYIGGDEN 309
              +        + +        D+ 
Sbjct: 833 QPEVAPPPQEKGAEVPAAPTQANDKT 858



 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 10/188 (5%), Positives = 26/188 (13%), Gaps = 4/188 (2%)

Query: 158 VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
            S   A   +     R       +    ++     +   +             +      
Sbjct: 671 ESESQANTSESPTHGRTTEIENSNPENQAVVSGGGSATPSSVSSETQPAGPTGQAAQAAQ 730

Query: 218 F----VFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRL 273
                             S     +    +      +               +P      
Sbjct: 731 EGQAVPPPQPSSATTTPPSQPSSATTTPPSQPSSATTTQPPQPSSATTTPPSQPSSATTQ 790

Query: 274 LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFI 333
               S     P     +      +             T    + E+       G      
Sbjct: 791 PPQPSSATTTPPPQESSATTTPPSQPSSATTTLPPQPTVPQAQPEVAPPPQEKGAEVPAA 850

Query: 334 NKGRGQSS 341
                  +
Sbjct: 851 PTQANDKT 858



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 15/261 (5%), Positives = 51/261 (19%), Gaps = 40/261 (15%)

Query: 4   FILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQ 63
           +++V+++ +D L    P+                         + ++  +   L+   L 
Sbjct: 634 YLIVLKKEIDKLKVFMPKV------------------------QSLINEEKKTLQNVTLS 669

Query: 64  VEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQG 123
            E +      +     ES     +   + +      + S       +            G
Sbjct: 670 GESE------SQANTSESPTHGRTTEIENSNPENQAVVSGGGSATPSSVSSETQPAGPTG 723

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
           ++             +                +  S  ++                   P
Sbjct: 724 QAAQAAQEGQAVPPPQPSS----------ATTTPPSQPSSATTTPPSQPSSATTTQPPQP 773

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
           + +            T+      +  +                 +   +     +     
Sbjct: 774 SSATTTPPSQPSSATTQPPQPSSATTTPPPQESSATTTPPSQPSSATTTLPPQPTVPQAQ 833

Query: 244 HFLRRESLDGGNVDKKNVFSG 264
             +     + G          
Sbjct: 834 PEVAPPPQEKGAEVPAAPTQA 854



 Score = 72.3 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/187 (8%), Positives = 38/187 (20%), Gaps = 7/187 (3%)

Query: 185 GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
                S  N   + T G  +     +  +                  +   G +  +   
Sbjct: 669 SGESESQANTSESPTHGRTTEIENSNPENQAVVSGGGSATPSSVSSETQPAGPTGQAAQA 728

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
               +++              +P          +     PS+         S+       
Sbjct: 729 AQEGQAVPPPQPSSATTTPPSQP------SSATTTPPSQPSSATTTQPPQPSSATTTPPS 782

Query: 305 GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
                +T            P            +  S+  +     ++ Q + +       
Sbjct: 783 QPSSATTQPPQPSSATTTPPPQESSATTTPPSQPSSATTTLPPQPTVPQAQPEVAPPPQE 842

Query: 365 KGDIPMI 371
           KG   + 
Sbjct: 843 KG-AEVP 848



 Score = 45.4 bits (105), Expect = 0.021,   Method: Composition-based stats.
 Identities = 10/113 (8%), Positives = 26/113 (23%), Gaps = 6/113 (5%)

Query: 11  AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
              + P +           A  +   +  S     P +         + +        Q+
Sbjct: 746 TPPSQPSSATTTPPSQPSSATTTQPPQPSSATTTPPSQPSSATTQPPQPSSATTTPPPQE 805

Query: 71  SLHTSKQDKESD------IPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
           S  T+    +         P+ +V   +     P     + +  +        
Sbjct: 806 SSATTTPPSQPSSATTTLPPQPTVPQAQPEVAPPPQEKGAEVPAAPTQANDKT 858


>gi|323099908|gb|ADX23545.1| trans-sialidase [Trypanosoma cruzi]
          Length = 818

 Score = 79.7 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/308 (5%), Positives = 51/308 (16%), Gaps = 2/308 (0%)

Query: 58  EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
           E  I  +             + +   PK +              +    +     +    
Sbjct: 456 ETEIGALNANKVTIPPPKSAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPA 515

Query: 118 ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                         +    +         +     E   +    A  +  + +    K A
Sbjct: 516 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPA 575

Query: 178 GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                               + +      +                        +     
Sbjct: 576 EPKPVEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPA 635

Query: 238 SKGSITHFLRRESLDGGNVDKKNVFS--GIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
                               +          PK       +    +  P+    A+  + 
Sbjct: 636 EPKPEEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSG 695

Query: 296 SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
                +      + +          EG           ++    +S+ S  +  +     
Sbjct: 696 EPKPAEPKPAEPKPAEPNAATSSAREGTADQPASATSSDEHEALASVTSSSVAITNVGAS 755

Query: 356 SQGLKGLV 363
           S      V
Sbjct: 756 SSDDAQTV 763



 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/335 (5%), Positives = 46/335 (13%)

Query: 25  HIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIP 84
            +      S   +    KP  PK    +           VE +  +      +  E    
Sbjct: 466 KVTIPPPKSAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPAEPKPAEPKPAEPKPA 525

Query: 85  KSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREIL 144
           +      +    +P     +    +            +          P        +  
Sbjct: 526 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKPA 585

Query: 145 SFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLS 204
                     +   +     E   +  +  +       P                    +
Sbjct: 586 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKPA 645

Query: 205 FYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSG 264
                                        +  K         +      G          
Sbjct: 646 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSGEPKPAEPKPA 705

Query: 265 IRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP 324
                        +                   +A          +       + +    
Sbjct: 706 EPKPAEPNAATSSAREGTADQPASATSSDEHEALASVTSSSVAITNVGASSSDDAQTVGT 765

Query: 325 LIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
             G+        +            +   E     
Sbjct: 766 ESGDMMQADQPTQFSVGTPDAANAATHNAEGKGQE 800



 Score = 61.6 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/293 (6%), Positives = 50/293 (17%), Gaps = 2/293 (0%)

Query: 11  AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQN 68
           A     E  P                  +  +P+  +                  VE + 
Sbjct: 525 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPVEPKP 584

Query: 69  QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +  E    +      +    +P     +    +            + +    
Sbjct: 585 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPEEPKP 644

Query: 129 TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               P        +            +   +     E   +  +  +       P     
Sbjct: 645 AEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSGEPKPAEPKP 704

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                   N         +A              +    +  V+ +   +  S       
Sbjct: 705 AEPKPAEPNAATSSAREGTADQPASATSSDEHEALASVTSSSVAITNVGASSSDDAQTVG 764

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
                     +     +            +E        P    A  + ++  
Sbjct: 765 TESGDMMQADQPTQFSVGTPDAANAATHNAEGKGQEGLHPQVKEAEAATLSSS 817


>gi|319757421|gb|ADV69363.1| Translation initiation factor 2 (IF-2; GTPase) [Streptococcus suis
           JS14]
          Length = 881

 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/381 (6%), Positives = 66/381 (17%), Gaps = 4/381 (1%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           +    + PE +  + E  +        + + +        +  K E A      + Q  +
Sbjct: 396 EPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEV 455

Query: 73  HTSKQDKESDIPKSS---VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
             S   +  D P +      +      +P++         +                   
Sbjct: 456 PESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEP 515

Query: 130 NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                       +      +   E   + S         S                    
Sbjct: 516 KKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAP 575

Query: 190 SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
           S                                +          +    K         E
Sbjct: 576 STPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPE 635

Query: 250 SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                    +       P+  +       E        P A                 + 
Sbjct: 636 EQPKETPAPEEPKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPKQ 695

Query: 310 STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
                   + ++      +          Q            + ++ +  +  + K  + 
Sbjct: 696 EDVQPEAPKSDKVETDK-QLPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQME 754

Query: 370 MIDNAFSASMTLKCNADISLS 390
                  A  + K   D  + 
Sbjct: 755 APKKDSEAPKSDKVETDKPMP 775



 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/373 (8%), Positives = 70/373 (18%), Gaps = 8/373 (2%)

Query: 10  RAVDNLPENTPERRSHIYEHA-----RNSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
           +  D    +TPE++  + E             + E   P +P+E  +      ++A    
Sbjct: 362 KKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAP 421

Query: 65  EKQNQKSLHTSKQDKES---DIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
               ++        +E    D P  S   K+    E           + K +  A  +  
Sbjct: 422 STPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPE 481

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           +              +    E    +  +  E        A    +K             
Sbjct: 482 EKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETP 541

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
               +           + +  +                                     S
Sbjct: 542 DAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPS 601

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
                                +         + E+  +    P      D   T      
Sbjct: 602 TPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPST 661

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                 +          + E  P          +   Q        + + +Q        
Sbjct: 662 PKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVETDKQLPETKQPD 721

Query: 362 LVIKGDIPMIDNA 374
           +       M    
Sbjct: 722 MKQPKADDMPKEQ 734



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/333 (9%), Positives = 68/333 (20%), Gaps = 7/333 (2%)

Query: 39  ESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT-----SKQDKESDIPKSS--VTSK 91
               P  P+   E    +   A    EKQ +                 D P++      K
Sbjct: 347 APQAPSAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEK 406

Query: 92  ENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQ 151
             +  EP+  + S+     K  +     + + K       S       + E  +      
Sbjct: 407 PQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDA 466

Query: 152 HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                      +I  +K ++         S P+             +        +  + 
Sbjct: 467 PSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTP 526

Query: 212 HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
               +           A        ++        +                  +P+   
Sbjct: 527 EKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPE 586

Query: 272 RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRV 331
              E+  + D    + P        +   +                  EE          
Sbjct: 587 SPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEE 646

Query: 332 FINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
              +   Q+            +E+        +
Sbjct: 647 PKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSV 679



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/367 (7%), Positives = 77/367 (20%), Gaps = 6/367 (1%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           +    + PE +  + E  +        + + +        +  K E A      + Q  +
Sbjct: 473 EPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEV 532

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             S   +  D P  +   +      P  +         +     +    Q ++  +    
Sbjct: 533 PESPNPETPDAPS-TPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEE 591

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
           PK                    +       +   D+ ++           P         
Sbjct: 592 PKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKED 651

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL-----R 247
                +        +   E                         +               
Sbjct: 652 TPQTPQAPSTPKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVETD 711

Query: 248 RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
           ++  +    D K   +   PK  +   ++            +      S     + +  D
Sbjct: 712 KQLPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETD 771

Query: 308 ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
           +           +     + + +               K      ++ S+  K   ++ D
Sbjct: 772 KPMPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVESD 831

Query: 368 IPMIDNA 374
             M +  
Sbjct: 832 KQMPETK 838



 Score = 68.1 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/357 (8%), Positives = 70/357 (19%), Gaps = 13/357 (3%)

Query: 10  RAVDNLPENTPERRSHIYEHA-----RNSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
           +  D    +TPE++  + E             + E   P +P+E  +      ++A    
Sbjct: 439 KKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAP 498

Query: 65  EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
               ++        +E     +   S      E           +    K         +
Sbjct: 499 STPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPE 558

Query: 125 SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
            +      PK  +                         A        +            
Sbjct: 559 EKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQP--------EVP 610

Query: 185 GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
            S      +                 +                    + S  K +     
Sbjct: 611 ESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAPKEE 670

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
                +        K   +   PK      E      V                   + +
Sbjct: 671 VPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVETDKQLPETKQPDMKQPKADDM 730

Query: 305 GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
             ++       K E  + +    E     ++      + + K +   +Q   +  K 
Sbjct: 731 PKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQPKA 787



 Score = 60.0 bits (143), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/348 (6%), Positives = 74/348 (21%), Gaps = 1/348 (0%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           PE  PE      E  +        S   + P+          +      ++    S+   
Sbjct: 501 PEKQPEAPESPTEEPKKE-DAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEE 559

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
           K     +  + + ++      +P      +     +     +    Q +   + N    +
Sbjct: 560 KPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPD 619

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                ++        + +   + +P    + D  +  +         P   +        
Sbjct: 620 APSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSV 679

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
             +            +  +         +              K      + +E     +
Sbjct: 680 PEEQPKETPTPEVPKQEDVQPEAPKSDKVETDKQLPETKQPDMKQPKADDMPKEQKPKAD 739

Query: 256 VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
             K       +P++     +  +       T          ++         +       
Sbjct: 740 EPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQPKADDMPKEQKPKAD 799

Query: 316 KKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           + + E+      +            S          + +K    +   
Sbjct: 800 EPKAEQPQMDKPQMEAPKKDSEAPKSDKVESDKQMPETKKPDMKQPKA 847



 Score = 56.2 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/320 (6%), Positives = 63/320 (19%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           +    + PE +  + E  +        + + +        +  K E A      + Q  +
Sbjct: 550 EPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEV 609

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             S   +  D P +     +   +       +      K +            +      
Sbjct: 610 PESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAPKE 669

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                            T          V        ++   K       P      +  
Sbjct: 670 EVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVETDKQLPETKQPDMKQPKADD 729

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                K +                           +  V       +       + ++ D
Sbjct: 730 MPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQPKADD 789

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                K         +      +  +      +       ++      K        +  
Sbjct: 790 MPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVESDKQMPETKKPDMKQPKADD 849

Query: 313 VLGKKEIEEGNPLIGEGRVF 332
           +  +++ +   P   + ++ 
Sbjct: 850 MPKEQKPKADEPKAEQPQMD 869



 Score = 55.8 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/272 (5%), Positives = 33/272 (12%)

Query: 115 LANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
                S                     +      +   E   + S         S     
Sbjct: 347 APQAPSAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEK 406

Query: 175 KLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYS 234
                          S                                +          +
Sbjct: 407 PQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDA 466

Query: 235 IGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
               K         E       + K           ++     S  +        A    
Sbjct: 467 PSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTP 526

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
                       +        K E +  +    + +V     +   S  S         E
Sbjct: 527 EKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPE 586

Query: 355 KSQGLKGLVIKGDIPMIDNAFSASMTLKCNAD 386
                            +       +      
Sbjct: 587 SPTEEPKKEDAPAPSTPEKQPEVPESPNPETP 618



 Score = 54.2 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/362 (7%), Positives = 72/362 (19%), Gaps = 6/362 (1%)

Query: 10  RAVDNLPENTPERRSHIYEHA-----RNSVARRLESMKPRLPKEILERQFNKLEQAILQV 64
           +  D    +TPE++  + E             + E   P +P+E  +      ++A    
Sbjct: 516 KKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAP 575

Query: 65  EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
               ++        +E     +   S      E           +    K    +    +
Sbjct: 576 STPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPE 635

Query: 125 SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
            +     +      +     +    +  + ++    V           + K       P 
Sbjct: 636 EQPKETPA-PEEPKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPK 694

Query: 185 GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
                                 +   +    K           A        +       
Sbjct: 695 QEDVQPEAPKSDKVETDKQLPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQME 754

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
             +++S    +   +        K          ++            A    +      
Sbjct: 755 APKKDSEAPKSDKVETDKPMPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQME 814

Query: 305 GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
              ++S      K   +      +                       + E+ Q  K    
Sbjct: 815 APKKDSEAPKSDKVESDKQMPETKKPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPHTR 874

Query: 365 KG 366
           + 
Sbjct: 875 RA 876



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/309 (7%), Positives = 69/309 (22%), Gaps = 14/309 (4%)

Query: 16  PENTPERRSHIYEH-------ARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
           PE  PE      E        A ++  ++ E  +   P+        K E  +  + ++ 
Sbjct: 578 PEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPEEQ 637

Query: 69  QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            K     ++ K+ D P++           P+    +    S   ++     + +   + +
Sbjct: 638 PKETPAPEEPKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPKQED 697

Query: 129 TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                        +      + Q               D  + ++ K     +       
Sbjct: 698 V-------QPEAPKSDKVETDKQLPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDK 750

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
             +     +                  K                        +    + +
Sbjct: 751 PQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDK 810

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
             ++    D +   S       +       ++    +     +    ++         D+
Sbjct: 811 PQMEAPKKDSEAPKSDKVESDKQMPETKKPDMKQPKADDMPKEQKPKADEPKAEQPQMDK 870

Query: 309 NSTFVLGKK 317
             T      
Sbjct: 871 PHTRRAIDS 879



 Score = 41.5 bits (95), Expect = 0.34,   Method: Composition-based stats.
 Identities = 11/198 (5%), Positives = 26/198 (13%)

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                   +                         +          +    K         
Sbjct: 344 KPDAPQAPSAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQAPSIP 403

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
           E       + K           ++     S  +        A                + 
Sbjct: 404 EEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPET 463

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
                  K E +  +    + +V     +   S  S         E              
Sbjct: 464 PDAPSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAP 523

Query: 369 PMIDNAFSASMTLKCNAD 386
              +       +      
Sbjct: 524 STPEKQPEVPESPNPETP 541


>gi|148257382|ref|YP_001241967.1| hypothetical protein BBta_6136 [Bradyrhizobium sp. BTAi1]
 gi|146409555|gb|ABQ38061.1| hypothetical protein BBta_6136 [Bradyrhizobium sp. BTAi1]
          Length = 277

 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/134 (16%), Positives = 57/134 (42%)

Query: 2   VDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI 61
            D+ +++ RA++NLP++  ERR+ +Y+ AR+++  +LE+M P + +  ++ +   L+ A+
Sbjct: 26  ADYFILLSRAMENLPDSNAERRAEVYQSARHALLTQLEAMNPPVSRSRIKAEQRALDDAV 85

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
             +E +   +     +   +  P             P + + ++           +    
Sbjct: 86  ETIETRALSAPLDDPEPPVTLAPGHFPRFFAANSDVPTVSASTTHDDDQDPAMAQSQFHS 145

Query: 122 QGKSRTNTNLSPKN 135
           +  +R         
Sbjct: 146 KFSARAVEEKPMSR 159


>gi|293364200|ref|ZP_06610926.1| cell surface antigen I/II [Streptococcus oralis ATCC 35037]
 gi|307702445|ref|ZP_07639401.1| putative streptococcal surface protein A [Streptococcus oralis ATCC
            35037]
 gi|291317046|gb|EFE57473.1| cell surface antigen I/II [Streptococcus oralis ATCC 35037]
 gi|307624027|gb|EFO03008.1| putative streptococcal surface protein A [Streptococcus oralis ATCC
            35037]
          Length = 1508

 Score = 79.7 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 76/249 (30%), Gaps = 3/249 (1%)

Query: 33   SVARRLESMKPRLPKEILERQFNKLEQA--ILQVEKQNQKSLHTSKQDKESDIPKSSVTS 90
            ++ +    ++P  P+         LE A  +   E +    + T  Q + S   + +  +
Sbjct: 829  TLEKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYET 888

Query: 91   KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNT 150
            ++ +   P   S  +              S   +   +   +P       +     +V T
Sbjct: 889  EKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 948

Query: 151  QHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALS 210
             H + + +     I  +        +          + + +        R   +    L 
Sbjct: 949  VHFHYNRLFAQPQINKEIKNEDGVDIDRTLVAKQSVVKFELKTEALTAGRPKTT-SFVLV 1007

Query: 211  EHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKIT 270
            +     Y   L      + G   S  K+  ++T     E+L   N D    F  + P + 
Sbjct: 1008 DPLPTGYQFDLEATKAASKGFETSYDKASHTVTFKATEETLAAFNADLTKSFETLYPTVV 1067

Query: 271  RRLLEDGSE 279
             R+L DG+ 
Sbjct: 1068 GRVLNDGAT 1076



 Score = 50.0 bits (117), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/100 (14%), Positives = 29/100 (29%), Gaps = 2/100 (2%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQK 70
           +      P      YE+      +  +  +P  P+E        LE A      E +   
Sbjct: 848 EVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTP 907

Query: 71  SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
            + T  Q + S   + +        + P  + + +     
Sbjct: 908 PVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVP 947



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 7/156 (4%), Positives = 23/156 (14%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
             +    + A  LS +  +           +      L                    + 
Sbjct: 793 QPAANDPRRAEKLSPKKPNIWFAINGNVRATNLPTITLEKPTPPVEPTAPQAPTYEVEKP 852

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
            +            + P  +      +     T               ++      +   
Sbjct: 853 LEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKTP 912

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
                S     +   +       +            
Sbjct: 913 DQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 948



 Score = 47.7 bits (111), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/197 (6%), Positives = 34/197 (17%), Gaps = 2/197 (1%)

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                   +D P S   +       P        + S++          +   + +    
Sbjct: 751 QPDSGWDNADAPNSWYGAGAVEISGPSNSMTIGTISSSEVLGQPAANDPRRAEKLSPKKP 810

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF--PTGSIFWS 190
              F+       +       E  +      A +     + +                   
Sbjct: 811 NIWFAINGNVRATNLPTITLEKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPV 870

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                   ++     Y                      +        SK    ++    +
Sbjct: 871 KTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYDPLPT 930

Query: 251 LDGGNVDKKNVFSGIRP 267
                  K+       P
Sbjct: 931 PPVAPTPKQLPTPPAVP 947


>gi|72000923|ref|NP_001024204.1| TiTiN family member (ttn-1) [Caenorhabditis elegans]
          Length = 18562

 Score = 79.3 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/340 (6%), Positives = 67/340 (19%), Gaps = 17/340 (5%)

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS------------- 104
            ++A   VE   + S   S++ +  +        K     EP    +              
Sbjct: 3332 QEAAPVVESIEETSSIGSEEFEIIEKFTEEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQ 3391

Query: 105  SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
             +       +       +  + +  + +         E                   A +
Sbjct: 3392 EVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPTQADV 3451

Query: 165  EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
                + L + ++             +  +          S           +       +
Sbjct: 3452 PKVAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEV 3511

Query: 225  LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
              +A  +     +           +                 PK          +V    
Sbjct: 3512 PMVAAPLEPIQEEVPKEAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSGPTQEDVPKEE 3571

Query: 285  STIPVADFANTSNIAFKNYI----GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQS 340
            +             A           +   +        E       +  V       + 
Sbjct: 3572 APSEPTQEDVPKEAAPSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEP 3631

Query: 341  SILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMT 380
            +    ++    +  +   ++    + + P+ +   +   T
Sbjct: 3632 TQEQSEVSKRSEPVEPTQIQQAASEEETPLEETNETVVQT 3671



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/254 (8%), Positives = 55/254 (21%), Gaps = 6/254 (2%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQ----FNKLEQAILQVEK 66
             V    E T +                +  +   L +  ++++       LE    +V K
Sbjct: 3469 TVAAPSEPT-QADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPK 3527

Query: 67   QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
            +   S  T +   +   P             P        +   +         V  ++ 
Sbjct: 3528 EAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSG-PTQEDVPKEEAPSEPTQEDVPKEAA 3586

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
             +                +  V  +      +      E   S   + +           
Sbjct: 3587 PSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEPTQEQSEVSKRSEPVE 3646

Query: 187  IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
                       +T    +  + +  +   K            +  S  +  +   I H  
Sbjct: 3647 PTQIQQAASEEETPLEETNETVVQTNEDVKEAEVPENAEAQKVVDSSDLQVAASEIAHLA 3706

Query: 247  RRESLDGGNVDKKN 260
              E++   +     
Sbjct: 3707 IDEAVLETSNQPSQ 3720


>gi|115699004|ref|XP_780169.2| PREDICTED: similar to cortical granule protein with LDL-receptor-like
            repeats [Strongylocentrotus purpuratus]
 gi|115950522|ref|XP_001192861.1| PREDICTED: similar to cortical granule protein with LDL-receptor-like
            repeats [Strongylocentrotus purpuratus]
          Length = 1110

 Score = 79.3 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/294 (6%), Positives = 59/294 (20%), Gaps = 12/294 (4%)

Query: 7    VIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ-AILQV- 64
            ++++ VD L +   E         +       E+++P  P+E+   +   ++  A  +V 
Sbjct: 812  LLRQDVDILKQQANENNQ--PYAPQEVQPYEPEAVQPYAPQEVQPYEPEAVQPYAPQEVQ 869

Query: 65   --EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPR-LRSISSILRSNKHKKLANILSV 121
              E +  +                    ++    EP+ +R            +       
Sbjct: 870  PYEPEAVQPYEPQDVRPYEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEP 929

Query: 122  ----QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                  + +      P++      + +              +       D        + 
Sbjct: 930  QDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVR 989

Query: 178  GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
                             +  +                         +             
Sbjct: 990  PYEPQDVRPPEPQNVRPYEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEP 1049

Query: 238  SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVAD 291
                          +  +V        +RP   + +     +         V  
Sbjct: 1050 QDVRPPEPQNVRPYEPQDVRPPEPQ-NVRPYEPQDVRPYEPQEVRPYEPQDVRP 1102



 Score = 77.7 bits (189), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/284 (5%), Positives = 46/284 (16%), Gaps = 6/284 (2%)

Query: 38   LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
             + ++P  P+ +         Q +   E +  +     +              ++    E
Sbjct: 833  PQEVQPYEPEAV----QPYAPQEVQPYEPEAVQPYAPQEVQPYEPEAVQPYEPQDVRPYE 888

Query: 98   PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
            P+             +            R     + + +  +            +E    
Sbjct: 889  PQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDV 948

Query: 158  VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
              P                      P              +            E    + 
Sbjct: 949  RPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPP--EPQNVRP 1006

Query: 218  FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
            +    +       V     ++         R          +            R  E  
Sbjct: 1007 YEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQDVRPPEPQNVRPYEPQ 1066

Query: 278  SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEE 321
                  P  +   +  +      +     +              
Sbjct: 1067 DVRPPEPQNVRPYEPQDVRPYEPQEVRPYEPQDVRPYETHNARP 1110


>gi|72000921|ref|NP_001024203.1| TiTiN family member (ttn-1) [Caenorhabditis elegans]
 gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans]
          Length = 18519

 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/340 (6%), Positives = 67/340 (19%), Gaps = 17/340 (5%)

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS------------- 104
            ++A   VE   + S   S++ +  +        K     EP    +              
Sbjct: 3332 QEAAPVVESIEETSSIGSEEFEIIEKFTEEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQ 3391

Query: 105  SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
             +       +       +  + +  + +         E                   A +
Sbjct: 3392 EVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPTQADV 3451

Query: 165  EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
                + L + ++             +  +          S           +       +
Sbjct: 3452 PKVAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEV 3511

Query: 225  LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
              +A  +     +           +                 PK          +V    
Sbjct: 3512 PMVAAPLEPIQEEVPKEAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSGPTQEDVPKEE 3571

Query: 285  STIPVADFANTSNIAFKNYI----GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQS 340
            +             A           +   +        E       +  V       + 
Sbjct: 3572 APSEPTQEDVPKEAAPSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEP 3631

Query: 341  SILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMT 380
            +    ++    +  +   ++    + + P+ +   +   T
Sbjct: 3632 TQEQSEVSKRSEPVEPTQIQQAASEEETPLEETNETVVQT 3671



 Score = 60.8 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/254 (8%), Positives = 55/254 (21%), Gaps = 6/254 (2%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQ----FNKLEQAILQVEK 66
             V    E T +                +  +   L +  ++++       LE    +V K
Sbjct: 3469 TVAAPSEPT-QADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPK 3527

Query: 67   QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
            +   S  T +   +   P             P        +   +         V  ++ 
Sbjct: 3528 EAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSG-PTQEDVPKEEAPSEPTQEDVPKEAA 3586

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
             +                +  V  +      +      E   S   + +           
Sbjct: 3587 PSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEPTQEQSEVSKRSEPVE 3646

Query: 187  IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
                       +T    +  + +  +   K            +  S  +  +   I H  
Sbjct: 3647 PTQIQQAASEEETPLEETNETVVQTNEDVKEAEVPENAEAQKVVDSSDLQVAASEIAHLA 3706

Query: 247  RRESLDGGNVDKKN 260
              E++   +     
Sbjct: 3707 IDEAVLETSNQPSQ 3720


>gi|72000919|ref|NP_001024202.1| TiTiN family member (ttn-1) [Caenorhabditis elegans]
 gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans]
          Length = 18534

 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/340 (6%), Positives = 67/340 (19%), Gaps = 17/340 (5%)

Query: 58   EQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS------------- 104
            ++A   VE   + S   S++ +  +        K     EP    +              
Sbjct: 3332 QEAAPVVESIEETSSIGSEEFEIIEKFTEEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQ 3391

Query: 105  SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
             +       +       +  + +  + +         E                   A +
Sbjct: 3392 EVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPTQADV 3451

Query: 165  EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
                + L + ++             +  +          S           +       +
Sbjct: 3452 PKVAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEV 3511

Query: 225  LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
              +A  +     +           +                 PK          +V    
Sbjct: 3512 PMVAAPLEPIQEEVPKEAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSGPTQEDVPKEE 3571

Query: 285  STIPVADFANTSNIAFKNYI----GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQS 340
            +             A           +   +        E       +  V       + 
Sbjct: 3572 APSEPTQEDVPKEAAPSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEP 3631

Query: 341  SILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMT 380
            +    ++    +  +   ++    + + P+ +   +   T
Sbjct: 3632 TQEQSEVSKRSEPVEPTQIQQAASEEETPLEETNETVVQT 3671



 Score = 61.2 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/254 (8%), Positives = 55/254 (21%), Gaps = 6/254 (2%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQ----FNKLEQAILQVEK 66
             V    E T +                +  +   L +  ++++       LE    +V K
Sbjct: 3469 TVAAPSEPT-QADVPKEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPK 3527

Query: 67   QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
            +   S  T +   +   P             P        +   +         V  ++ 
Sbjct: 3528 EAAPSEPTQEDVPKGAAPLEPTQEDVPKEAAPSG-PTQEDVPKEEAPSEPTQEDVPKEAA 3586

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
             +                +  V  +      +      E   S   + +           
Sbjct: 3587 PSEPTQENVPKEAAPSEPTKDVPKEAAPSEPIQEEVPKEATLSEPTQEQSEVSKRSEPVE 3646

Query: 187  IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
                       +T    +  + +  +   K            +  S  +  +   I H  
Sbjct: 3647 PTQIQQAASEEETPLEETNETVVQTNEDVKEAEVPENAEAQKVVDSSDLQVAASEIAHLA 3706

Query: 247  RRESLDGGNVDKKN 260
              E++   +     
Sbjct: 3707 IDEAVLETSNQPSQ 3720


>gi|241888531|ref|ZP_04775839.1| hypothetical protein GEMHA0001_0073 [Gemella haemolysans ATCC
           10379]
 gi|241864798|gb|EER69172.1| hypothetical protein GEMHA0001_0073 [Gemella haemolysans ATCC
           10379]
          Length = 978

 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/329 (6%), Positives = 50/329 (15%)

Query: 46  PKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS 105
           P+         +E A+     + ++    + + +E  +P            +    S  +
Sbjct: 187 PEYKEVLGGAIVEPAVQPELPKAEEPATPAPKAEEIGVPAPKAEEPSAPAPKAEQPSAPA 246

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
                              +      +            +                AA  
Sbjct: 247 PKAEEPAAPAPKAEEPAAPAPKAEEPAASAPKAEGPAAPAPKAEEPAAPAPKAEEPAASA 306

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
                                                     A            + +  
Sbjct: 307 PKVEEPAAPAPKVEEPATPAPKAEEPATPAPKAEEPAAPAPKAEEPATPAPKAEEIGVPA 366

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPS 285
             A   +    K++       + E         +   +               E    PS
Sbjct: 367 PKAEEPAAPAPKAEEPAAPAPKVEEPATPAPKAEEPAAPAPKAEEPATPAPKVEEPAAPS 426

Query: 286 TIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSG 345
                  A +                     K  E   P            + +      
Sbjct: 427 PKAEEPAAPSPKAEEPAAPALKVEEPAAPAPKAEEPAAPSPKAEEPAAPALKVEEPAAPA 486

Query: 346 KILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                    K       V   D  + +  
Sbjct: 487 PKAEEPTAPKEDTPSEEVTPKDEKLEEAK 515



 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/311 (5%), Positives = 52/311 (16%), Gaps = 1/311 (0%)

Query: 38  LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
            ++ +P  P    E       +A        +    ++   K  +    +  ++E     
Sbjct: 207 PKAEEPATPAPKAEEIGVPAPKAEEPSAPAPKAEQPSAPAPKAEEPAAPAPKAEEPAAPA 266

Query: 98  PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
           P+    ++     +        + +  +           S    E  +       E  + 
Sbjct: 267 PKAEEPAASAPKAEGPAAPAPKAEEPAAPAPK-AEEPAASAPKVEEPAAPAPKVEEPATP 325

Query: 158 VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
                       +          +    +             +       A         
Sbjct: 326 APKAEEPATPAPKAEEPAAPAPKAEEPATPAPKAEEIGVPAPKAEEPAAPAPKAEEPAAP 385

Query: 218 FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
              +      A         +  +         ++              P          
Sbjct: 386 APKVEEPATPAPKAEEPAAPAPKAEEPATPAPKVEEPAAPSPKAEEPAAPSPKAEEPAAP 445

Query: 278 SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR 337
           +     P+          +                       +   P   +      +  
Sbjct: 446 ALKVEEPAAPAPKAEEPAAPSPKAEEPAAPALKVEEPAAPAPKAEEPTAPKEDTPSEEVT 505

Query: 338 GQSSILSGKIL 348
            +   L     
Sbjct: 506 PKDEKLEEAKK 516



 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/308 (5%), Positives = 48/308 (15%)

Query: 45  LPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS 104
           +   +        E A    + +         ++  +  PK+   S      E       
Sbjct: 198 VEPAVQPELPKAEEPATPAPKAEEIGVPAPKAEEPSAPAPKAEQPSAPAPKAEEPAAPAP 257

Query: 105 SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
                      A   +                                          A 
Sbjct: 258 KAEEPAAPAPKAEEPAASAPKAEGPAAPAPKAEEPAAPAPKAEEPAASAPKVEEPAAPAP 317

Query: 165 EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
           + ++      K     +    +   +       +          +               
Sbjct: 318 KVEEPATPAPKAEEPATPAPKAEEPAAPAPKAEEPATPAPKAEEIGVPAPKAEEPAAPAP 377

Query: 225 LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                       +   +        +      ++    +    +      +        P
Sbjct: 378 KAEEPAAPAPKVEEPATPAPKAEEPAAPAPKAEEPATPAPKVEEPAAPSPKAEEPAAPSP 437

Query: 285 STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
                A  A             +E +      +E       + E      K    ++   
Sbjct: 438 KAEEPAAPALKVEEPAAPAPKAEEPAAPSPKAEEPAAPALKVEEPAAPAPKAEEPTAPKE 497

Query: 345 GKILWSLQ 352
                 + 
Sbjct: 498 DTPSEEVT 505



 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/352 (7%), Positives = 61/352 (17%), Gaps = 5/352 (1%)

Query: 11  AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                 E          E +  +      S      +E         E A    + +   
Sbjct: 214 TPAPKAEEIGVPAPKAEEPSAPAPKAEQPSAPAPKAEEPAAPAPKAEEPAAPAPKAEEPA 273

Query: 71  SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
           +     +   +  PK+   +      E    S   +             +          
Sbjct: 274 ASAPKAEGPAAPAPKAEEPAAPAPKAEEPAASAPKVEEPAAPAPKVEEPATPAPK----- 328

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
                      E  +       E  +       I     +          +    +    
Sbjct: 329 AEEPATPAPKAEEPAAPAPKAEEPATPAPKAEEIGVPAPKAEEPAAPAPKAEEPAAPAPK 388

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V        +       A            +      +         S  +         
Sbjct: 389 VEEPATPAPKAEEPAAPAPKAEEPATPAPKVEEPAAPSPKAEEPAAPSPKAEEPAAPALK 448

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
           ++              P          +     P+         T+              
Sbjct: 449 VEEPAAPAPKAEEPAAPSPKAEEPAAPALKVEEPAAPAPKAEEPTAPKEDTPSEEVTPKD 508

Query: 311 TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             +   K+  +               + +      K+   L++ K  GL+ +
Sbjct: 509 EKLEEAKKDGKDVIEKIAASKLSEIEKVKDEAEKAKLEAKLKELKEAGLEAI 560


>gi|331284120|ref|NP_001193562.1| proteoglycan 4 [Bos taurus]
          Length = 1195

 Score = 78.9 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/351 (6%), Positives = 55/351 (15%)

Query: 12  VDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
           V  +     E  +                 +P              E A     K+   +
Sbjct: 325 VPAISTPKAETITRSPTPTTPKDPPPTHPKEPAPTNNKEPTPTTPKEPAPTTTPKEPAPT 384

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
               +   +   P ++         +    +         HK+     + +  + T+   
Sbjct: 385 TKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKE 444

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
                                                        +     PT +     
Sbjct: 445 PAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA 504

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                 +         A +E                           + + T        
Sbjct: 505 PTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPT 564

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
                          P   +      +  +  P+T P                     + 
Sbjct: 565 TTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAE 624

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                    E                  +S  + +   +L+       +  
Sbjct: 625 PKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPP 675



 Score = 73.5 bits (178), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 16/323 (4%), Positives = 44/323 (13%), Gaps = 5/323 (1%)

Query: 44  RLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSI 103
                  E +    E A     K+   ++           P  +   +      P+  + 
Sbjct: 380 EPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAP 439

Query: 104 SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
           +S                   +                         + +  +  S    
Sbjct: 440 TSPKEPAP-----TSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEP 494

Query: 164 IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                ++            PT     +                   +             
Sbjct: 495 APTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPA 554

Query: 224 LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                     +  K            +                    +       +    
Sbjct: 555 PTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAP 614

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                 A                  +             +    E    +      +   
Sbjct: 615 AEPKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQP 674

Query: 344 SGKILWSLQQEKSQGLKGLVIKG 366
             +      +   +      IKG
Sbjct: 675 PIEPTPKALENSPKEPAVPTIKG 697



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/332 (6%), Positives = 54/332 (16%), Gaps = 1/332 (0%)

Query: 17  ENTPERRSHIYEHARNSVARRLESMKP-RLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
              P   +   E A  +      + +P               E A    ++    +    
Sbjct: 369 PKEPAPTTTPKEPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEP 428

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
                   P  +   +            S    +          +   +        P  
Sbjct: 429 TPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAP 488

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
            S +     + +                 +       +         P  +         
Sbjct: 489 TSSKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPA 548

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
             K     S           +                 +   +          +     +
Sbjct: 549 EPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTD 608

Query: 256 VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
             +        P          +  +    + P      TS  +          +     
Sbjct: 609 PKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPA 668

Query: 316 KKEIEEGNPLIGEGRVFINKGRGQSSILSGKI 347
           +   +       +      K     +I   K+
Sbjct: 669 ESTPQPPIEPTPKALENSPKEPAVPTIKGPKV 700



 Score = 68.9 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/343 (5%), Positives = 46/343 (13%), Gaps = 11/343 (3%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P +T  +          +            P+                     +    T 
Sbjct: 293 PTSTSAKEKTTSAKETRTAENTSTKGLAPTPEVPAISTPKAETITRSPTPTTPKDPPPTH 352

Query: 76  KQDKE-----------SDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
            ++                P  + T KE           +         K       +  
Sbjct: 353 PKEPAPTNNKEPTPTTPKEPAPTTTPKEPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEP 412

Query: 125 SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
           + T                 +                       S               
Sbjct: 413 APTTPKEPAPTTHKEPTPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEPAPTTTPKEPAP 472

Query: 185 GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
                                 +  +                            + + T 
Sbjct: 473 TDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTS 532

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
                                 P   +      +  +  P+        +    A     
Sbjct: 533 PKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTT 592

Query: 305 GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKI 347
                +T        +   P   E +        + +  S + 
Sbjct: 593 KEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPET 635



 Score = 61.9 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/307 (7%), Positives = 53/307 (17%), Gaps = 2/307 (0%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
           +      P+ P     ++               ++      ++      K    +     
Sbjct: 443 KEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKE 502

Query: 96  LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
             P            K    A        S      +         E    +  +  E  
Sbjct: 503 PAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPA 562

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
            + +       +         +     PT +           +         A +E    
Sbjct: 563 PTTTTKEPAPAEPKEPAP--TSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEP 620

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
                          ++ S        T      +            +   P+       
Sbjct: 621 APAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTP 680

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
              E       +P       +       +        +    EI      I        +
Sbjct: 681 KALENSPKEPAVPTIKGPKVNKPEITTTVKDKSTEKDIYSTPEITTAVAKIITEAATKTE 740

Query: 336 GRGQSSI 342
              +S I
Sbjct: 741 KTTESKI 747



 Score = 60.4 bits (144), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/344 (6%), Positives = 44/344 (12%), Gaps = 4/344 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
            E  P              A                   +  E A    ++    S    
Sbjct: 402 KEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEP 461

Query: 76  KQDKESDIPKS----SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                   P           E     P      +   + K             +      
Sbjct: 462 APTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTDPKEPA 521

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
             +            +  T  +  +   P                    +          
Sbjct: 522 PAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPT 581

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                  T          +                          +   +    L   S 
Sbjct: 582 SPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSP 641

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
           D          +          L+  +E    P   P       S               
Sbjct: 642 DIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPTIKGPKVN 701

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
                  +++ +                  I           E 
Sbjct: 702 KPEITTTVKDKSTEKDIYSTPEITTAVAKIITEAATKTEKTTES 745



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/350 (4%), Positives = 59/350 (16%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           D       E +      ++                       +  E A  + ++    S 
Sbjct: 474 DPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSP 533

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                   +  P  +   +            ++       +      +   +    T   
Sbjct: 534 KEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTK 593

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
               +   +E            +      A  +                 P  +   +  
Sbjct: 594 EPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEAST 653

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
           +    +    L   +  +     +     +        V    G            +   
Sbjct: 654 STTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPTIKGPKVNKPEITTTVKDKS 713

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                                    +E               ++             +T 
Sbjct: 714 TEKDIYSTPEITTAVAKIITEAATKTEKTTESKIPSTTTDVTSTTTKDTTSSKITPKATL 773

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                   +      + +        +    + ++     Q+ ++  K  
Sbjct: 774 APKVMTATKKTTEKTKNKPEKTTAVPKGRATNSQVTTPKPQKPTKAPKKP 823



 Score = 46.9 bits (109), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/349 (7%), Positives = 69/349 (19%), Gaps = 3/349 (0%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
            E  P         +    A    + +P   +       +  E A     K+   +    
Sbjct: 518 KEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEP-- 575

Query: 76  KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            ++     PK    +       P            K    A               +   
Sbjct: 576 -KEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPE 634

Query: 136 FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
                   +     ++    ++    +      +                +         
Sbjct: 635 TLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPT 694

Query: 196 FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
               +      +   +    +  ++    +  A+    +   +K   T   +  S     
Sbjct: 695 IKGPKVNKPEITTTVKDKSTEKDIYSTPEITTAVAKIITEAATKTEKTTESKIPSTTTDV 754

Query: 256 VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG 315
                  +       +  L          +T    +    +    K      + +T    
Sbjct: 755 TSTTTKDTTSSKITPKATLAPKVMTATKKTTEKTKNKPEKTTAVPKGRATNSQVTTPKPQ 814

Query: 316 KKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
           K       P   +        + +++    K   S   E +       +
Sbjct: 815 KPTKAPKKPTSTKKPRTPRVRKPKTTPTPPKTTTSAMPEPTPTSLPEAM 863



 Score = 46.2 bits (107), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/334 (5%), Positives = 59/334 (17%)

Query: 38  LESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97
                     +         E A     K+   +        E   P  +   +      
Sbjct: 574 EPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSP 633

Query: 98  PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
             L   S  + +    + +   +    S T  + +       +        N+  E    
Sbjct: 634 ETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVP 693

Query: 158 VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
                 +   +        +      +     +       +        +          
Sbjct: 694 TIKGPKVNKPEITTTVKDKSTEKDIYSTPEITTAVAKIITEAATKTEKTTESKIPSTTTD 753

Query: 218 FVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDG 277
                     +  ++     +   +T   +         +K       R   ++      
Sbjct: 754 VTSTTTKDTTSSKITPKATLAPKVMTATKKTTEKTKNKPEKTTAVPKGRATNSQVTTPKP 813

Query: 278 SEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGR 337
            +    P          T  +           +T     +      P             
Sbjct: 814 QKPTKAPKKPTSTKKPRTPRVRKPKTTPTPPKTTTSAMPEPTPTSLPEAMLQTTTRPTPT 873

Query: 338 GQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
             S I+                  ++ +  +   
Sbjct: 874 PNSEIIDVNPENEDGDAAEGEKPHMIFRPPVLTP 907



 Score = 41.1 bits (94), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/295 (6%), Positives = 53/295 (17%), Gaps = 5/295 (1%)

Query: 74  TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
           ++   +    PK     K     +P           +        L+      T      
Sbjct: 185 SAANRELKKKPKVKDKKKRTPKNKPTPEPPVIDEDGSGLDNGDFKLTPTPNIPTTQRNKV 244

Query: 134 KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                      +    +      +   + +  + ++ +   + +      + S      +
Sbjct: 245 TTTPKITTVKPTLPKPSLPPNSDTTKEIPSTVNRETTVETKETSTTNKPTSTSAKEKTTS 304

Query: 194 YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
               +T    S         +          +  +   +                 + + 
Sbjct: 305 AKETRTAENTSTKGLAPTPEVPAISTPKAETITRSPTPTTPKDPPPTHPKEPAPTNNKEP 364

Query: 254 GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI-----PVADFANTSNIAFKNYIGGDE 308
                K       PK      ++       P+       P                    
Sbjct: 365 TPTTPKEPAPTTTPKEPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTT 424

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           +          E       E      K    +S        + ++      K   
Sbjct: 425 HKEPTPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPA 479


>gi|242011150|ref|XP_002426318.1| hypothetical protein Phum_PHUM248030 [Pediculus humanus corporis]
 gi|212510395|gb|EEB13580.1| hypothetical protein Phum_PHUM248030 [Pediculus humanus corporis]
          Length = 2034

 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/359 (9%), Positives = 73/359 (20%), Gaps = 9/359 (2%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             +  PE  +      R        S +   P      Q      A    +++ +    T+
Sbjct: 1120 SQRRPETVASTTSQRRPEPVASTTSQRRPEPVASTTSQRRPERVASTTSQRRPEPVASTT 1179

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
             Q +   +  ++   +         +     +     ++    +S     R   +++P  
Sbjct: 1180 SQRRPERVASTTSQRRPERVASTTSQRRPESVADKAPERRPEPVSTTTSERRPESVAPTT 1239

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
               R   + S +   + E   + +         +     +     +  T           
Sbjct: 1240 SQRRPESVASTTSQRRLEP-VAGTSSQHRLEPVASTTSQRRPEPVASTTSQRRPESVAPT 1298

Query: 196  FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
             ++ R      +                           I     + T   RR     G 
Sbjct: 1299 TSQRRPESVAPTTSQRRPESVADKAPERRPEPVADNVPEIRLEPVASTSSQRRPESVAGK 1358

Query: 256  VDK---KNVFSGIRPKITRRLLEDGSEVDVGP---STIPVADFANTSNIAFKNYIGGDEN 309
            V       V     P+  RR  E              +                      
Sbjct: 1359 VPSLLTAPVQDTAPPEAARRRTESAVSSGSKRRRLERVSSTTSQRRPEPVAPTTTQRRPE 1418

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ--QEKSQGLKGLVIKG 366
                   +   E        R                +  S+Q   E        +I  
Sbjct: 1419 PVAPTTTQRRPEPVAPTTTQRRPEPVADNVPERRLEPVAGSVQPLAEPVHDDTPPLIPA 1477



 Score = 68.1 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/311 (8%), Positives = 76/311 (24%), Gaps = 5/311 (1%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            R      +  PER +      R          +   P      +      A    +++ +
Sbjct: 1186 RVASTTSQRRPERVASTTSQRRPESVADKAPERRPEPVSTTTSERRPESVAPTTSQRRPE 1245

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                T+ Q +   +  +S   +         +     + S   ++    ++     R   
Sbjct: 1246 SVASTTSQRRLEPVAGTSSQHRLEPVASTTSQRRPEPVASTTSQRRPESVAPTTSQRRPE 1305

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
            +++P     R   +   +   + E  +   P   +E   S   + +   +       +  
Sbjct: 1306 SVAPTTSQRRPESVADKAPERRPEPVADNVPEIRLEPVASTSSQRRPESVAGKVPSLLTA 1365

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
             V +    +     +  +  S           +  +            +  +        
Sbjct: 1366 PVQDTAPPEAARRRTESAVSSGSK-----RRRLERVSSTTSQRRPEPVAPTTTQRRPEPV 1420

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +        + V      +    + ++  E  + P    V   A   +      I    +
Sbjct: 1421 APTTTQRRPEPVAPTTTQRRPEPVADNVPERRLEPVAGSVQPLAEPVHDDTPPLIPAPTD 1480

Query: 310  STFVLGKKEIE 320
                    + +
Sbjct: 1481 ENAPQTNVQSQ 1491



 Score = 53.9 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/292 (7%), Positives = 56/292 (19%), Gaps = 4/292 (1%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             +  PE  +      R        S +          Q      A    +K  ++     
Sbjct: 1276 SQRRPEPVASTTSQRRPESVAPTTSQRRPESVAPTTSQRRPESVA----DKAPERRPEPV 1331

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
              +      +   ++      E     + S+L +          + +      ++ S + 
Sbjct: 1332 ADNVPEIRLEPVASTSSQRRPESVAGKVPSLLTAPVQDTAPPEAARRRTESAVSSGSKRR 1391

Query: 136  FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYF 195
               R+    S          ++      +    ++ R   +A   +              
Sbjct: 1392 RLERVSSTTSQRRPEPVAPTTTQRRPEPVAPTTTQRRPEPVAPTTTQRRPEPVADNVPER 1451

Query: 196  FNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGN 255
              +         A   H      +              S  + K         E      
Sbjct: 1452 RLEPVAGSVQPLAEPVHDDTPPLIPAPTDENAPQTNVQSQRRRKEPPETPAPPERPLLSQ 1511

Query: 256  VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
                 V                  +D  P           +   +      +
Sbjct: 1512 TKLPTVLPRPPEIRRDAPANMIPIIDSVPIVDSTQPLLPQTITKYVPPSEAE 1563



 Score = 41.9 bits (96), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/267 (7%), Positives = 58/267 (21%), Gaps = 5/267 (1%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +R     P  +  R   + + A     RR E +   +P+  +  +      +  + E   
Sbjct: 1302 RRPESVAPTTSQRRPESVADKAP---ERRPEPVADNVPE--IRLEPVASTSSQRRPESVA 1356

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
             K         +   P  +   +    +    +       S+   +          ++  
Sbjct: 1357 GKVPSLLTAPVQDTAPPEAARRRTESAVSSGSKRRRLERVSSTTSQRRPEPVAPTTTQRR 1416

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                    + R  E ++ +   +     + +         +   +     +       I 
Sbjct: 1417 PEPVAPTTTQRRPEPVAPTTTQRRPEPVADNVPERRLEPVAGSVQPLAEPVHDDTPPLIP 1476

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                                  E         L       +       +           
Sbjct: 1477 APTDENAPQTNVQSQRRRKEPPETPAPPERPLLSQTKLPTVLPRPPEIRRDAPANMIPII 1536

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLE 275
            +S+   +  +  +   I   +     E
Sbjct: 1537 DSVPIVDSTQPLLPQTITKYVPPSEAE 1563


>gi|119597393|gb|EAW76987.1| hCG19253, isoform CRA_c [Homo sapiens]
          Length = 4928

 Score = 78.5 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 73.1 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 66.6 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 56.2 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 51.9 bits (122), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/324 (6%), Positives = 69/324 (21%), Gaps = 1/324 (0%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
             +     P     + + A                 +   +Q   ++     V   +  + 
Sbjct: 716  PSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLVSSSSATTK 775

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                  K     +   T           +S               I      S+  ++  
Sbjct: 776  PDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISHPG 835

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            P + S   +++       + +   +            +          +           
Sbjct: 836  PSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQS 895

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                 ++R       ++++    +       + G   G   SI     ++     +    
Sbjct: 896  PKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPH 955

Query: 253  GGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              +     +  +    +         S     P+          +       +       
Sbjct: 956  SQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQA 1015

Query: 312  FVLGKKEIEEGNPLIGEGRVFINK 335
              + + E E+  P I + +    +
Sbjct: 1016 PTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/376 (5%), Positives = 67/376 (17%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN----------- 297
                             +P+   R                      T             
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 45.8 bits (106), Expect = 0.017,   Method: Composition-based stats.
 Identities = 33/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            +
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVT 814



 Score = 40.4 bits (92), Expect = 0.64,   Method: Composition-based stats.
 Identities = 15/279 (5%), Positives = 41/279 (14%), Gaps = 6/279 (2%)

Query: 101 RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
               +       K+                   +     + +      +   +  +  S 
Sbjct: 180 SDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSI 239

Query: 161 VAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
            +           G    I                        +  + +      K  + 
Sbjct: 240 SSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLP 299

Query: 221 LIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGS 278
                 +           +          +          K +                +
Sbjct: 300 SPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTT 359

Query: 279 EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFIN 334
           +    P          T +    +   G +      G  +     P       +      
Sbjct: 360 KPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPK 419

Query: 335 KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
               Q  + S        +   Q      I         
Sbjct: 420 PLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 36.5 bits (82), Expect = 9.3,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|119597394|gb|EAW76988.1| hCG19253, isoform CRA_d [Homo sapiens]
          Length = 4919

 Score = 78.5 bits (191), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 66.6 bits (160), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 56.2 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 51.9 bits (122), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/324 (6%), Positives = 69/324 (21%), Gaps = 1/324 (0%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
             +     P     + + A                 +   +Q   ++     V   +  + 
Sbjct: 716  PSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLVSSSSATTK 775

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                  K     +   T           +S               I      S+  ++  
Sbjct: 776  PDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRPASDSKIISHPG 835

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            P + S   +++       + +   +            +          +           
Sbjct: 836  PSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQS 895

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                 ++R       ++++    +       + G   G   SI     ++     +    
Sbjct: 896  PKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPH 955

Query: 253  GGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              +     +  +    +         S     P+          +       +       
Sbjct: 956  SQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQA 1015

Query: 312  FVLGKKEIEEGNPLIGEGRVFINK 335
              + + E E+  P I + +    +
Sbjct: 1016 PTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/376 (5%), Positives = 67/376 (17%), Gaps = 21/376 (5%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQP--KM 759

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
               +    S           +++ +  +       ++ D ++  +               
Sbjct: 760  VKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSK 819

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                    +K        S                       +S                
Sbjct: 820  AIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPP 879

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN----------- 297
                             +P+   R                      T             
Sbjct: 880  GPRPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIF 939

Query: 298  -------IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
                             ++      K+      P   +G          +   S  +   
Sbjct: 940  SQASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKE 999

Query: 351  LQQEKSQGLKGLVIKG 366
             +   ++ L+    + 
Sbjct: 1000 TKAPAAEKLEPKAEQA 1015



 Score = 45.8 bits (106), Expect = 0.018,   Method: Composition-based stats.
 Identities = 33/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            +
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVT 814



 Score = 40.4 bits (92), Expect = 0.67,   Method: Composition-based stats.
 Identities = 15/279 (5%), Positives = 41/279 (14%), Gaps = 6/279 (2%)

Query: 101 RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
               +       K+                   +     + +      +   +  +  S 
Sbjct: 180 SDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSI 239

Query: 161 VAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
            +           G    I                        +  + +      K  + 
Sbjct: 240 SSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLP 299

Query: 221 LIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGS 278
                 +           +          +          K +                +
Sbjct: 300 SPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTT 359

Query: 279 EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFIN 334
           +    P          T +    +   G +      G  +     P       +      
Sbjct: 360 KPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPK 419

Query: 335 KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
               Q  + S        +   Q      I         
Sbjct: 420 PLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 36.5 bits (82), Expect = 9.9,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|10048483|ref|NP_064483.1| protein piccolo isoform 1 [Rattus norvegicus]
 gi|24212076|sp|Q9JKS6|PCLO_RAT RecName: Full=Protein piccolo; AltName: Full=Aczonin; AltName:
           Full=Multidomain presynaptic cytomatrix protein
 gi|7528227|gb|AAF63196.1| multidomain presynaptic cytomatrix protein Piccolo [Rattus
           norvegicus]
          Length = 5085

 Score = 78.5 bits (191), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/354 (6%), Positives = 53/354 (14%), Gaps = 12/354 (3%)

Query: 42  KPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLR 101
                +E   ++   +++   + E   +  L                   +       + 
Sbjct: 177 DSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEVIQQDSSPKSVS 236

Query: 102 SISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPV 161
           S  +     +                    SP     +       +V       S   P 
Sbjct: 237 SQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQPGPAKSPAQPA 296

Query: 162 AAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT----------RGLLSFYSALSE 211
              +       +          T S                       +           
Sbjct: 297 GTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVKSPAQQPGTAKH 356

Query: 212 HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                       + G     +   G  K         +      +  K          T+
Sbjct: 357 PAQQPGPQTAAKVPGPTKTPAQQSGPGKTPAQQPGPTKPSPQQPIPAKPQPQQPVATKTQ 416

Query: 272 RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRV 331
                 ++                +    +                   +  P       
Sbjct: 417 PQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQPPTATKPQPQPPTATKPH 476

Query: 332 FINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNA 385
               G  + S        S                         S ++   CN 
Sbjct: 477 HQQPGLAKPSAQQPTKSISQTVTGRPLQPPP--TSAAQTPAQGLSKTICPLCNT 528



 Score = 71.6 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/344 (6%), Positives = 63/344 (18%), Gaps = 7/344 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
           + + ++ E    Q   Q ++             P      K+   ++  ++  SS    +
Sbjct: 177 DSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEVIQQDSSPKSVS 236

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
             +         G  + +     +  + +       +        +   P  A    +  
Sbjct: 237 SQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQPGPAKSPAQPA 296

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
                 A   +   G            +        +                  G A  
Sbjct: 297 GTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVKSPAQQPGTAKH 356

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
            +   G    +       ++    +   K       P          ++           
Sbjct: 357 PAQQPGPQTAAKV-PGPTKTPAQQSGPGKTPAQQPGPTKPSPQQPIPAKPQPQQPVATKT 415

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
               ++    +                   +  P              +           
Sbjct: 416 QPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQPPTATKPQPQPPTATKP 475

Query: 351 LQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHV 394
             Q+                   + S ++T +       S    
Sbjct: 476 HHQQPGLAKPS------AQQPTKSISQTVTGRPLQPPPTSAAQT 513



 Score = 53.9 bits (127), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/334 (7%), Positives = 63/334 (18%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
            +        P++ +  +    +    + + Q         Q      P+    +     
Sbjct: 387 AQQPGPTKPSPQQPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQ 446

Query: 96  LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
            +P   +          K      +          L+  +     + I         +  
Sbjct: 447 PQPPTPAKPQPQPPTATKPQPQPPTATKPHHQQPGLAKPSAQQPTKSISQTVTGRPLQPP 506

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
            + +     +     +                           T   L  ++        
Sbjct: 507 PTSAAQTPAQGLSKTICPLCNTTELLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEI 566

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
           K ++ L   +  A+G   +               +                PK      +
Sbjct: 567 KEWLCLNCQMQRALGGDLAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQ 626

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
           D  +                                 + G          + E       
Sbjct: 627 DSPKALESKKPPEPKKPPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAP 686

Query: 336 GRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
            +  S  L  +    +   + +  K    + DI 
Sbjct: 687 PKEPSGPLPEQAKAPVGDVEPKQPKMTETRADIQ 720



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/304 (8%), Positives = 58/304 (19%)

Query: 28  EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
           +        +        P++    +    + A  + + Q         Q      P+  
Sbjct: 399 QPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQ 458

Query: 88  VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
             +      +P   +     +    K  A   +                +   +      
Sbjct: 459 PPTATKPQPQPPTATKPHHQQPGLAKPSAQQPTKSISQTVTGRPLQPPPTSAAQTPAQGL 518

Query: 148 VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
             T     ++   +  I    +     +         G                      
Sbjct: 519 SKTICPLCNTTELLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQR 578

Query: 208 ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
           AL                  A   + +  KS         ++         K + S   P
Sbjct: 579 ALGGDLAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQDSPKALESKKPP 638

Query: 268 KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
           +  +            P  +      +    A    +   E        KE     P   
Sbjct: 639 EPKKPPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAPPKEPSGPLPEQA 698

Query: 328 EGRV 331
           +  V
Sbjct: 699 KAPV 702



 Score = 45.8 bits (106), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/349 (6%), Positives = 64/349 (18%), Gaps = 9/349 (2%)

Query: 22   RRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKES 81
                + E A           + + P   +E +  K+ +    ++  +           +S
Sbjct: 677  VAEALPEPAPPKEPSGPLPEQAKAPVGDVEPKQPKMTETRADIQSSSTTKPDILSSQVQS 736

Query: 82   DIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLR 141
                 + +  +    +P      +  ++      A           +             
Sbjct: 737  QAQVKTASPLKTDSAKPSQSFPPTGEKTTPLDSKAMPRPASDSKIISQPGPGSESKDPKH 796

Query: 142  EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR- 200
                   +   +     SP    +               +                  R 
Sbjct: 797  IDPIQKKDEPKKAQPKGSPKPETKPVPKGSPTPSGTRPTAGQAAPPSQQPPKPQEQSRRF 856

Query: 201  --------GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                              +  +          +        S    +G            
Sbjct: 857  SLNLGGITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQQGPHPQTGPAAPSK 916

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                  ++  +    K T +L    ++          A   N  +   +           
Sbjct: 917  QAPTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLESKPEQAPTAKKTEKDK 976

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                 ++ +  P   E  V  +K    +       L   +         
Sbjct: 977  KPPPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLGSQEPP 1025



 Score = 44.6 bits (103), Expect = 0.034,   Method: Composition-based stats.
 Identities = 21/313 (6%), Positives = 68/313 (21%), Gaps = 2/313 (0%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES--DIPKSSVTSKENIFLEPRLRSISSILR 108
           E +  ++   + + +   + S+  +  +  S     +   +       +P      +   
Sbjct: 46  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSQAPQQPGKPPDPGRPTQPG 105

Query: 109 SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
            +K +      S Q     + +      S    +      ++      S     +     
Sbjct: 106 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDFKEEYKSSMMPGFFSDVNPLSAVSSV 165

Query: 169 SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
                       S  +             +            +    K        +   
Sbjct: 166 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEV 225

Query: 229 IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
           I    S           ++ ++   G   +++       + +              +   
Sbjct: 226 IQQDSSPKSVSSQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQ 285

Query: 289 VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                + +  A          +     +  +E+ +     G   + +  G      G + 
Sbjct: 286 PGPAKSPAQPAGTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVK 345

Query: 349 WSLQQEKSQGLKG 361
              QQ  +     
Sbjct: 346 SPAQQPGTAKHPA 358



 Score = 41.5 bits (95), Expect = 0.30,   Method: Composition-based stats.
 Identities = 26/351 (7%), Positives = 74/351 (21%), Gaps = 14/351 (3%)

Query: 17   ENTPERRSHIYEHARNSV-ARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
               P +++     +  +    +     P  P +    +      A   +E + +++    
Sbjct: 911  PAAPSKQAPTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLESKPEQAPTAK 970

Query: 76   KQDKESDIPKSS-VTSKENIFLEPRLRSISSILRSNKHKKL------------ANILSVQ 122
            K +K+   P +       +   +             K                    +  
Sbjct: 971  KTEKDKKPPPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLGSQEPPNFNTC 1030

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
             + +                 +   +    +   ++S              G  A     
Sbjct: 1031 TECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMGKMPPAPSGPKASPMPA 1090

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            P              K +   +     +E  + +     I      +     + +S+G  
Sbjct: 1091 PAEPSSQKTPTGTQVKGKKKEAEGKTEAEKPVPEKETASIEKTPPMVTTDQKLEESEGKK 1150

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
            +             +K         K          E    P    +   A   +   + 
Sbjct: 1151 SKVSALPEKKPSEEEKAISADKKERKPPAEEKPPLEEKKPIPVDKKLPPEAKPLSSEGEE 1210

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                 +    +  ++   +     GE     +         +   L    +
Sbjct: 1211 KHEILKAHVQIPEEEPTGKVAAKAGEEEQQPDSRPEALPGATPLTLPKAGE 1261



 Score = 39.6 bits (90), Expect = 1.2,   Method: Composition-based stats.
 Identities = 39/359 (10%), Positives = 78/359 (21%), Gaps = 5/359 (1%)

Query: 8   IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
           +  A+ + P+ TP+  +     A  S     ++   + P    +     LE       K+
Sbjct: 584 LAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQDSP-KALESKKPPEPKK 642

Query: 68  NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +     +  K   + K            P+L    ++      K+ +  L  Q K+  
Sbjct: 643 PPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAPPKEPSGPLPEQAKAPV 702

Query: 128 NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                 +      R  +  S  T+ +  SS     A     S L+        SFP    
Sbjct: 703 GDVEPKQPKMTETRADIQSSSTTKPDILSSQVQSQAQVKTASPLKTDSAKPSQSFPPTGE 762

Query: 188 FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV---FLIILLGMAIGVSYSIGKSKGSITH 244
             +  +          S   +                I                  +   
Sbjct: 763 KTTPLDSKAMPRPASDSKIISQPGPGSESKDPKHIDPIQKKDEPKKAQPKGSPKPETKPV 822

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
                +  G            +     +       +++G  T        T        +
Sbjct: 823 PKGSPTPSGTRPTAGQAAPPSQQPPKPQEQSRRFSLNLGGITDAPKSQPTTPQETVTGKL 882

Query: 305 GGDENST-FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
            G   S            G              +   +           +   Q     
Sbjct: 883 FGFGASIFSQASNLISTAGQQGPHPQTGPAAPSKQAPTPSQSPAAQGPAKSTGQLPPAP 941


>gi|150170670|ref|NP_055325.2| protein piccolo isoform 2 [Homo sapiens]
          Length = 4935

 Score = 78.5 bits (191), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/321 (6%), Positives = 54/321 (16%), Gaps = 5/321 (1%)

Query: 16  PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
           P  TP+         R++   + +       + +     +  +  I Q       +    
Sbjct: 261 PTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPG 320

Query: 76  KQDKESDIPKSSVTS-----KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +  +    K                      +     +    +         +   +  
Sbjct: 321 HEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPLGPAKPPAQQTGSEK 380

Query: 131 LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            S +    +          T  +      P          L +       +   G     
Sbjct: 381 PSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPLAQQPGLQSPAKAPGPTKTP 440

Query: 191 VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
           V      K     +     S            +                        +  
Sbjct: 441 VQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPP 500

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  K         K + +           P +   +    +             + 
Sbjct: 501 SQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQ 560

Query: 311 TFVLGKKEIEEGNPLIGEGRV 331
           T      +    +P   +   
Sbjct: 561 TGSGKPLQPPTVSPSAKQPPS 581



 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/361 (6%), Positives = 62/361 (17%), Gaps = 7/361 (1%)

Query: 29  HARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSV 88
            + +S        +P    + ++      +    ++     +   +  Q K++DI +   
Sbjct: 237 KSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKL---PLQRDASRPQTKQADIVRGES 293

Query: 89  TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSV 148
                           +  +    +                         +    +   V
Sbjct: 294 VKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPV 353

Query: 149 NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSA 208
                      P+   +    +    K +     P              +  G     + 
Sbjct: 354 QPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQ 413

Query: 209 LSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPK 268
                        +     A G + +  +  G      ++      +  +          
Sbjct: 414 QVGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQL 473

Query: 269 ITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE 328
                          P           S           +        ++     P   +
Sbjct: 474 PGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQ 533

Query: 329 ----GRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCN 384
                         + S        S            V              ++   CN
Sbjct: 534 PGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCN 593

Query: 385 A 385
            
Sbjct: 594 T 594



 Score = 66.6 bits (160), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/289 (6%), Positives = 44/289 (15%), Gaps = 6/289 (2%)

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
           + +   S  P+   +         +  + +      K     +    Q K          
Sbjct: 235 TPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESV 294

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
             S            T  +  +        +   ++                        
Sbjct: 295 KPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQ 354

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
               T+                              ++   G  K         +     
Sbjct: 355 PPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQ 414

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
               K +      +   +           P    +               G  +  + + 
Sbjct: 415 VGTPKPLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLP 474

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
           G  +     P   +            S   G               G  
Sbjct: 475 GPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTK------PPPQQPGPA 517



 Score = 56.2 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/306 (5%), Positives = 48/306 (15%), Gaps = 4/306 (1%)

Query: 62  LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            +  ++         Q ++           +    +P  +         +       +S 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSISS 241

Query: 122 QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
           Q   +  +         +       + + +       S     + D  R    K +    
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPSP 301

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                   +       +     S                 +      +        +   
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKP 361

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               L            +   S               +                      
Sbjct: 362 PAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKPL 421

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIG----EGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
               G ++     G  +     P  G    +          Q+             +   
Sbjct: 422 AQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPP 481

Query: 358 GLKGLV 363
              G  
Sbjct: 482 QQPGPA 487



 Score = 51.9 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/324 (6%), Positives = 69/324 (21%), Gaps = 1/324 (0%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
             +     P     + + A                 +   +Q   ++     V   +  + 
Sbjct: 716  PSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLVSSSSATTK 775

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                  K     +   T           +S               I      S+  ++  
Sbjct: 776  PDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRPASDSKIISHPG 835

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
            P + S   +++       + +   +            +          +           
Sbjct: 836  PSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQS 895

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                 ++R       ++++    +       + G   G   SI     ++     +    
Sbjct: 896  PKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPH 955

Query: 253  GGNVDKKNV-FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              +     +  +    +         S     P+          +       +       
Sbjct: 956  SQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQA 1015

Query: 312  FVLGKKEIEEGNPLIGEGRVFINK 335
              + + E E+  P I + +    +
Sbjct: 1016 PTVKRTETEKKPPPIKDSKSLTAE 1039



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/359 (8%), Positives = 71/359 (19%), Gaps = 1/359 (0%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 643  KRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 701

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E   L          + S + K        +      
Sbjct: 702  KPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVK 761

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                  + S    +    S   Q + +   +P    +  K            S       
Sbjct: 762  PTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAI 821

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +     +    S  S   +                 +                   
Sbjct: 822  PRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGP 881

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                G  V         + +  R  L  GS  D   S         T  +         +
Sbjct: 882  RPTAGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQ 941

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGD 367
             S  +    +    +       +       Q     G    + Q   +      V K  
Sbjct: 942  ASNLISTAGQPGPHSQSGPGAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKET 1000



 Score = 45.4 bits (105), Expect = 0.024,   Method: Composition-based stats.
 Identities = 34/349 (9%), Positives = 77/349 (22%), Gaps = 1/349 (0%)

Query: 31  RNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ-NQKSLHTSKQDKESDIPKSSVT 89
                 +L       P++    +    +    +   Q    +    +Q   +        
Sbjct: 466 PTKPPSQLPGPAKPPPQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPG 525

Query: 90  SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
           S +    +P     S+   S              ++ +   L P   S   ++  S  + 
Sbjct: 526 STKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLP 585

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
                  + + +     +K+                    + H     +   L       
Sbjct: 586 KTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRA 645

Query: 210 SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
               L          L  A   + S              +       D        +P  
Sbjct: 646 LGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPP 705

Query: 270 TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             +               P AD  +      +  +  +++   V   K  +         
Sbjct: 706 LVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTD 765

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSAS 378
            V  +    +  I S K+    +++ +  LK    K            S
Sbjct: 766 LVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVS 814



 Score = 40.4 bits (92), Expect = 0.67,   Method: Composition-based stats.
 Identities = 15/279 (5%), Positives = 41/279 (14%), Gaps = 6/279 (2%)

Query: 101 RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
               +       K+                   +     + +      +   +  +  S 
Sbjct: 180 SDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSI 239

Query: 161 VAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
            +           G    I                        +  + +      K  + 
Sbjct: 240 SSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLP 299

Query: 221 LIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGS 278
                 +           +          +          K +                +
Sbjct: 300 SPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTT 359

Query: 279 EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNP----LIGEGRVFIN 334
           +    P          T +    +   G +      G  +     P       +      
Sbjct: 360 KPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPK 419

Query: 335 KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
               Q  + S        +   Q      I         
Sbjct: 420 PLAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGK 458



 Score = 36.5 bits (82), Expect = 9.9,   Method: Composition-based stats.
 Identities = 27/320 (8%), Positives = 72/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L        L+E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G++                      
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   SI   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPLGPA 369


>gi|268561066|ref|XP_002646356.1| Hypothetical protein CBG12070 [Caenorhabditis briggsae]
 gi|187029900|emb|CAP31110.1| CBR-UNC-89 protein [Caenorhabditis briggsae AF16]
          Length = 6561

 Score = 78.1 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/357 (8%), Positives = 86/357 (24%), Gaps = 19/357 (5%)

Query: 17   ENTPERRSHIYE---------HARNSVARRLESMKPRLPKEILERQFNKLEQAILQV--- 64
            E TPE+     +             +V  +  + K + P++         E+A+      
Sbjct: 1394 EKTPEKVEEKPKSPTKKEKSPEKSTTVEVKSPTKKEKSPEKPTSPTKKNAEEAVKSPTKK 1453

Query: 65   EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
            EK  +KS    K   + +         ++   + +     +I+  +    +    +    
Sbjct: 1454 EKSPEKSEEKVKSPTKKEKSPVRSEEVKSPTKKEKSPEAKNIVEVSSETTIKKTEATAEV 1513

Query: 125  SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH--DKSRLRRGKLAGIFSF 182
            ++T+          +    +     +  + + S     +     +               
Sbjct: 1514 TKTSEEAKSPTMKEKSPGKVEEKPKSPTKKEKSPEKPTSPTKKTEDQPGSPFPPKSPTKI 1573

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
                   +         +   S                    +      S +        
Sbjct: 1574 EEKPSSPTQKKSPPASPKKAKSPEKFEEAVKSPTKKEKSPEKMADEKPTSPTQKDKPPEQ 1633

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI-PVADFANTSNIAFK 301
                           +K+    ++  I +    + S  +   S           ++   K
Sbjct: 1634 VEKKPTSQTKKEKSPEKSTTEEVKTPIKKEKSPEKSATEEVKSPTKKEKSPEKPTSPTKK 1693

Query: 302  NYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQG 358
                  ++ T      E  E  P          +   + S  +  +   +++E+S  
Sbjct: 1694 TAEEAVKSPTKKEKSPEKIEEKP----KSPTKEEKSPEKSTGAEDVKSPIKKERSPD 1746



 Score = 51.9 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/313 (8%), Positives = 62/313 (19%), Gaps = 38/313 (12%)

Query: 61   ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
            + ++E  ++    T  ++       S    +    +    R         K  K   + S
Sbjct: 1324 VSKIEVVSKTESQTDVREGTPKRRVSFAEEEPPKEVIDPERKKKKSPTPEKKGKSPEMTS 1383

Query: 121  VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
             +      T            +  +         + S      +E      +        
Sbjct: 1384 DEKPKSPTTEEKTPEKVEEKPKSPTKK-------EKSPEKSTTVEVKSPTKKEKSPEKPT 1436

Query: 181  SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
            S    +   +V +    +     S     S     K  V    +            K+  
Sbjct: 1437 SPTKKNAEEAVKSPTKKEKSPEKSEEKVKSPTKKEKSPVRSEEVKSPTKKEKSPEAKNIV 1496

Query: 241  SITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
             ++     +  +      K       P +  +      E    P+    +    TS    
Sbjct: 1497 EVSSETTIKKTEATAEVTKTSEEAKSPTMKEKSPGKVEEKPKSPTKKEKSPEKPTSPTKK 1556

Query: 301  KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
                 G         K E +  +P                               +Q   
Sbjct: 1557 TEDQPGSPFPPKSPTKIEEKPSSP-------------------------------TQKKS 1585

Query: 361  GLVIKGDIPMIDN 373
                       + 
Sbjct: 1586 PPASPKKAKSPEK 1598


>gi|322375909|ref|ZP_08050420.1| TolA domain protein [Streptococcus sp. C300]
 gi|321279177|gb|EFX56219.1| TolA domain protein [Streptococcus sp. C300]
          Length = 558

 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/316 (5%), Positives = 58/316 (18%)

Query: 8   IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
           + +A++         +    +    +        + +  + + +     LEQ       Q
Sbjct: 76  LAKAIEKKVAELGSNKEAKKQLLAIADQAIAAIQEAKTQEAVNKALETALEQISKLEAAQ 135

Query: 68  NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
            +K        +     +    ++     +P   +        +    +   +   K   
Sbjct: 136 PEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQ 195

Query: 128 NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
               +      +  +        Q E  +        E      +  +        T + 
Sbjct: 196 PETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQ 255

Query: 188 FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                           +     ++                A   + +  ++         
Sbjct: 256 PEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAE 315

Query: 248 RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
            E         +        K  +       E    P      +         +      
Sbjct: 316 PEKPAQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQ 375

Query: 308 ENSTFVLGKKEIEEGN 323
                   K       
Sbjct: 376 PEKPAQPEKPITSSSP 391



 Score = 72.0 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/381 (7%), Positives = 83/381 (21%), Gaps = 3/381 (0%)

Query: 15  LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
                PE+ +   + A+     + E+          E+     +    +   Q +K    
Sbjct: 149 EKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQPETPTQPEKPAQP 208

Query: 75  SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
            K  +     +    ++    ++P            +        +   +          
Sbjct: 209 EKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQP 268

Query: 135 NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
               +  +        Q E  +     A  E         +          +        
Sbjct: 269 EKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQP 328

Query: 195 FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                    +     ++                A     +  +         + E     
Sbjct: 329 ETPAQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKPITS 388

Query: 255 NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
           +  ++ V   +    +  ++             P  D      ++        E      
Sbjct: 389 SSPEEGVKDLVFTLPSLEIVNKVVPFKTIRRENPQLDKGKEQVLSEGKDGLLVEYVEVDG 448

Query: 315 GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ---EKSQGLKGLVIKGDIPMI 371
             +++ +      + RV     +  S       + +L +    +        +  +    
Sbjct: 449 DNRKVLQTEATPAQDRVIEVGSKQSSVGTEAPPVVTLPEYVLPRETEKPAPAVTDNSSSK 508

Query: 372 DNAFSASMTLKCNADISLSIT 392
           D     + T+K + +  L  T
Sbjct: 509 DEKAPVTATVKEDKERLLPAT 529


>gi|123475902|ref|XP_001321126.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121903946|gb|EAY08903.1| hypothetical protein TVAG_464510 [Trichomonas vaginalis G3]
          Length = 5901

 Score = 77.7 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/312 (5%), Positives = 59/312 (18%), Gaps = 12/312 (3%)

Query: 35   ARRLESMKPRLPKEILERQFNKLEQAILQ------VEKQNQKSLHTSKQDKESDIPK--- 85
             ++       + K + +     ++ A+        VE         S +      P    
Sbjct: 5259 EQKFGEETTHIKKALSDMIEQVVDTAVASFGVGQIVESIEPIQPIVSSKSAPVKPPPVKQ 5318

Query: 86   --SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
               +    + +       +     +     +   I + +     N      + +      
Sbjct: 5319 TQPTKYIPKRLPPTTASATPQQQTKQEPEPQQHKIQTKKSPLDNNFPSLTPSQTRSTPIQ 5378

Query: 144  LSFSVNTQHEYDSSVSPVAA-IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGL 202
                          VS           +         F+ P+             +    
Sbjct: 5379 PWLKQPINQVPQPPVSQQKFVEPQPAFKASPPPQTQSFAAPSLPPQKQPSPPPEPQPSFQ 5438

Query: 203  LSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
             +      +                             + T           +   +   
Sbjct: 5439 QTPPPQPPKLDAPSTPPPQTQTFSAPPQTQAFNAPPPQTQTFNAPPPQKQTFDSPPQAQQ 5498

Query: 263  SGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEG 322
              + P   ++ +   S+  +       +       +    +      S+       ++E 
Sbjct: 5499 KFVEPAPKKQQINTPSQPPMQKQAFIDSPPGFEGPLEEPKFSKTSPTSSVQPFPSPLQEQ 5558

Query: 323  NPLIGEGRVFIN 334
             P+         
Sbjct: 5559 QPVQLFQSPLQE 5570



 Score = 67.0 bits (161), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/275 (7%), Positives = 69/275 (25%), Gaps = 12/275 (4%)

Query: 28   EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
            E  +  V+ +   +KP        +Q    +    ++      +    +  +E +  +  
Sbjct: 5298 EPIQPIVSSKSAPVKPPP-----VKQTQPTKYIPKRLPPTTASATPQQQTKQEPEPQQHK 5352

Query: 88   VTSKENI-----FLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLRE 142
            + +K++            ++ S+ ++    + +  +       +      P   +    +
Sbjct: 5353 IQTKKSPLDNNFPSLTPSQTRSTPIQPWLKQPINQVPQPPVSQQKFVEPQPAFKASPPPQ 5412

Query: 143  ILSFSVN--TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR 200
              SF+       +  S               +  KL    + P  +  +S          
Sbjct: 5413 TQSFAAPSLPPQKQPSPPPEPQPSFQQTPPPQPPKLDAPSTPPPQTQTFSAPPQTQAFNA 5472

Query: 201  GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKN 260
                  +  +     + F          +  +    +        +++++        + 
Sbjct: 5473 PPPQTQTFNAPPPQKQTFDSPPQAQQKFVEPAPKKQQINTPSQPPMQKQAFIDSPPGFEG 5532

Query: 261  VFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
                 +   T                 PV  F + 
Sbjct: 5533 PLEEPKFSKTSPTSSVQPFPSPLQEQQPVQLFQSP 5567



 Score = 65.8 bits (158), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/310 (10%), Positives = 66/310 (21%), Gaps = 13/310 (4%)

Query: 48   EILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSIL 107
            E        L   I QV      S    +  +  +  +  V+SK      P ++      
Sbjct: 5264 EETTHIKKALSDMIEQVVDTAVASFGVGQIVESIEPIQPIVSSKSAPVKPPPVKQTQPTK 5323

Query: 108  RSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHD 167
               K        +   +         ++     +  L  +  +       ++P       
Sbjct: 5324 YIPKRLPPTTASATPQQQTKQEPEPQQHKIQTKKSPLDNNFPS-------LTPSQTRSTP 5376

Query: 168  KSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGM 227
                 +  +  +   P     +      F  +    +   A     L             
Sbjct: 5377 IQPWLKQPINQVPQPPVSQQKFVEPQPAFKASPPPQTQSFA--APSLPPQKQPSPPPEPQ 5434

Query: 228  AIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI 287
                     +                 +   +       P  T+      +       T 
Sbjct: 5435 PSFQQTPPPQPPKLDAPSTPPPQTQTFSAPPQTQAFNAPPPQTQ----TFNAPPPQKQTF 5490

Query: 288  PVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKI 347
                 A    +            +    +K+    +P   EG +   K    S   S + 
Sbjct: 5491 DSPPQAQQKFVEPAPKKQQINTPSQPPMQKQAFIDSPPGFEGPLEEPKFSKTSPTSSVQP 5550

Query: 348  LWSLQQEKSQ 357
              S  QE+  
Sbjct: 5551 FPSPLQEQQP 5560



 Score = 65.0 bits (156), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/259 (6%), Positives = 55/259 (21%), Gaps = 14/259 (5%)

Query: 121  VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
               +   ++  +P       +   +  +  +    ++ +        +   ++ K+    
Sbjct: 5298 EPIQPIVSSKSAPVKPPPVKQTQPTKYIPKRLPPTTASATPQQQTKQEPEPQQHKIQTKK 5357

Query: 181  SF-----PTGSIFWSVHNYFFNK--------TRGLLSFYSALSEHHLFKYFVFLIILLGM 227
            S      P+ +   +                 +  +S    +     FK           
Sbjct: 5358 SPLDNNFPSLTPSQTRSTPIQPWLKQPINQVPQPPVSQQKFVEPQPAFKASPPPQTQSFA 5417

Query: 228  AIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI 287
            A  +      S         +++            +      T          +  P   
Sbjct: 5418 APSLPPQKQPSPPPEPQPSFQQTPPPQPPKLDAPSTPPPQTQTFSAPPQTQAFNAPPPQT 5477

Query: 288  PVADFANTSNIA-FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGK 346
               +                 +       K++I   +    + + FI+   G    L   
Sbjct: 5478 QTFNAPPPQKQTFDSPPQAQQKFVEPAPKKQQINTPSQPPMQKQAFIDSPPGFEGPLEEP 5537

Query: 347  ILWSLQQEKSQGLKGLVIK 365
                     S       ++
Sbjct: 5538 KFSKTSPTSSVQPFPSPLQ 5556



 Score = 40.0 bits (91), Expect = 0.93,   Method: Composition-based stats.
 Identities = 18/218 (8%), Positives = 41/218 (18%), Gaps = 34/218 (15%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKE---------ILERQFNKLEQAILQVEKQNQK 70
            PE + H  +  ++ +     S+ P   +           + +           VE Q   
Sbjct: 5346 PEPQQHKIQTKKSPLDNNFPSLTPSQTRSTPIQPWLKQPINQVPQPPVSQQKFVEPQPAF 5405

Query: 71   SLHTSKQDKESDIPK------------------------SSVTSKENIFLEPRLRSISSI 106
                  Q +    P                                +    P+ ++ S+ 
Sbjct: 5406 KASPPPQTQSFAAPSLPPQKQPSPPPEPQPSFQQTPPPQPPKLDAPSTPP-PQTQTFSAP 5464

Query: 107  LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
             ++                             + + +       Q    S          
Sbjct: 5465 PQTQAFNAPPPQTQTFNAPPPQKQTFDSPPQAQQKFVEPAPKKQQINTPSQPPMQKQAFI 5524

Query: 167  DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLS 204
            D      G L       T             + +  + 
Sbjct: 5525 DSPPGFEGPLEEPKFSKTSPTSSVQPFPSPLQEQQPVQ 5562


>gi|157151439|ref|YP_001449530.1| streptococcal surface protein A [Streptococcus gordonii str. Challis
            substr. CH1]
 gi|157076233|gb|ABV10916.1| streptococcal surface protein A [Streptococcus gordonii str. Challis
            substr. CH1]
          Length = 1575

 Score = 77.4 bits (188), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 37/269 (13%), Positives = 80/269 (29%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA--ILQVEKQNQK 70
            +      P   +  YE+      +  +  +P  P+E        LE A  +   E +   
Sbjct: 844  EVEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVVPTYENEPTP 903

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   +  +              S   +   +  
Sbjct: 904  PVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYDPL 963

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 964  PTPPVAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 1023

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 1024 LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1082

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1083 LATYNADLTKPVETLHPTVVGRVLNDGAT 1111



 Score = 51.9 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/161 (6%), Positives = 29/161 (18%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
            +  K K    +   + ++ T     P   +       +         D           
Sbjct: 822 PKITKEKPTPPVAPTEPQAPTYEVEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPT 881

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
            ++         + ++                ++     Y                    
Sbjct: 882 YETEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPT 941

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
             +        SK     +    +       K+     + P
Sbjct: 942 PPVKTPDQPEPSKPEEPTYDPLPTPPVAPTPKQLPTPPVVP 982


>gi|46205078|ref|ZP_00049064.2| hypothetical protein Magn03002378 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 303

 Score = 77.4 bits (188), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/220 (10%), Positives = 67/220 (30%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M D+  ++ RA+D LP+ +P  R  +Y+ AR+++  +L S+ P +P+  ++ +   L+ A
Sbjct: 1   MADYYPLLARALDALPDRSPALRRAVYDRARSALIAQLRSLDPPVPEADIDLERQALDTA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I ++E + + +  + + +       S   ++           +   L   +  +  +   
Sbjct: 61  IQRLETEYEPATASKEPEVAPPQIPSPAPAEPLRPEPLVPEPLPPTLPEPEPPQAVDKPP 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
              +       +                      ++    +  +   +            
Sbjct: 121 QAAEEPHRAATASPVLPPASVPAGFLPDAPPANAETPAETLPFMPPPRRPRLDEAPKSET 180

Query: 181 SFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
                           ++  G     +      +      
Sbjct: 181 PDGAVPSAEPPAEGAASEANGHGEAVNGRQRPRIDVVTPT 220


>gi|190608798|gb|ACE79730.1| coiled-coil Y protein [Drosophila virilis]
          Length = 1540

 Score = 77.4 bits (188), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/331 (6%), Positives = 61/331 (18%), Gaps = 11/331 (3%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P   P+  +     A+    +   + +P    +           A   V+ Q+  
Sbjct: 828  AAAAQPGAEPQDAAATQPGAKP---QDTAAAQPGAKPQDTA-------AAQPGVKPQDTA 877

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +     + +++   +     ++    +P  +   +       K      +  G    +  
Sbjct: 878  AAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDAA 937

Query: 131  LSPKNFSCRLREILSFS-VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
             +      +                    +        +   +    A +          
Sbjct: 938  AAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAVQPGAKPQDTA 997

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
            +       +  G     +   +    +             G       +           
Sbjct: 998  AAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAASKPGAKPQDTA 1057

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
            +   G   +         K               P          T     +      + 
Sbjct: 1058 AAQPGAKPQDTTAGQPGSKPQDTTAGKPGAKPGAPQVEKPGGAGETGGKPAQPSDASGDK 1117

Query: 310  STFVLGKKEIEEGNPLIGEGRVFINKGRGQS 340
            +       +     P             G+ 
Sbjct: 1118 AGAPGQTGDKPGDKPPAAGKPGDKPPTAGKP 1148



 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/350 (7%), Positives = 57/350 (16%), Gaps = 6/350 (1%)

Query: 12   VDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKS 71
            +   P   P+ ++     A+   A   +           +      + A  Q   + Q +
Sbjct: 805  IIGQPGEEPQDKTSGQPGAKPQDAAAAQPGAEPQDAAATQPGAKPQDTAAAQPGAKPQDT 864

Query: 72   LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
                   K  D   +   +K          +     +             Q  +      
Sbjct: 865  AAAQPGVKPQDTAAAQPGAKPQD-----TAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGA 919

Query: 132  SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
             P++ +                        AA    K +       G     T +     
Sbjct: 920  KPQDTAAAQPGAKPQDAAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGA 979

Query: 192  HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                    +         +     K         G     + +             +   
Sbjct: 980  KPQDTAAVQPGAKPQDTAAAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQDTAAAQPGA 1039

Query: 252  DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
               +       +  +     +      +   G       D         K      E   
Sbjct: 1040 KPQDTAASKPGAKPQDTAAAQPGAKPQDTTAGQPGSKPQDTTAG-KPGAKPGAPQVEKPG 1098

Query: 312  FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                              +       G               +     K 
Sbjct: 1099 GAGETGGKPAQPSDASGDKAGAPGQTGDKPGDKPPAAGKPGDKPPTAGKP 1148



 Score = 70.8 bits (171), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/359 (7%), Positives = 70/359 (19%), Gaps = 13/359 (3%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                 P   P+          ++ A +  +            +      A    + Q+  
Sbjct: 864  TAAAQPGVKPQ----------DTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTA 913

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +     + +++   +     ++    +P  +   +       K      +  G    +T 
Sbjct: 914  AAQPGAKPQDTAAAQPGAKPQDAAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTA 973

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +         +  +         D++ +   A   D    + G      +         
Sbjct: 974  AAQPG---AKPQDTAAVQPGAKPQDTAAAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQ 1030

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                     +   +  S                                 +      +  
Sbjct: 1031 DTAAAQPGAKPQDTAASKPGAKPQDTAAAQPGAKPQDTTAGQPGSKPQDTTAGKPGAKPG 1090

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                        +G +P        D +         P            K    G    
Sbjct: 1091 APQVEKPGGAGETGGKPAQPSDASGDKAGAPGQTGDKPGDKPPAAGKPGDKPPTAGKPGD 1150

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
                   +    +    E         G     + +   + + +  Q   G   K  +P
Sbjct: 1151 KSGAASAQPAAASADKAEAAGKAGPKPGDKPGKAAQPTSADEDKTGQIDAGPGDKAGVP 1209



 Score = 69.3 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/356 (8%), Positives = 70/356 (19%), Gaps = 7/356 (1%)

Query: 11   AVDNLPENTPERRSHIYEHAR--NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
                 P   P+  +     A+  ++ A +  +            +      A    + Q+
Sbjct: 876  TAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQD 935

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEP-----RLRSISSILRSNKHKKLANILSVQG 123
              +     + +++   +     ++    +P        +     +      +      Q 
Sbjct: 936  AAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAVQPGAKPQD 995

Query: 124  KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
             +       P++                          AA    K +       G     
Sbjct: 996  TAAAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAASKPGAKPQD 1055

Query: 184  TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
            T +             +         +     K     +   G A        +   +  
Sbjct: 1056 TAAAQPGAKPQDTTAGQPGSKPQDTTAGKPGAKPGAPQVEKPGGAGETGGKPAQPSDASG 1115

Query: 244  HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                     G     K   +G          + G +     +    A             
Sbjct: 1116 DKAGAPGQTGDKPGDKPPAAGKPGDKPPTAGKPGDKSGAASAQPAAASADKAEAAGKAGP 1175

Query: 304  IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
              GD+           E+    I  G        GQ     G        + S   
Sbjct: 1176 KPGDKPGKAAQPTSADEDKTGQIDAGPGDKAGVPGQPDAGPGDKPGGAAGQPSDKP 1231



 Score = 65.0 bits (156), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/350 (6%), Positives = 62/350 (17%), Gaps = 30/350 (8%)

Query: 43   PRLPKEILERQFNK---------------------------LEQAILQVEKQNQKSLHTS 75
             +  K+ +E Q                               E A L+ E +  + + T 
Sbjct: 686  EKEAKQRIEEQRKAEEAEKAAEEAEKAAEEAKKAAEEVKKDAEDAKLKEEPKLIEKVMTP 745

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
                E  I K    +++                     + +++ +     +       + 
Sbjct: 746  TGMVERLIEKPEGVARQIPSERLEESRAKPGFGDTAEVQPSSMPTDTAADQPGARPQDRI 805

Query: 136  --FSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                    +  +         D++ +   A   D +  + G      +            
Sbjct: 806  IGQPGEEPQDKTSGQPGAKPQDAAAAQPGAEPQDAAATQPGAKPQDTAAAQPGAKPQDTA 865

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                  +   +  +                                 +      +     
Sbjct: 866  AAQPGVKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTA 925

Query: 254  GNVDKKNVFSGIRPKITRRLL-EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                          +   +      ++    P     A              G     T 
Sbjct: 926  AAQPGAKPQDAAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTA 985

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             +      +       G    + G  +          +    K Q     
Sbjct: 986  AVQPGAKPQDTAAAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQDTAAA 1035



 Score = 63.5 bits (152), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 31/359 (8%), Positives = 72/359 (20%), Gaps = 10/359 (2%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            A    P   P+  +     A+        +     P++    Q     Q    V+   + 
Sbjct: 936  AAAAQPGAKPQDTAAAQPGAKPQDTA--AAQPGAKPQDTAAAQPGAKPQDTAAVQPGAKP 993

Query: 71   ----SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSR 126
                +     + +++   K     ++    +P  +   +       K      S  G   
Sbjct: 994  QDTAAAQPGAKPQDTGASKPGAKPQDTAAAQPGAKPQDTAAAQPGAKPQDTAASKPGAKP 1053

Query: 127  TNTNLSPKNFSCRLREILSF-SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
             +T  +      +        S           +   A + +K                 
Sbjct: 1054 QDTAAAQPGAKPQDTTAGQPGSKPQDTTAGKPGAKPGAPQVEKPGGAGETGGKPAQPSDA 1113

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
            S   +          G     +                    +   + +      +    
Sbjct: 1114 SGDKAGAPGQTGDKPGDKPPAAGKPGDKPPTAGKPGDKSGAASAQPAAASADKAEAAGKA 1173

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP---VADFANTSNIAFKN 302
              +     G   +       +         D + V   P   P       A   +     
Sbjct: 1174 GPKPGDKPGKAAQPTSADEDKTGQIDAGPGDKAGVPGQPDAGPGDKPGGAAGQPSDKPGR 1233

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
              G     +   G+     G P    G       +  + +  G         +      
Sbjct: 1234 AGGPAGQLSDKPGRAGGPAGQPGATAGDKAGAGRQPGARVGGGPGAAEKTGGRPGDESS 1292



 Score = 63.5 bits (152), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/362 (7%), Positives = 69/362 (19%), Gaps = 6/362 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                 P   P+  +     A+      ++           +      +    +   + Q 
Sbjct: 960  TAAAQPGAKPQDTAAAQPGAKPQDTAAVQPGAKPQDTAAAQPGAKPQDTGASKPGAKPQD 1019

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
            +       K  D   +   +K       +  +      + +        +         +
Sbjct: 1020 TAAAQPGAKPQDTAAAQPGAKPQDTAASKPGAKPQDTAAAQPGAKPQDTTAGQPGSKPQD 1079

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +      +             E     +  +    DK+             P  +    
Sbjct: 1080 TTAGKPGAKPGAPQVEKPGGAGETGGKPAQPSDASGDKAGAPGQTGDKPGDKPPAAGKPG 1139

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG----VSYSIGKSKGSITHFL 246
                   K        SA                           +      +       
Sbjct: 1140 DKPPTAGKPGDKSGAASAQPAAASADKAEAAGKAGPKPGDKPGKAAQPTSADEDKTGQID 1199

Query: 247  RRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                   G   + +   G +P        D      GP+             A +     
Sbjct: 1200 AGPGDKAGVPGQPDAGPGDKPGGAAGQPSDKPGRAGGPAGQLSDKPGRAGGPAGQPGATA 1259

Query: 307  DENSTFVLGKKEIEEGNPLIGEGRV--FINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
             + +           G P   E       ++  GQ +  +G      +Q      +   +
Sbjct: 1260 GDKAGAGRQPGARVGGGPGAAEKTGGRPGDESSGQPAAKAGAAGGETRQGPKGLAQKPGL 1319

Query: 365  KG 366
            + 
Sbjct: 1320 RA 1321



 Score = 46.2 bits (107), Expect = 0.014,   Method: Composition-based stats.
 Identities = 18/323 (5%), Positives = 46/323 (14%), Gaps = 3/323 (0%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
                 P   P+  +     A+       +           +      +    Q   + Q 
Sbjct: 1020 TAAAQPGAKPQDTAAAQPGAKPQDTAASKPGAKPQDTAAAQPGAKPQDTTAGQPGSKPQD 1079

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKL---ANILSVQGKSRT 127
            +       K                 +P   S +S  ++    +                
Sbjct: 1080 TTAGKPGAKPGAPQVEKPGGAGETGGKPAQPSDASGDKAGAPGQTGDKPGDKPPAAGKPG 1139

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
            +   +      +     +       +   +         DK        +          
Sbjct: 1140 DKPPTAGKPGDKSGAASAQPAAASADKAEAAGKAGPKPGDKPGKAAQPTSADEDKTGQID 1199

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                                                     +                  
Sbjct: 1200 AGPGDKAGVPGQPDAGPGDKPGGAAGQPSDKPGRAGGPAGQLSDKPGRAGGPAGQPGATA 1259

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             +    G      V  G                    +    A               G 
Sbjct: 1260 GDKAGAGRQPGARVGGGPGAAEKTGGRPGDESSGQPAAKAGAAGGETRQGPKGLAQKPGL 1319

Query: 308  ENSTFVLGKKEIEEGNPLIGEGR 330
                  +   + ++G   +  G 
Sbjct: 1320 RAPGRDIYGDDGDDGIGGVKRGA 1342


>gi|315611755|ref|ZP_07886677.1| streptococcal surface protein A [Streptococcus sanguinis ATCC 49296]
 gi|315316170|gb|EFU64200.1| streptococcal surface protein A [Streptococcus sanguinis ATCC 49296]
          Length = 1543

 Score = 77.4 bits (188), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 39/269 (14%), Positives = 79/269 (29%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQV--EKQNQK 70
            +      P      YE+      +  +  +P  P+E        LE A +    E +   
Sbjct: 844  EVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPNYENEPTP 903

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q   S   + +  +++ +   P   S  +              S   +   +  
Sbjct: 904  PVKTPDQPDPSKPEEPNYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYDPL 963

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +     +V T H + + +     I  +        +          + + 
Sbjct: 964  PTPPVAPTPKQLPTPPAVPTVHFHYNRLFAQPQINKEIKNEDGVDIDRTLVAKQSVVKFE 1023

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   S  K+  ++T     E+
Sbjct: 1024 LKTEALTAGRPKTT-SFVLVDPLPTGYQFDLEATKAASKGFETSYDKASHTVTFKATEET 1082

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D    F  + P +  R+L DG+ 
Sbjct: 1083 LAAFNADLTKSFETLYPTVVGRVLNDGAT 1111



 Score = 68.1 bits (164), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/158 (9%), Positives = 36/158 (22%), Gaps = 3/158 (1%)

Query: 35  ARRLESMKPRLPKEILERQFNKLEQA--ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKE 92
            +    ++P  P+         LE A  +   E +    + T  Q + S   + +  +++
Sbjct: 827 EKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYETEK 886

Query: 93  NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQH 152
            +   P   +  +              S   +        P   +       +       
Sbjct: 887 PLEPAPVAPNYENEPTPPVKTPDQPDPSKPEE-PNYETEKPLEPAPVAPSYENEPTPPVK 945

Query: 153 EYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             D          +                PT     +
Sbjct: 946 TPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 983



 Score = 55.8 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/158 (6%), Positives = 32/158 (20%), Gaps = 2/158 (1%)

Query: 58  EQAILQVEKQNQKSLH-TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLA 116
           E+    VE    ++     ++  E      +  ++    ++   +   S      ++   
Sbjct: 827 EKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEPTYETEK 886

Query: 117 NILSVQGKSRTNTNLSPKNFSCRLREILSFSVN-TQHEYDSSVSPVAAIEHDKSRLRRGK 175
            +             +P   +    +         + E     +PVA    ++       
Sbjct: 887 PLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEPNYETEKPLEPAPVAPSYENEPTPPVKT 946

Query: 176 LAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH 213
                        +                        
Sbjct: 947 PDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPTV 984



 Score = 55.4 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 4/163 (2%), Positives = 22/163 (13%)

Query: 100 LRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVS 159
           +  I+    +   +  A         +                    + +          
Sbjct: 821 VPKITKEKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEP 880

Query: 160 PVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
                +  +            + P  +      +                     ++   
Sbjct: 881 TYETEKPLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEPNYETEKPLEPAPVAPSYENEP 940

Query: 220 FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
              +        S     +   +       +            
Sbjct: 941 TPPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 983



 Score = 51.9 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 7/162 (4%), Positives = 25/162 (15%), Gaps = 1/162 (0%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRL-REILSFSVNTQHEYDSSVSPVAAIE 165
           +     +K    +           +        +     +         D          
Sbjct: 821 VPKITKEKPTPPVEPTAPQAPTYEVEKPLEPAPVVPNYENEPTPPVKTPDQPEPSKPEEP 880

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
             ++           ++              + ++     Y                   
Sbjct: 881 TYETEKPLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEPNYETEKPLEPAPVAPSYENEP 940

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
              +        SK    ++    +       K+       P
Sbjct: 941 TPPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVP 982


>gi|332358464|gb|EGJ36289.1| major cell-surface adhesin PAc [Streptococcus sanguinis SK49]
          Length = 1554

 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 77/269 (28%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQK 70
            +      P      YE+      +  +  +P  P+E         E A      E +   
Sbjct: 850  EEEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPSEPAPVAPTYENEPTP 909

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   +  +              S   +   +  
Sbjct: 910  PVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYDPL 969

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 970  PTPPLAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 1029

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 1030 LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1088

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1089 LASYNADLTKPVETLHPMVVGRVLNDGAT 1117



 Score = 46.5 bits (108), Expect = 0.009,   Method: Composition-based stats.
 Identities = 11/206 (5%), Positives = 38/206 (18%), Gaps = 1/206 (0%)

Query: 63  QVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
            V   +  ++    +  +     ++   K NI+     +  +  +     +K    ++  
Sbjct: 783 TVGATSATNVMPVAEMPKVPGRDNTEGKKPNIWYSLNGKIRAVNVPKITKEKPTPPVAPT 842

Query: 123 GKSRTNTNLSPKNFSCRL-REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
                            +     +         D            ++           +
Sbjct: 843 EPQAPTYEEEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPSEPAPVAPT 902

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
           +                ++     Y                      +        SK  
Sbjct: 903 YENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPE 962

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRP 267
              +    +       K+     + P
Sbjct: 963 EPTYDPLPTPPLAPTPKQLPTPPVVP 988


>gi|71648919|ref|XP_813237.1| trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70878103|gb|EAN91386.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 1496

 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 18/332 (5%), Positives = 49/332 (14%), Gaps = 2/332 (0%)

Query: 17   ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE--QAILQVEKQNQKSLHT 74
            E  P                  +  +P+  +                  VE +  +    
Sbjct: 1124 EPKPAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSAEPKPAEPKPAEPKPVEPKPAEPKPA 1183

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
              +  E    +      +    +P     +    +            +          P 
Sbjct: 1184 EPKPAEPKPAEPKSAEPKPAEPKPAEPKPAEPKPAEPKPAEPKSAEPKPAEPKPAEPKPA 1243

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
                   +            +   +     E   +  +  +                   
Sbjct: 1244 EPKPAEPKPAEPKPAEPKSAEPKPAEPKPAEPKSAEPKPAEPKPAEPKSAEPKPAEPKPA 1303

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGG 254
                     +                             +  K         +       
Sbjct: 1304 EPKSAEPKPAEPKPAEPKPAEPKPAEPKSAEPKPAEPKSAEPKPAEPKPAEPKPAEPKSA 1363

Query: 255  NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL 314
                    SG       +  E         ++      A+    A  +       S    
Sbjct: 1364 EPKPAEPKSGEPKPAEPKPAEPKPAEPNAATSSAREGTADQPASATSSDEHEALASVTSS 1423

Query: 315  GKKEIEEGNPLIGEGRVFINKGRGQSSILSGK 346
                 + G     + +    +G          
Sbjct: 1424 SVAITDVGASSSDDAQTVGTEGGAVMQADQPT 1455


>gi|163845799|ref|YP_001633843.1| beta strand repeat-containing protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523509|ref|YP_002567979.1| autotransporter-associated beta strand repeat-containing protein
           [Chloroflexus sp. Y-400-fl]
 gi|163667088|gb|ABY33454.1| autotransporter-associated beta strand repeat protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222447388|gb|ACM51654.1| autotransporter-associated beta strand repeat protein [Chloroflexus
           sp. Y-400-fl]
          Length = 1320

 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/344 (9%), Positives = 68/344 (19%), Gaps = 3/344 (0%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
                 TPE  + +      SV     +     P   +  +               + + 
Sbjct: 575 SATASATPEPTASVTPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTA 634

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             + +   S  P+ + ++  +      +    S   S      A   +    + + T   
Sbjct: 635 SATPEPTASVTPEPTASTTPSPSATASVTPSPSATASVTPSPSATASATPEPTASTTPSP 694

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
               S       S + +      ++ +  +      +              T S+  S  
Sbjct: 695 SATASTTPEPTASTTPS---PSATASTTPSPSATASATPEPTASTTPSPSATASVTPSPS 751

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                      +     S                     + S   S  +        S  
Sbjct: 752 ATASTTPSPSATASVTPSPSATASMTPSPSATASATPEPTASTTPSPSATASVTPSPSAT 811

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                  +  +   P  +       S       T         S  A  +       S  
Sbjct: 812 ASTTPSPSATASTTPSPSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTASVT 871

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
                             V  +     S+  S  +  S     S
Sbjct: 872 PSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSPS 915



 Score = 76.6 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/348 (9%), Positives = 68/348 (19%), Gaps = 9/348 (2%)

Query: 18  NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
            TPE  + +      S      +     P      +               + +   + +
Sbjct: 588 VTPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPE 647

Query: 78  DKESDIPKSSVTSKENI---------FLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
              S  P  S T+                    S +    ++     +   S   +   +
Sbjct: 648 PTASTTPSPSATASVTPSPSATASVTPSPSATASATPEPTASTTPSPSATASTTPEPTAS 707

Query: 129 TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
           T  SP   +       + +  T     S+    +A                    T S+ 
Sbjct: 708 TTPSPSATASTTPSPSATASATPEPTASTTPSPSATASVTPSPSATASTTPSPSATASVT 767

Query: 189 WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
            S             +  +                 +  +   + S   S  +       
Sbjct: 768 PSPSATASMTPSPSATASATPEPTASTTPSPSATASVTPSPSATASTTPSPSATASTTPS 827

Query: 249 ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            S         +  + + P+ T       S           +   + S  A         
Sbjct: 828 PSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTASVTPSPSATASVTPSPSAT 887

Query: 309 NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
            S                       +     S+  S     S     S
Sbjct: 888 ASVTPSPSATASTTPSPSVTASTTPSPSATASTTPSPSATASTTPSPS 935



 Score = 75.0 bits (182), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/344 (9%), Positives = 62/344 (18%), Gaps = 5/344 (1%)

Query: 18  NTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQ 77
            TPE  +        SV     +     P   +  +                 S   +  
Sbjct: 612 VTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTASTTPSPSATASVTPSPSATAS 671

Query: 78  DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
              S    +S T +      P   + +S           +  +    + + +  +     
Sbjct: 672 VTPSPSATASATPEPTASTTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASATPE 731

Query: 138 CRLREILSFSV-----NTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                  S S       +     S+    +A                    T S      
Sbjct: 732 PTASTTPSPSATASVTPSPSATASTTPSPSATASVTPSPSATASMTPSPSATASATPEPT 791

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                      S   + S                 +   + S   S  +        +  
Sbjct: 792 ASTTPSPSATASVTPSPSATASTTPSPSATASTTPSPSATASATPSPSATASVTPEPTAS 851

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                     +   P  +       +       +   +   + S  A          ST 
Sbjct: 852 TTPSPSATASATPEPTASVTPSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTT 911

Query: 313 VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
                                +     S+  S     S     S
Sbjct: 912 PSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPS 955


>gi|306830103|ref|ZP_07463287.1| streptococcal surface protein A [Streptococcus mitis ATCC 6249]
 gi|304427629|gb|EFM30725.1| streptococcal surface protein A [Streptococcus mitis ATCC 6249]
          Length = 1549

 Score = 77.0 bits (187), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 41/269 (15%), Positives = 81/269 (30%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQV--EKQNQK 70
            +      P   +  YE+      +  +   P  P+E        LE A +    E +   
Sbjct: 850  EVEKPLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEPTYETEKPLEPAPVAPNYENEPTP 909

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   S  +              S   +   +  
Sbjct: 910  PVKTPDQPEPSKPEEPNYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYDPL 969

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +     +V T H + SS+     I  +        +          + + 
Sbjct: 970  PTPPVAPTPKQLPTPPAVPTVHFHYSSLMAQPQINKEIKNEDGVDIDRTLVAKQSVVKFE 1029

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   S  K+  ++T     E+
Sbjct: 1030 LKTEALTAGRPKTT-SFVLVDPLPTGYQFDLEATKAASKGFETSYDKASHTVTFKATEET 1088

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D    F  + P +  R+L DG+ 
Sbjct: 1089 LAAFNADLTKSFETLYPTVVGRVLNDGAT 1117



 Score = 55.0 bits (130), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 3/163 (1%), Positives = 20/163 (12%)

Query: 100 LRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVS 159
           +  I+    +                +                    + +          
Sbjct: 827 VPKITKEKPTPPVAPTEPQAPTYEVEKPLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEP 886

Query: 160 PVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
                +  +            + P  +      +                     ++   
Sbjct: 887 TYETEKPLEPAPVAPNYENEPTPPVKTPDQPEPSKPEEPNYETEKPLEPAPVAPSYENEP 946

Query: 220 FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVF 262
              +        S     +   +       +            
Sbjct: 947 TPPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVPT 989



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/161 (6%), Positives = 28/161 (17%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
            +  K K    +   + ++ T     P   +       +         D           
Sbjct: 828 PKITKEKPTPPVAPTEPQAPTYEVEKPLEPAPVAPNYENEPTPPVKTPDQPDPSKPEEPT 887

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
            ++           ++                ++     Y                    
Sbjct: 888 YETEKPLEPAPVAPNYENEPTPPVKTPDQPEPSKPEEPNYETEKPLEPAPVAPSYENEPT 947

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
             +        SK    ++    +       K+       P
Sbjct: 948 PPVKTPDQPEPSKPEEPNYDPLPTPPVAPTPKQLPTPPAVP 988


>gi|3220006|sp|P16952|SSP5_STRGN RecName: Full=Agglutinin receptor; AltName: Full=SSP-5; Flags:
            Precursor
 gi|1100973|gb|AAC44100.1| SspB precursor [Streptococcus gordonii]
          Length = 1500

 Score = 77.0 bits (187), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 79/269 (29%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQK 70
            +      P   +  YE+      +  +  +P  P+E        LE A      E +   
Sbjct: 772  ETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTP 831

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   S  +              S   +   +  
Sbjct: 832  PVKTPDQPEPSKPEEPNYETEKPLEPAPVAPSYENEPTPPVKIPDQPEPSKPEEPTYDPL 891

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 892  PTPPLAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 951

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 952  LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1010

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1011 LATYNADLTKPVETLHPTVVGRVLNDGAT 1039



 Score = 43.5 bits (100), Expect = 0.083,   Method: Composition-based stats.
 Identities = 7/154 (4%), Positives = 23/154 (14%), Gaps = 1/154 (0%)

Query: 115 LANILSVQGKSRTNTNLSPKNFSCR-LREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRR 173
               ++    ++                   +         D            ++    
Sbjct: 757 PTKPVAPTAPTQPMYETEKPLEPAPVAPSYENEPTPPVKTPDQPEPSKPEEPTYETEKPL 816

Query: 174 GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                  S+                ++     Y                      + +  
Sbjct: 817 EPAPVAPSYENEPTPPVKTPDQPEPSKPEEPNYETEKPLEPAPVAPSYENEPTPPVKIPD 876

Query: 234 SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
               SK     +    +       K+     + P
Sbjct: 877 QPEPSKPEEPTYDPLPTPPLAPTPKQLPTPPVVP 910


>gi|47214568|emb|CAG13290.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 10495

 Score = 76.6 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/249 (7%), Positives = 53/249 (21%), Gaps = 14/249 (5%)

Query: 4     FILVIQRAVDNLPENTP--ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI 61
              + +  R +      T   E R  I         +++ +M    P    E++     +A 
Sbjct: 10250 MVPLAARVLIEETVETKKVEMREGIPSKEP----KQVATMPKPEPTPKAEQEPKPKPKAE 10305

Query: 62    LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
              + + + +       + K    PK    ++     +P++     +    + +        
Sbjct: 10306 PEPKPKPKAEPEPKPKPKAEPEPKPKPKAEPEPKPKPKVEPEPKLKPKAEPEPKPKPKVE 10365

Query: 122   QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
                              R                      A     + +      +    
Sbjct: 10366 PEPKLKPKAEPEPKPKQRAELEP-------IAELELKPTPAPKVEPEPKPAVKVESEAKP 10418

Query: 182   FPTGSIFWSVHNYFFNKTRGLLSFYSAL-SEHHLFKYFVFLIILLGMAIGVSYSIGKSKG 240
              P   +         ++            +   +   +              +S+G  + 
Sbjct: 10419 EPVKKLTTPPSKESEDRPERTQKPAGVRYTPQEVQSIWREEGETPSNLETQFFSLGPERK 10478

Query: 241   SITHFLRRE 249
                      
Sbjct: 10479 EHAPSRESS 10487



 Score = 74.7 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/251 (6%), Positives = 50/251 (19%), Gaps = 23/251 (9%)

Query: 54    FNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHK 113
                +E+ +   + + ++ + + +  + + +PK   T K     +P+ ++        K +
Sbjct: 10256 RVLIEETVETKKVEMREGIPSKEPKQVATMPKPEPTPKAEQEPKPKPKAEPEPKPKPKAE 10315

Query: 114   KLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRR 173
                                                                   + +L+ 
Sbjct: 10316 PEPKPKPKAEP-----------------------EPKPKPKAEPEPKPKPKVEPEPKLKP 10352

Query: 174   GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                      P       +      + +               K      +       V  
Sbjct: 10353 KAEPEPKPKPKVEPEPKLKPKAEPEPKPKQRAELEPIAELELKPTPAPKVEPEPKPAVKV 10412

Query: 234   SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
                     +       S +  +  ++           + +     E    PS +    F+
Sbjct: 10413 ESEAKPEPVKKLTTPPSKESEDRPERTQKPAGVRYTPQEVQSIWREEGETPSNLETQFFS 10472

Query: 294   NTSNIAFKNYI 304
                        
Sbjct: 10473 LGPERKEHAPS 10483



 Score = 71.6 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/252 (9%), Positives = 49/252 (19%), Gaps = 23/252 (9%)

Query: 45    LPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS 104
             + + +  ++    E    +  KQ           K    PK    ++     +P+     
Sbjct: 10259 IEETVETKKVEMREGIPSKEPKQVATMPKPEPTPKAEQEPKPKPKAEPEPKPKPKAEPEP 10318

Query: 105   SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAI 164
                   + +      +                                          A 
Sbjct: 10319 KPKPKAEPEPKPKPKAEPEP-----------------------KPKPKVEPEPKLKPKAE 10355

Query: 165   EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
                K + +      +                       L    A       K  V +   
Sbjct: 10356 PEPKPKPKVEPEPKLKPKAEPEPKPKQRAELEPIAELELKPTPAPKVEPEPKPAVKVESE 10415

Query: 225   LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                      +   SK S     R +   G     + V S  R +       +     +GP
Sbjct: 10416 AKPEPVKKLTTPPSKESEDRPERTQKPAGVRYTPQEVQSIWREEGETPSNLETQFFSLGP 10475

Query: 285   STIPVADFANTS 296
                  A    +S
Sbjct: 10476 ERKEHAPSRESS 10487



 Score = 55.4 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/166 (7%), Positives = 36/166 (21%)

Query: 14    NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
               PE  P+ ++      +  V    +      P+   + +     +   + E + +    
Sbjct: 10324 AEPEPKPKPKAEPEPKPKPKVEPEPKLKPKAEPEPKPKPKVEPEPKLKPKAEPEPKPKQR 10383

Query: 74    TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
                +       K +   K     +P ++  S        K               T    
Sbjct: 10384 AELEPIAELELKPTPAPKVEPEPKPAVKVESEAKPEPVKKLTTPPSKESEDRPERTQKPA 10443

Query: 134   KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
                         +    +   +      +     K      + +  
Sbjct: 10444 GVRYTPQEVQSIWREEGETPSNLETQFFSLGPERKEHAPSRESSRG 10489


>gi|71980588|ref|NP_001020985.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|82583720|sp|O01761|UNC89_CAEEL RecName: Full=Muscle M-line assembly protein unc-89; AltName:
            Full=Uncoordinated protein 89
 gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 8081

 Score = 76.6 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 33/342 (9%), Positives = 85/342 (24%), Gaps = 16/342 (4%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             E TPE+     +           + K + P++ +  +     +     EK  +K    +
Sbjct: 1528 KEKTPEKVDEKPKS---------PTKKDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPT 1578

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            K++K  + P S     EN    P  +  S      +  K     S +       + + K 
Sbjct: 1579 KKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKE 1638

Query: 136  FSCRLREILSFSVNTQHE--YDSSVSPVAAIEHDKSRLRRGKLAGIFSFP-----TGSIF 188
             S            T+ E   +       +    +S   +     + S         ++ 
Sbjct: 1639 KSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVE 1698

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +    +     S    +                            +   +    ++
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTKK 1758

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E     + ++K      +     ++ +D  +        P       ++   K       
Sbjct: 1759 EKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKKEKTPEKS 1818

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
             +  +    + E+      +     +K +            +
Sbjct: 1819 AAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT 1860



 Score = 65.4 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/404 (7%), Positives = 76/404 (18%), Gaps = 38/404 (9%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPK--------------------- 47
            ++  D + E +P +     E +          +K                          
Sbjct: 1452 KKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSETTIEKTETTM 1511

Query: 48   -------EILERQFNKLEQAILQVEKQNQKSLHTSKQDK--------ESDIPKSSVTSKE 92
                       R   K E+   +V+++ +      K  +             + S    E
Sbjct: 1512 TTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSPVKKEKSPEKVE 1571

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN-LSPKNFSCRLREILSFSVNTQ 151
                 P  +  S    ++  KK  N +    K   +      +       +    + +  
Sbjct: 1572 EKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKP 1631

Query: 152  HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                           +  +    K              +       K            E
Sbjct: 1632 KSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKE 1691

Query: 212  HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                                  S+ +   S       ++ +      K   S  +     
Sbjct: 1692 KSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEE 1751

Query: 272  RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD-ENSTFVLGKKEIEEGNPLIGEGR 330
                   E     S             +       + ++ T      E  E  P     +
Sbjct: 1752 VKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKK 1811

Query: 331  VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                +      + S           ++       +      +  
Sbjct: 1812 EKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEK 1855


>gi|25990270|gb|AAC44101.3| streptococcal surface protein A precursor [Streptococcus gordonii]
          Length = 1575

 Score = 76.6 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 37/269 (13%), Positives = 80/269 (29%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA--ILQVEKQNQK 70
            +      P   +  YE+      +  +  +P  P+E        LE A  +   E +   
Sbjct: 844  EVEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVVPTYENEPTP 903

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   +  +              S   +   +  
Sbjct: 904  PVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYDPL 963

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 964  PTPPVAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 1023

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 1024 LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1082

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1083 LATYNADLTKPVETLHPTVVGRVLNDGAT 1111



 Score = 51.5 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 10/161 (6%), Positives = 29/161 (18%)

Query: 107 LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
            +  K K    +   + ++ T     P   +       +         D           
Sbjct: 822 PKITKEKPTPPVAPTEPQAPTYEVEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPT 881

Query: 167 DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLG 226
            ++         + ++                ++     Y                    
Sbjct: 882 YETEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPT 941

Query: 227 MAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
             +        SK     +    +       K+     + P
Sbjct: 942 PPVKTPDQPEPSKPEEPTYDPLPTPPVAPTPKQLPTPPVVP 982


>gi|260783730|ref|XP_002586925.1| hypothetical protein BRAFLDRAFT_103585 [Branchiostoma floridae]
 gi|229272056|gb|EEN42936.1| hypothetical protein BRAFLDRAFT_103585 [Branchiostoma floridae]
          Length = 4251

 Score = 76.6 bits (186), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/294 (7%), Positives = 45/294 (15%), Gaps = 4/294 (1%)

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS----SILRSNKHKKLANILSVQGKSR 126
               +S Q     +P+      +       L S      + L    H       +      
Sbjct: 880  PYPSSDQPTMPSVPQPPHVGTQLPPPPEGLISSPWQYNAGLGQPVHDPSYPPGAPCAPHL 939

Query: 127  TNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS 186
                 +    S      L+F         S+    +    D            +      
Sbjct: 940  PGQAPNAPFSSAPYPPGLAFHAPYPPGSASNTPHSSGPMPDAPYPPGPASNAPYPPGPAL 999

Query: 187  IFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFL 246
                      N +    +               +       A  +      +        
Sbjct: 1000 DAPYPPGPAPNASYPPGAMPDVPCPAGPAPDAPYPPGPALDAPYLPGPAANAPYPPGAMP 1059

Query: 247  RRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                  G   D             +      +     P            N  ++     
Sbjct: 1060 DVPCPAGPAPDAPYPPGPASDAPYQPGAVPNAPCPPEPVPDAPYPSGPAPNAPYQPGAVP 1119

Query: 307  DENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
            D                P          +       +    + S      Q   
Sbjct: 1120 DAPYPPGPAPNAPYPPGPAADAPYPPGQQPTQNDPAIRETDILSPPYVSDQRQP 1173



 Score = 52.7 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/319 (5%), Positives = 52/319 (16%)

Query: 54   FNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHK 113
               +E+ +     + +  +                + +     E +              
Sbjct: 702  EELVEETVQPFPSKAKAIVVPEDPSPTKVKVTRKSSLESKPLPEFQPVDKFEREMKPPEP 761

Query: 114  KLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRR 173
             +     ++ + +     + +          +     +   D      A++    S    
Sbjct: 762  LIKTDPLLKNQQQVKVRTTGEEVETLQTFGPTGEKPDRPAGDVPSRARASLVAPPSCPDV 821

Query: 174  GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                   +          H+    + R               +     +        + Y
Sbjct: 822  TASVTPSAGEGQEPSQPGHDKQIEEQRSNEGVAQPPVLPPTGRPPTGDVTTGKPGSSLPY 881

Query: 234  SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFA 293
                     +               + + S                     +        
Sbjct: 882  PSSDQPTMPSVPQPPHVGTQLPPPPEGLISSPWQYNAGLGQPVHDPSYPPGAPCAPHLPG 941

Query: 294  NTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
               N  F +       +             P             G +S        +L  
Sbjct: 942  QAPNAPFSSAPYPPGLAFHAPYPPGSASNTPHSSGPMPDAPYPPGPASNAPYPPGPALDA 1001

Query: 354  EKSQGLKGLVIKGDIPMID 372
                G           M D
Sbjct: 1002 PYPPGPAPNASYPPGAMPD 1020



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/346 (6%), Positives = 57/346 (16%), Gaps = 4/346 (1%)

Query: 21   ERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ--AILQVEKQNQKSLH-TSKQ 77
            E        A+  V     S            +   L +   + + E++ +         
Sbjct: 707  ETVQPFPSKAKAIVVPEDPSPTKVKVTRKSSLESKPLPEFQPVDKFEREMKPPEPLIKTD 766

Query: 78   DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
                +  +  V +        +    +          + +       +  +      + +
Sbjct: 767  PLLKNQQQVKVRTTGEEVETLQTFGPTGEKPDRPAGDVPSRARASLVAPPSCPDVTASVT 826

Query: 138  CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFN 197
                E    S     +          +         G+                +     
Sbjct: 827  PSAGEGQEPSQPGHDKQIEEQRSNEGVAQPPVLPPTGRPPTGDVTTGKPGSSLPYPSSDQ 886

Query: 198  KTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD 257
             T   +     +           +        G+   +                      
Sbjct: 887  PTMPSVPQPPHVGTQLPPPPEGLISSPWQYNAGLGQPVHDPSYPPGAPCAPHLPGQAPNA 946

Query: 258  KKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKK 317
              +                GS  +   S+ P+ D          N       +       
Sbjct: 947  PFSSAPYPPGLAFHAPYPPGSASNTPHSSGPMPDAPYPPGP-ASNAPYPPGPALDAPYPP 1005

Query: 318  EIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                           +    G +         +L      G     
Sbjct: 1006 GPAPNASYPPGAMPDVPCPAGPAPDAPYPPGPALDAPYLPGPAANA 1051



 Score = 48.1 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/323 (7%), Positives = 59/323 (18%), Gaps = 10/323 (3%)

Query: 43   PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRS 102
            P      +         A       +               P+    +       P    
Sbjct: 1054 PPGAMPDVPCPAGPAPDAPYPPGPASDAPYQPGAVPNAPCPPEPVPDAPYPSGPAPNAPY 1113

Query: 103  ISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVA 162
                +    +       +            P        +      +       S     
Sbjct: 1114 QPGAVPDAPYPPGPAPNAPYPPGPAADAPYPPGQQPTQNDPAIRETDILSPPYVSDQRQP 1173

Query: 163  AIEH-DKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFL 221
               +  +SR     +       +          F  +    +   + +S H + K    L
Sbjct: 1174 FEGNVPESRESTDDVEEPDDRLSSEKLEKRRVSFETQNSKDIQHSAPMSSHDVGKLDGRL 1233

Query: 222  IILLGMAIGVSYSIG---------KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRR 272
                     VS+                     L    ++     +        P     
Sbjct: 1234 ASDKLEKRRVSFETQNSKDIQHSAPMSPPDKAVLPWRPIEEIISPRPGSIPIPLPWTPTP 1293

Query: 273  LLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVF 332
              E     D G +    ++         ++             ++E + G    G     
Sbjct: 1294 SPEKQQAFDFGGAPNVPSESEQIPAELSEHKSEIPGQLGLSKAEEEYQSGEVSSGPDASP 1353

Query: 333  INKGRGQSSILSGKILWSLQQEK 355
              +   +S +       S   + 
Sbjct: 1354 GKERAPESKVKDDAAPMSPPDKA 1376



 Score = 40.8 bits (93), Expect = 0.62,   Method: Composition-based stats.
 Identities = 26/342 (7%), Positives = 75/342 (21%), Gaps = 6/342 (1%)

Query: 35  ARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENI 94
             +   + P   +  ++      E+A +  E      L  +++++    P  S+  K+  
Sbjct: 536 QAKATVVTPPHTQSKVKIHRASSEEAPISTE------LRPAEKEERQVEPPESLIDKDIF 589

Query: 95  FLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEY 154
                           +  +  +  + +     +        S                 
Sbjct: 590 KKNQHQVRALETEGEEETCQTISPATEKSPMPEDDVQVKSKTSMVPVLHPPDVTAITTPS 649

Query: 155 DSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHL 214
             + SP+      +        A            ++          +      L E  +
Sbjct: 650 SGTGSPLQPTVSYQQEETIVGEAVPVLSEDTGASATLPPGTHPTMSFIDGGDEELVEETV 709

Query: 215 FKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLL 274
             +      ++         +  ++ S             +  ++ +        T  LL
Sbjct: 710 QPFPSKAKAIVVPEDPSPTKVKVTRKSSLESKPLPEFQPVDKFEREMKPPEPLIKTDPLL 769

Query: 275 EDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFIN 334
           ++  +V V  +   V           K      +  +            P +        
Sbjct: 770 KNQQQVKVRTTGEEVETLQTFGPTGEKPDRPAGDVPSRARASLVAPPSCPDVTASVTPSA 829

Query: 335 KGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFS 376
               + S          Q+      +  V+           +
Sbjct: 830 GEGQEPSQPGHDKQIEEQRSNEGVAQPPVLPPTGRPPTGDVT 871



 Score = 38.8 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 32/370 (8%), Positives = 86/370 (23%), Gaps = 12/370 (3%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQ-----------AILQV 64
              ++PE        +  +  R+L   K    ++ L       E+            I + 
Sbjct: 1919 DPSSPEVEPLSPYKSSPTRVRQLNKQKATKREQGLVEGTTIFEEDPGMAKLVNVVDIPER 1978

Query: 65   EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK 124
            E+    +     Q  +     + +  +     EP L   ++   ++        ++    
Sbjct: 1979 EEVALSTAFVRSQPPDHGNVDNELNRRRAAAGEPGLVEEATSFEADPSMTKVANVADVSP 2038

Query: 125  SRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPT 184
                   +    S   ++    +           +    ++   +R  +       S P 
Sbjct: 2039 HEDVALSAAFVSSQPPQQRDGDNEGDVFYDAPDTAASEPVKQKPARQSKIPTFQSKSPPH 2098

Query: 185  GSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITH 244
             +          +  +      +   +       + +                     T 
Sbjct: 2099 SAKPDEGLTEQQSPDQPQPEHSTGPFQQSPSPSKIPIGPSTLPTTPRKRVDSPPPPPNTP 2158

Query: 245  FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
                      +           P +     + GS +   P           S    +   
Sbjct: 2159 KSPTRKSTSPSKIPSEAKPSGIPTLKISAKDSGSPLSTAPPGDSEKSATEESEKVPQAKE 2218

Query: 305  GGDENSTFVLGKKEIEEGN-PLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
            GG E        ++++      + +          + +      +    +E     +G  
Sbjct: 2219 GGRELGDEKERPQDVKMVRGEEVHDVANLPKPDEPRENQGDPDSVEDQTKESEDERQGYE 2278

Query: 364  IKGDIPMIDN 373
            I  D+  ID 
Sbjct: 2279 IPEDLERIDE 2288


>gi|167522703|ref|XP_001745689.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776038|gb|EDQ89660.1| predicted protein [Monosiga brevicollis MX1]
          Length = 2262

 Score = 76.6 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 8/217 (3%), Positives = 28/217 (12%), Gaps = 5/217 (2%)

Query: 87   SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
               +  +          S+   + +      +    G +               +     
Sbjct: 1414 PTQASSDGPTSMHAVPESNASATLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQSPKYA 1473

Query: 147  SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFY 206
                      +                         P  S   +      +         
Sbjct: 1474 PPEPPQSPKHAPPKPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPP 1533

Query: 207  SALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR 266
             +                            K          + +            S   
Sbjct: 1534 QSPKHAPPGPPQSPKHAPPEPPQSP-----KHAPPKPPQSPKHAPPKPPQSPVLPPSEAA 1588

Query: 267  PKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                  L +   E++           +  +  +    
Sbjct: 1589 SDAASELSDSLPELNESRPRSGAMATSRPAAQSANPE 1625



 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/300 (8%), Positives = 56/300 (18%), Gaps = 3/300 (1%)

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +++L   K     + P                   S + +                +   
Sbjct: 1350 KQTLAERKSTASMNPPPPPPAEAPASGASESSLPDSDVAKPAIPSAAPPAPPSAPAAEVA 1409

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            + + P   S      +     +        S    +                + P     
Sbjct: 1410 SGVRPTQASSDGPTSMHAVPESNASATLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQS 1469

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                     ++          S  H                  S      +   +     
Sbjct: 1470 PKYAPPEPPQSPKHAPPKPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAP 1529

Query: 249  ESLDGGN--VDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                            S              +      S          S +   +    
Sbjct: 1530 PEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAPPKPPQSPKHAPPKPPQSPVLPPSEAAS 1589

Query: 307  DENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKG 366
            D  S       E+ E  P  G            ++    ++L +L++  ++  KG+ +  
Sbjct: 1590 DAASELSDSLPELNESRPRSG-AMATSRPAAQSANPEKVELLSALERVANEHPKGITLSA 1648



 Score = 71.2 bits (172), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 14/205 (6%), Positives = 32/205 (15%), Gaps = 16/205 (7%)

Query: 60   AILQVEKQNQKSLHTSKQDKESDIPKSSV------TSKENIFLEPRLRSI-SSILRSNKH 112
            A   ++  +   +          +            S +    EP      +        
Sbjct: 1433 ASATLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAPPKPPQSP 1492

Query: 113  KKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR 172
            K          K            +                   +               
Sbjct: 1493 KHAPPEPPQSPKHAPPEPPQSPKHAPPEP---------PQSPKHAPPEPPQSPKHAPPGP 1543

Query: 173  RGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
                      P  S   +      +          +               L      ++
Sbjct: 1544 PQSPKHAPPEPPQSPKHAPPKPPQSPKHAPPKPPQSPVLPPSEAASDAASELSDSLPELN 1603

Query: 233  YSIGKSKGSITHFLRRESLDGGNVD 257
             S  +S    T     +S +   V+
Sbjct: 1604 ESRPRSGAMATSRPAAQSANPEKVE 1628



 Score = 51.2 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 35/183 (19%), Gaps = 3/183 (1%)

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
               +++    S  +  +                +A GV  +   S G  +     ES   
Sbjct: 1375 SGASESSLPDSDVAKPAIPSAAPPAPPSAPAAEVASGVRPTQASSDGPTSMHAVPESNAS 1434

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFV 313
              +   +      P     +     +                   + K+       S   
Sbjct: 1435 ATLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAPPKPPQSPKH 1494

Query: 314  LGKKEIEEG---NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
               +  +      P   +          QS   +        +    G            
Sbjct: 1495 APPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEP 1554

Query: 371  IDN 373
              +
Sbjct: 1555 PQS 1557


>gi|71980586|ref|NP_001020984.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|20198774|gb|AAB54132.2| Uncoordinated protein 89, isoform a, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 6632

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/342 (9%), Positives = 85/342 (24%), Gaps = 16/342 (4%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             E TPE+     +           + K + P++ +  +     +     EK  +K    +
Sbjct: 1528 KEKTPEKVDEKPKS---------PTKKDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPT 1578

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            K++K  + P S     EN    P  +  S      +  K     S +       + + K 
Sbjct: 1579 KKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKE 1638

Query: 136  FSCRLREILSFSVNTQHE--YDSSVSPVAAIEHDKSRLRRGKLAGIFSFP-----TGSIF 188
             S            T+ E   +       +    +S   +     + S         ++ 
Sbjct: 1639 KSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVE 1698

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +    +     S    +                            +   +    ++
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTKK 1758

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E     + ++K      +     ++ +D  +        P       ++   K       
Sbjct: 1759 EKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKKEKTPEKS 1818

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
             +  +    + E+      +     +K +            +
Sbjct: 1819 AAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT 1860



 Score = 65.4 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/404 (7%), Positives = 76/404 (18%), Gaps = 38/404 (9%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPK--------------------- 47
            ++  D + E +P +     E +          +K                          
Sbjct: 1452 KKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSETTIEKTETTM 1511

Query: 48   -------EILERQFNKLEQAILQVEKQNQKSLHTSKQDK--------ESDIPKSSVTSKE 92
                       R   K E+   +V+++ +      K  +             + S    E
Sbjct: 1512 TTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSPVKKEKSPEKVE 1571

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN-LSPKNFSCRLREILSFSVNTQ 151
                 P  +  S    ++  KK  N +    K   +      +       +    + +  
Sbjct: 1572 EKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKP 1631

Query: 152  HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                           +  +    K              +       K            E
Sbjct: 1632 KSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKE 1691

Query: 212  HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                                  S+ +   S       ++ +      K   S  +     
Sbjct: 1692 KSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEE 1751

Query: 272  RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD-ENSTFVLGKKEIEEGNPLIGEGR 330
                   E     S             +       + ++ T      E  E  P     +
Sbjct: 1752 VKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKK 1811

Query: 331  VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                +      + S           ++       +      +  
Sbjct: 1812 EKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEK 1855


>gi|328876667|gb|EGG25030.1| hypothetical protein DFA_03276 [Dictyostelium fasciculatum]
          Length = 1287

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/326 (9%), Positives = 59/326 (18%), Gaps = 20/326 (6%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
             L S +P  P+     Q      A    + ++ ++   +     S  P +   S +   
Sbjct: 161 HDLRSSQPPPPRYDQHPQTY----APPPADYRSSQAPPPADYRSSSAPPPADYRSSQAPP 216

Query: 96  LEPRLRSISS--ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHE 153
            +                        S    S       P +           S  + + 
Sbjct: 217 HQSGYPPHDPYYGHPPPPASHDPYYGSSHHGSSYYGAPPPSSPYGSHYAPPPPSSYSPYS 276

Query: 154 YDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH 213
           +                      +     P      S + +    +              
Sbjct: 277 HAPPPPSPYHGYSHAPPPPSPYSSYDRYAPPPPAAASPYGHPPPASHDPYYGSQYAPPPP 336

Query: 214 LFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG--------GNVDKKNVFSGI 265
                         A     S G       H+  R S            +       +  
Sbjct: 337 PQSNGAPPPPQTNGAPPPPSSYGAPPPPSQHYDNRGSPPSHGDPYYPPSSSSSTPGTAPP 396

Query: 266 RPKITRRLLEDGSEVDVGPST------IPVADFANTSNIAFKNYIGGDENSTFVLGKKEI 319
            P   R      S+ D  P                         +    +S      +  
Sbjct: 397 PPSYDRYGPPPPSQSDQQPPPHHNGYHQQQPQPQQHQPQGPPPPLSSSTDSRPPPLNQSG 456

Query: 320 EEGNPLIGEGRVFINKGRGQSSILSG 345
                L  + R  + +         G
Sbjct: 457 PSQEELDHQQRSKMREELRAEKFPEG 482



 Score = 73.1 bits (177), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/304 (6%), Positives = 50/304 (16%), Gaps = 9/304 (2%)

Query: 80  ESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCR 139
            S  P          +  P     SS        + ++         +        +   
Sbjct: 165 SSQPPPPRYDQHPQTYAPPPADYRSSQAPPPADYRSSSAPPPADYRSSQAPPHQSGYPPH 224

Query: 140 LREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT 199
                       H+     S   +  +          +     P  S     H       
Sbjct: 225 DPYYGHPPPPASHDPYYGSSHHGSSYYGAPPPSSPYGSHYAPPPPSSYSPYSHAPPPPSP 284

Query: 200 RGLLSFYSALSEHHLFKYF---------VFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
               S        +                       +    Y    +            
Sbjct: 285 YHGYSHAPPPPSPYSSYDRYAPPPPAAASPYGHPPPASHDPYYGSQYAPPPPPQSNGAPP 344

Query: 251 LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
               N       S   P    +  ++                ++++          D   
Sbjct: 345 PPQTNGAPPPPSSYGAPPPPSQHYDNRGSPPSHGDPYYPPSSSSSTPGTAPPPPSYDRYG 404

Query: 311 TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
                + + +      G  +      + Q       +  S         +    + ++  
Sbjct: 405 PPPPSQSDQQPPPHHNGYHQQQPQPQQHQPQGPPPPLSSSTDSRPPPLNQSGPSQEELDH 464

Query: 371 IDNA 374
              +
Sbjct: 465 QQRS 468



 Score = 57.7 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/238 (5%), Positives = 38/238 (15%), Gaps = 2/238 (0%)

Query: 22  RRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKES 81
                Y  ++        S     P +    Q    +      +         +  D   
Sbjct: 182 PPPADYRSSQAPPPADYRSSSAPPPADYRSSQAPPHQSGYPPHDPYYGHPPPPASHDPYY 241

Query: 82  DIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLR 141
                  +            S  +    + +   ++           ++  P        
Sbjct: 242 GSSHHGSSYYGAPPPSSPYGSHYAPPPPSSYSPYSHAPPPPSPYHGYSHAPPPPSPYSSY 301

Query: 142 EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRG 201
           +  +              P +   +  S+            P               + G
Sbjct: 302 DRYAPPPPAAASPYGHPPPASHDPYYGSQYAPPPPPQSNGAPPPPQTNGAPPP--PSSYG 359

Query: 202 LLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
                S   ++               +   +        S   +              
Sbjct: 360 APPPPSQHYDNRGSPPSHGDPYYPPSSSSSTPGTAPPPPSYDRYGPPPPSQSDQQPPP 417



 Score = 55.8 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/321 (5%), Positives = 37/321 (11%), Gaps = 41/321 (12%)

Query: 92  ENIFLEPRLRSISSILRSNKHKKLANILSVQ--GKSRTNTNLSPKNFSCRLREILSFSVN 149
                    RS             ++              +   +            S +
Sbjct: 96  PPPTPVGDYRSSQPPPPHPVGDYRSSQPPPSYGAPGAAYDDPHRRYDQSGAPPPPPSSAS 155

Query: 150 TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
             H Y    S            +           + +   + +               A 
Sbjct: 156 PPHHYHDLRSSQPPPPRYDQHPQTYAPPPADYRSSQAPPPADYRSSSAPPPADYRSSQAP 215

Query: 210 SEHHLFKYFVFLIILLGMAIGVSY-------------SIGKSKGSITHFLRRESLDGGNV 256
                +                               +   S    +H+           
Sbjct: 216 PHQSGYPPHDPYYGHPPPPASHDPYYGSSHHGSSYYGAPPPSSPYGSHYAPPPPSSYSPY 275

Query: 257 DKKNVFSGI------------------------RPKITRRLLEDGSEVDVGPSTIPVADF 292
                                                +       +  D    +      
Sbjct: 276 SHAPPPPSPYHGYSHAPPPPSPYSSYDRYAPPPPAAASPYGHPPPASHDPYYGSQYAPPP 335

Query: 293 ANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
              SN A                             G    +         S     +  
Sbjct: 336 PPQSNGAPPPPQTNGAPPPPSSYGAPPPPSQHYDNRGSPPSHGDPYYPPSSSSSTPGTAP 395

Query: 353 QEKSQG--LKGLVIKGDIPMI 371
              S          + D    
Sbjct: 396 PPPSYDRYGPPPPSQSDQQPP 416



 Score = 37.7 bits (85), Expect = 4.9,   Method: Composition-based stats.
 Identities = 19/216 (8%), Positives = 34/216 (15%), Gaps = 21/216 (9%)

Query: 129 TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
            +   +      +   + S    + +    +PV      +            S P  S  
Sbjct: 69  HDPYNRPPPPPQQHYDARSSPPSYAHPPPPTPVGDYRSSQPPPPHPVGDYRSSQPPPSYG 128

Query: 189 WSVHNYFFNKTRGLLSFYSA----------------LSEHHLFKYFVFLIILLGMAIGVS 232
                Y     R   S                     S+    +Y               
Sbjct: 129 APGAAYDDPHRRYDQSGAPPPPPSSASPPHHYHDLRSSQPPPPRYDQHPQTYAPPPADYR 188

Query: 233 YSIGKSKGSITHFLRRESLDGGNVDKKNVF---SGIRPKITRRLLEDGSEVDVGPS--TI 287
            S                 D  +              P           +   G S    
Sbjct: 189 SSQAPPPADYRSSSAPPPADYRSSQAPPHQSGYPPHDPYYGHPPPPASHDPYYGSSHHGS 248

Query: 288 PVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGN 323
                   S+    +Y     +S             
Sbjct: 249 SYYGAPPPSSPYGSHYAPPPPSSYSPYSHAPPPPSP 284


>gi|221486573|gb|EEE24834.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 2574

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/351 (7%), Positives = 66/351 (18%), Gaps = 5/351 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              LP +  +  S           +   S    LP +               +     K  
Sbjct: 1844 APLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPT----KPSSSTSAPLPPDPTKPS 1899

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             ++      D  K S ++   +  +P   S S+           ++ +        T  S
Sbjct: 1900 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPS 1959

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVA-AIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
                +    +    S +T        +  + +             +   +          
Sbjct: 1960 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSTSAPLPPDPTKPS 2019

Query: 192  HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
                            + S           +               S  +       +  
Sbjct: 2020 LFTSAPLPPDPTKPSLSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSTAAPLPADPTKPS 2079

Query: 252  DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
               +       +      +  L  D ++     S     D    S+             +
Sbjct: 2080 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPS 2139

Query: 312  FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
                     +           +     + S  +   L     + S      
Sbjct: 2140 LSTSAPLPPDPTKPSSSISAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAP 2190



 Score = 75.4 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 37/422 (8%), Positives = 84/422 (19%), Gaps = 8/422 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
             +LP +  +  S           +   S    LP +               +     K  
Sbjct: 1784 SSLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPT----KSSSSTSAPLPPDPTKPS 1839

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             ++      D  K S ++   +  +P   S S+           +  +        T  S
Sbjct: 1840 LSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPS 1899

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                +    +    S +T        +  ++           K +   S P         
Sbjct: 1900 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPS 1959

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
            +          +  S+ +   L        +     +    +   S  S           
Sbjct: 1960 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSTSAPLPPDPTKPS 2019

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                             T   L          ++ P+       + +    +  D     
Sbjct: 2020 LFTSAPLPPDPTKPSLSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSTAAPLPADPTKPS 2079

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMID 372
                  +                              S                 +P   
Sbjct: 2080 SSTSAPLPPDPTKPSSSTSAPLP----PDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDP 2135

Query: 373  NAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNI 432
               S S +     D +   + +   +   P +   +          K  +S S  +  + 
Sbjct: 2136 TKPSLSTSAPLPPDPTKPSSSISAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDP 2195

Query: 433  FV 434
              
Sbjct: 2196 TK 2197



 Score = 74.7 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/331 (7%), Positives = 55/331 (16%), Gaps = 5/331 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              LP +  +  S           +   S    LP +               +     K  
Sbjct: 1889 APLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPT----KPSSSTSAPLPPDPTKPS 1944

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             ++      D  K S ++   +  +P   S S+           ++ +        T  S
Sbjct: 1945 LSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPS 2004

Query: 133  PKNFSC-RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
                +             +         P  +                 +          
Sbjct: 2005 SSTSAPLPPDPTKPSLFTSAPLPPDPTKPSLSTSAPLPPDPTKPSLSTSAPLPPDPTKPS 2064

Query: 192  HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
             +             S+ S                           S  +       +  
Sbjct: 2065 SSTAAPLPADPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPS 2124

Query: 252  DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
               +       +      +  L  D ++     S     D    S+             +
Sbjct: 2125 SSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSISAPLPPDPTKPSSSTSAPLPPDPTKPS 2184

Query: 312  FVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
                     +                     
Sbjct: 2185 SSTSAPLPPDPTKPSSSTSAPRPPEPLDPGA 2215



 Score = 56.2 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/325 (8%), Positives = 65/325 (20%), Gaps = 5/325 (1%)

Query: 40   SMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPR 99
            S    LP +               +     K    +      D  K S+++   +  +P 
Sbjct: 1991 STSAPLPPDPT----KPSSSTSAPLPPDPTKPSLFTSAPLPPDPTKPSLSTSAPLPPDPT 2046

Query: 100  LRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHE-YDSSV 158
              S+S+           +  +        T  S    +    +    S +T         
Sbjct: 2047 KPSLSTSAPLPPDPTKPSSSTAAPLPADPTKPSSSTSAPLPPDPTKPSSSTSAPLPPDPT 2106

Query: 159  SPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYF 218
             P ++             +   +           +             S++S        
Sbjct: 2107 KPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSISAPLPPDPT 2166

Query: 219  VFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGS 278
                               S  +       +     +  +             +  E+  
Sbjct: 2167 KPSSSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPRPPEPLDPGAVGREKGEEETG 2226

Query: 279  EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
            E +   S         + +++  +   G  +        + E        G        G
Sbjct: 2227 EGERIVSDSGEKVAEVSPDLSETSLSSGSSSYAQARELSQPELQTSEEKAGDAEKKAEAG 2286

Query: 339  QSSILSGKILWSLQQEKSQGLKGLV 363
            +        L  +    +       
Sbjct: 2287 EDKPKIASSLLGVTSLGASNAAPPA 2311



 Score = 43.8 bits (101), Expect = 0.069,   Method: Composition-based stats.
 Identities = 29/321 (9%), Positives = 63/321 (19%), Gaps = 4/321 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
              LP +  +  S           +   S    LP +               +     K  
Sbjct: 2054 APLPPDPTKPSSSTAAPLPADPTKPSSSTSAPLPPDPT----KPSSSTSAPLPPDPTKPS 2109

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             ++      D  K S ++   +  +P   S+S+           +           T  S
Sbjct: 2110 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSLSTSAPLPPDPTKPSSSISAPLPPDPTKPS 2169

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                +    +    S +T        +  ++               +             
Sbjct: 2170 SSTSAPLPPDPTKPSSSTSAPLPPDPTKPSSSTSAPRPPEPLDPGAVGREKGEEETGEGE 2229

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                +    +      LSE  L            ++     +  +  G            
Sbjct: 2230 RIVSDSGEKVAEVSPDLSETSLSSGSSSYAQARELSQPELQTSEEKAGDAEKKAEAGEDK 2289

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                      + +                       V   A +   +     G   + T 
Sbjct: 2290 PKIASSLLGVTSLGASNAAPPASSPFGGSTTSPFAAVGPQAGSPFSSQAPSFGSVSSQTA 2349

Query: 313  VLGKKEIEEGNPLIGEGRVFI 333
                    +  P  G   +F 
Sbjct: 2350 GSFFTGTFDTKPSAGGSSLFG 2370


>gi|1160355|gb|AAB00542.1| UNC-89 [Caenorhabditis elegans]
          Length = 6632

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/342 (9%), Positives = 85/342 (24%), Gaps = 16/342 (4%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             E TPE+     +           + K + P++ +  +     +     EK  +K    +
Sbjct: 1528 KEKTPEKVDEKPKS---------PTKKDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPT 1578

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            K++K  + P S     EN    P  +  S      +  K     S +       + + K 
Sbjct: 1579 KKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKE 1638

Query: 136  FSCRLREILSFSVNTQHE--YDSSVSPVAAIEHDKSRLRRGKLAGIFSFP-----TGSIF 188
             S            T+ E   +       +    +S   +     + S         ++ 
Sbjct: 1639 KSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVE 1698

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +    +     S    +                            +   +    ++
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTKK 1758

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E     + ++K      +     ++ +D  +        P       ++   K       
Sbjct: 1759 EKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKKEKTPEKS 1818

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
             +  +    + E+      +     +K +            +
Sbjct: 1819 AAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT 1860



 Score = 65.0 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/404 (7%), Positives = 76/404 (18%), Gaps = 38/404 (9%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPK--------------------- 47
            ++  D + E +P +     E +          +K                          
Sbjct: 1452 KKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSETTIEKTETTM 1511

Query: 48   -------EILERQFNKLEQAILQVEKQNQKSLHTSKQDK--------ESDIPKSSVTSKE 92
                       R   K E+   +V+++ +      K  +             + S    E
Sbjct: 1512 TTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSPVKKEKSPEKVE 1571

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN-LSPKNFSCRLREILSFSVNTQ 151
                 P  +  S    ++  KK  N +    K   +      +       +    + +  
Sbjct: 1572 EKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKP 1631

Query: 152  HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                           +  +    K              +       K            E
Sbjct: 1632 KSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKE 1691

Query: 212  HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                                  S+ +   S       ++ +      K   S  +     
Sbjct: 1692 KSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEE 1751

Query: 272  RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD-ENSTFVLGKKEIEEGNPLIGEGR 330
                   E     S             +       + ++ T      E  E  P     +
Sbjct: 1752 VKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKK 1811

Query: 331  VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                +      + S           ++       +      +  
Sbjct: 1812 EKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEK 1855


>gi|302528592|ref|ZP_07280934.1| predicted protein [Streptomyces sp. AA4]
 gi|302437487|gb|EFL09303.1| predicted protein [Streptomyces sp. AA4]
          Length = 5049

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/319 (7%), Positives = 56/319 (17%), Gaps = 12/319 (3%)

Query: 55   NKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKE-----NIFLEPRLRSISSILRS 109
            N    A   V+  N     ++     S      ++  +     N    P L S +     
Sbjct: 727  NPAPSAPDSVKAGNPAPPPSAHDSVGSRDATPPLSRPDSGTTGNPPANPDLTSTNGRPSL 786

Query: 110  NKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKS 169
              H                              +          + +  +  +   H   
Sbjct: 787  VGHPVSPPTPQHDTGLPGFGGHQNAAPHPATDPVPVNGPANPVAHSNPETAPSPSGHATP 846

Query: 170  RLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAI 229
                         P  +   +      +                                
Sbjct: 847  GPATNASPNPSLSPNVTPSPNPSTDRASGVNPSPDSVRTPGPTTGPNSPASTDPKPVPPP 906

Query: 230  ------GVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                  G+  +   +  +        +             G          +        
Sbjct: 907  TSTSVKGIDSTPSPAPKTTVDGPSPATPGPSPAQTAVPHPGSTTGSPTPTADPTPGTHPN 966

Query: 284  PSTIPVADFANTSNIAFKNY-IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSI 342
            P + P +D     N A           ST    +  ++  +P                S 
Sbjct: 967  PVSTPDSDTKPGPNPAVAPDLASKSGPSTQPNPESVVKPASPPESATHPTPTPNPVAHSS 1026

Query: 343  LSGKILWSLQQEKSQGLKG 361
             + ++  + +   +     
Sbjct: 1027 SAAELTPTPRSASTPSPAA 1045



 Score = 72.0 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/376 (5%), Positives = 59/376 (15%), Gaps = 14/376 (3%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
            D  P  +        + A               P        N            + K+ 
Sbjct: 637  DATPPASAPDPGETGDPASPPSTPDSVKTGNPAPPPSTPDSVNAENPTPPPSTPDSVKTD 696

Query: 73   HTSKQDKESD-----------IPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
            + +      D               +V +       P      +                
Sbjct: 697  NPAPPPSTPDSVKTGNPAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAHDSVGSRDA 756

Query: 122  QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
                    + +  N         +    +   +  S                   A   +
Sbjct: 757  TPPLSRPDSGTTGNPPANPDLTSTNGRPSLVGHPVSPPTPQHDTGLPGFGGHQNAAPHPA 816

Query: 182  FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                 +    +    +      S     +            +   +    + S  ++ G 
Sbjct: 817  TDPVPVNGPANPVAHSNPETAPSPSGHATPGPATNASPNPSLSPNVTPSPNPSTDRASGV 876

Query: 242  ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGS-EVDVGPSTIPVADFANTSNIAF 300
                    +            +  +P            +    P+     D  + +    
Sbjct: 877  NPSPDSVRTPGPTTGPNSPASTDPKPVPPPTSTSVKGIDSTPSPAPKTTVDGPSPATPGP 936

Query: 301  KNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ--G 358
                    +     G                            +  +   L  +      
Sbjct: 937  SPAQTAVPHPGSTTGSPTPTADPTPGTHPNPVSTPDSDTKPGPNPAVAPDLASKSGPSTQ 996

Query: 359  LKGLVIKGDIPMIDNA 374
                 +       ++A
Sbjct: 997  PNPESVVKPASPPESA 1012



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/350 (8%), Positives = 60/350 (17%), Gaps = 9/350 (2%)

Query: 44   RLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSI 103
              P        N    ++         +   S   K    P S+     +    P  ++ 
Sbjct: 866  PNPSTDRASGVNPSPDSVRTPGPTTGPNSPASTDPKPVPPPTSTSVKGIDSTPSPAPKTT 925

Query: 104  SSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA 163
                            +V     T  + +P             S             VA 
Sbjct: 926  VDGPSPATPGPSPAQTAVPHPGSTTGSPTPTADPTPGTHPNPVSTPDSDTKPGPNPAVAP 985

Query: 164  IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLII 223
                KS             P      + H           S  + L+             
Sbjct: 986  DLASKSGPSTQPNPESVVKPASPPESATHPTPTPNPVAHSSSAAELTPTP-----RSAST 1040

Query: 224  LLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVG 283
                A   + +               +         N  +   P  T     +       
Sbjct: 1041 PSPAAKSATPTPDTRPTPTPSPATNPNPAVKPAPTPNPVTNPNPDTTPPPKPNTDPASPK 1100

Query: 284  PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
            P+  P +           +     +              + +           +   +  
Sbjct: 1101 PAAEPTSGSPTPQLPKNGSAPSPAKPIGTEPTPAPRSRDDAVSHRDNPTDASRKSVPAAN 1160

Query: 344  SGKILWSLQQEKSQGLK----GLVIKGDIPMIDNAFSASMTLKCNADISL 389
                  +    K                 P+ D   S   +   N    +
Sbjct: 1161 RQSSTPAAAAAKPGKPTTVANPPQRDAHAPVPDKPVSGPDSSGRNLHTPV 1210



 Score = 54.2 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/297 (5%), Positives = 41/297 (13%), Gaps = 9/297 (3%)

Query: 74  TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
                       +   S             ++   S          +    +  +     
Sbjct: 608 PGTSATPPSGTTTHPESTPANQGGNGTDHDATPPASAPDPGETGDPASPPSTPDSVKTGN 667

Query: 134 KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
                   + ++    T                  S     K       P+        N
Sbjct: 668 PAPPPSTPDSVNAENPTPPPSTPDSVKTDNPAPPPSTPDSVKTGNPAPPPSAPDAVKTGN 727

Query: 194 YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
              +     +   +                   ++   S + G    +            
Sbjct: 728 PAPSAP-DSVKAGNPAPPPSAHDSVGSRDATPPLSRPDSGTTGNPPANPDLTSTNGRPSL 786

Query: 254 GNVDKKNVFSGIRP--------KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                                 +              GP+         T+     +   
Sbjct: 787 VGHPVSPPTPQHDTGLPGFGGHQNAAPHPATDPVPVNGPANPVAHSNPETAPSPSGHATP 846

Query: 306 GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
           G   +                              S+ +           S   K +
Sbjct: 847 GPATNASPNPSLSPNVTPSPNPSTDRASGVNPSPDSVRTPGPTTGPNSPASTDPKPV 903



 Score = 50.0 bits (117), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/289 (4%), Positives = 49/289 (16%), Gaps = 2/289 (0%)

Query: 72  LHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNL 131
             +      ++ P  + +S              +      +    +      +    +  
Sbjct: 511 PASPSGPNSANHPNPADSSGSATPSNSANTPSGNSHPVTSNTPTNDSEGNLVQGAPGSTP 570

Query: 132 SPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV 191
                        S +        ++    +   +          +G  + P  +     
Sbjct: 571 PHGENHNGTYLSGSQNSTNSTGPAATAGNQSTNPNSNPGTSATPPSGTTTHPESTPANQG 630

Query: 192 HNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESL 251
            N   +      S                   +         S   S             
Sbjct: 631 GNGTDHDATPPASAPDPGETGDPASPPSTPDSVKTGNPAPPPSTPDSV--NAENPTPPPS 688

Query: 252 DGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENST 311
              +V   N         + +            +        +  +           ++ 
Sbjct: 689 TPDSVKTDNPAPPPSTPDSVKTGNPAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAH 748

Query: 312 FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLK 360
             +G ++          G           +  +G+             +
Sbjct: 749 DSVGSRDATPPLSRPDSGTTGNPPANPDLTSTNGRPSLVGHPVSPPTPQ 797



 Score = 49.2 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/254 (3%), Positives = 35/254 (13%)

Query: 70  KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
            +   S          ++ +   +        + S                        +
Sbjct: 523 PNPADSSGSATPSNSANTPSGNSHPVTSNTPTNDSEGNLVQGAPGSTPPHGENHNGTYLS 582

Query: 130 NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                  S              +    + +   +              G  +    +   
Sbjct: 583 GSQNSTNSTGPAATAGNQSTNPNSNPGTSATPPSGTTTHPESTPANQGGNGTDHDATPPA 642

Query: 190 SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
           S  +                 +             +                  +     
Sbjct: 643 SAPDPGETGDPASPPSTPDSVKTGNPAPPPSTPDSVNAENPTPPPSTPDSVKTDNPAPPP 702

Query: 250 SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
           S                P   +      S  D   +  P    +   ++  ++       
Sbjct: 703 STPDSVKTGNPAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAHDSVGSRDATPPLSR 762

Query: 310 STFVLGKKEIEEGN 323
                        +
Sbjct: 763 PDSGTTGNPPANPD 776



 Score = 49.2 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/292 (6%), Positives = 45/292 (15%), Gaps = 10/292 (3%)

Query: 84  PKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREI 143
           P ++  ++          S +    +  H +          +  +               
Sbjct: 593 PAATAGNQSTNPNSNPGTSATPPSGTTTHPESTPANQGGNGTDHDATPPASAPDPGETGD 652

Query: 144 LSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP-----TGSIFWSVHNYFFNK 198
            +   +T     +          D                           +  +     
Sbjct: 653 PASPPSTPDSVKTGNPAPPPSTPDSVNAENPTPPPSTPDSVKTDNPAPPPSTPDSVKTGN 712

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDK 258
                S   A+   +        +     A   S          T  L R          
Sbjct: 713 PAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAHDSVGSRDATPPLSRPDSGTTGNPP 772

Query: 259 KNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKE 318
            N            +    S       T       + +            N         
Sbjct: 773 ANPDLTSTNGRPSLVGHPVSPPTPQHDTGLPGFGGHQNAAPHPATDPVPVNGPANPVAHS 832

Query: 319 IEEGNPLIGEGRVFINKGRGQSSI-----LSGKILWSLQQEKSQGLKGLVIK 365
             E  P                +      ++     S  +          ++
Sbjct: 833 NPETAPSPSGHATPGPATNASPNPSLSPNVTPSPNPSTDRASGVNPSPDSVR 884



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/292 (6%), Positives = 41/292 (14%), Gaps = 4/292 (1%)

Query: 87  SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146
           S         +    + +    +               ++                    
Sbjct: 590 STGPAATAGNQSTNPNSNPGTSATPPSGTTTHPESTPANQGGNGTDHDATPPASAPDPGE 649

Query: 147 SVNTQHEYDSSVSPVAAIEHDKSR-LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
           + +      +  S                        P+        N     +      
Sbjct: 650 TGDPASPPSTPDSVKTGNPAPPPSTPDSVNAENPTPPPSTPDSVKTDNPAPPPSTPDSVK 709

Query: 206 YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE-SLDGGNVDKKNVFSG 264
               +        V        A     +   +     H                +  +G
Sbjct: 710 TGNPAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAHDSVGSRDATPPLSRPDSGTTG 769

Query: 265 IRPKITRRLLEDGSEVDVGPSTIPVADFANT--SNIAFKNYIGGDENSTFVLGKKEIEEG 322
             P        +G    VG    P     +T                +  V         
Sbjct: 770 NPPANPDLTSTNGRPSLVGHPVSPPTPQHDTGLPGFGGHQNAAPHPATDPVPVNGPANPV 829

Query: 323 NPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                E     +         +     SL    +        +         
Sbjct: 830 AHSNPETAPSPSGHATPGPATNASPNPSLSPNVTPSPNPSTDRASGVNPSPD 881



 Score = 47.7 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/328 (7%), Positives = 59/328 (17%), Gaps = 18/328 (5%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
            D  P   P     +   +  S     ES+                   +       + + 
Sbjct: 974  DTKPGPNPAVAPDLASKSGPSTQPNPESVVKPASPPESATHPTPTPNPVAHSSSAAELTP 1033

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLR-----SISSILRSNKHKKLANILSVQGKSRT 127
                    S   KS+  + +                     +       N  +       
Sbjct: 1034 TPRSASTPSPAAKSATPTPDTRPTPTPSPATNPNPAVKPAPTPNPVTNPNPDTTPPPKPN 1093

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                SPK  +       +  +       S   P+        R R   ++   +    S 
Sbjct: 1094 TDPASPKPAAEPTSGSPTPQLPKNGSAPSPAKPIGTEPTPAPRSRDDAVSHRDNPTDASR 1153

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKS--------- 238
                     + T    +                    +                      
Sbjct: 1154 KSVPAANRQSSTPAAAAAKPGKPTTVANPPQRDAHAPVPDKPVSGPDSSGRNLHTPVAAP 1213

Query: 239  ----KGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
                  +     +  + +  N    N  +  +   T    +  +      +    A  A 
Sbjct: 1214 KKPAAAANPQSGKPPAPEKPNPQSDNPIAAPKKPATPANPQSSNLHTPIAAPKKPAAPAK 1273

Query: 295  TSNIAFKNYIGGDENSTFVLGKKEIEEG 322
              +          + +T        +  
Sbjct: 1274 PQSSLHTPVAAPKKPATGPGPNVGKQPP 1301



 Score = 46.5 bits (108), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/286 (8%), Positives = 47/286 (16%), Gaps = 2/286 (0%)

Query: 86  SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILS 145
            +  S  N    P     S     +      +  S    S T TN S  N          
Sbjct: 511 PASPSGPNSANHPNPADSSGSATPSNSANTPSGNSHPVTSNTPTNDSEGNLVQGAPGSTP 570

Query: 146 FSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSF 205
                 +    S S  +      +     +     S P  S           ++      
Sbjct: 571 PHGENHNGTYLSGSQNSTNSTGPAATAGNQSTNPNSNPGTSATPPSGTTTHPESTPANQG 630

Query: 206 YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
            +                  G                 +     S       +       
Sbjct: 631 GNGTDHDATPPASAPDPGETGDPAS--PPSTPDSVKTGNPAPPPSTPDSVNAENPTPPPS 688

Query: 266 RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
            P   +                       ++  A K           V         +  
Sbjct: 689 TPDSVKTDNPAPPPSTPDSVKTGNPAPPPSAPDAVKTGNPAPSAPDSVKAGNPAPPPSAH 748

Query: 326 IGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
              G         +    +     +     S   +  ++   +   
Sbjct: 749 DSVGSRDATPPLSRPDSGTTGNPPANPDLTSTNGRPSLVGHPVSPP 794



 Score = 38.8 bits (88), Expect = 2.4,   Method: Composition-based stats.
 Identities = 25/278 (8%), Positives = 56/278 (20%), Gaps = 1/278 (0%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
                  TP   S     A+++         P            K       V   N  + 
Sbjct: 1028 AAELTPTPRSASTPSPAAKSATPTPDTRPTPTPSPATNPNPAVKPAPTPNPVTNPNPDTT 1087

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
               K + +   PK +          P+L    S     K        + + +    ++  
Sbjct: 1088 PPPKPNTDPASPKPAAEPTSGSPT-PQLPKNGSAPSPAKPIGTEPTPAPRSRDDAVSHRD 1146

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                + R     +   ++     ++         +  +                      
Sbjct: 1147 NPTDASRKSVPAANRQSSTPAAAAAKPGKPTTVANPPQRDAHAPVPDKPVSGPDSSGRNL 1206

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
            +      +   +  +  S                +A     +   +  S        +  
Sbjct: 1207 HTPVAAPKKPAAAANPQSGKPPAPEKPNPQSDNPIAAPKKPATPANPQSSNLHTPIAAPK 1266

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
                  K   S   P    +    G   +VG       
Sbjct: 1267 KPAAPAKPQSSLHTPVAAPKKPATGPGPNVGKQPPVTG 1304



 Score = 37.3 bits (84), Expect = 5.5,   Method: Composition-based stats.
 Identities = 9/155 (5%), Positives = 28/155 (18%)

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               T     ++  P+    SK N+    +    +    S++   +      +      T 
Sbjct: 1992 PAPTPPPRLDNPRPEPGPDSKPNLHTPIKAPQDAKQPGSSQDAHVEPGPDTKPTPHNPTT 2051

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +         +          + +       +    +    +           G     
Sbjct: 2052 GAQDPKQPGSTQDAHVQSEPSTKPNPHTPTTTSQGAKQPGSSQTSHQSPRHEHDGEPTPQ 2111

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
                       +    +                L 
Sbjct: 2112 APTRSQQDAVLVADEQTDKEPEEAPDTRPLADRLP 2146


>gi|71980604|ref|NP_001020990.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|54607254|gb|AAV34801.1| Uncoordinated protein 89, isoform g, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 7122

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/342 (9%), Positives = 85/342 (24%), Gaps = 16/342 (4%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
             E TPE+     +           + K + P++ +  +     +     EK  +K    +
Sbjct: 1528 KEKTPEKVDEKPKS---------PTKKDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPT 1578

Query: 76   KQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKN 135
            K++K  + P S     EN    P  +  S      +  K     S +       + + K 
Sbjct: 1579 KKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKE 1638

Query: 136  FSCRLREILSFSVNTQHE--YDSSVSPVAAIEHDKSRLRRGKLAGIFSFP-----TGSIF 188
             S            T+ E   +       +    +S   +     + S         ++ 
Sbjct: 1639 KSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVE 1698

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
                +    +     S    +                            +   +    ++
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTKK 1758

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
            E     + ++K      +     ++ +D  +        P       ++   K       
Sbjct: 1759 EKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKKEKTPEKS 1818

Query: 309  NSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
             +  +    + E+      +     +K +            +
Sbjct: 1819 AAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT 1860



 Score = 65.0 bits (156), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/404 (7%), Positives = 76/404 (18%), Gaps = 38/404 (9%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPK--------------------- 47
            ++  D + E +P +     E +          +K                          
Sbjct: 1452 KKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSETTIEKTETTM 1511

Query: 48   -------EILERQFNKLEQAILQVEKQNQKSLHTSKQDK--------ESDIPKSSVTSKE 92
                       R   K E+   +V+++ +      K  +             + S    E
Sbjct: 1512 TTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSPVKKEKSPEKVE 1571

Query: 93   NIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN-LSPKNFSCRLREILSFSVNTQ 151
                 P  +  S    ++  KK  N +    K   +      +       +    + +  
Sbjct: 1572 EKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKP 1631

Query: 152  HEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSE 211
                           +  +    K              +       K            E
Sbjct: 1632 KSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKE 1691

Query: 212  HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                                  S+ +   S       ++ +      K   S  +     
Sbjct: 1692 KSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEE 1751

Query: 272  RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD-ENSTFVLGKKEIEEGNPLIGEGR 330
                   E     S             +       + ++ T      E  E  P     +
Sbjct: 1752 VKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEKVEEKPASPTKK 1811

Query: 331  VFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNA 374
                +      + S           ++       +      +  
Sbjct: 1812 EKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEK 1855


>gi|218514056|ref|ZP_03510896.1| hypothetical protein Retl8_10302 [Rhizobium etli 8C-3]
          Length = 182

 Score = 76.2 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 71/174 (40%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1   MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           I +VE ++ ++L   +       P+       +   EP      ++             +
Sbjct: 61  IREVEGEHSEALSVDEAAVAIAAPEPVEEHAAHGESEPAPGPQPAVDEPVDQADAEPPAA 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRG 174
                      +    +                 + ++  +      ++     
Sbjct: 121 EVVDEPDRVEPAAPQGAAEEVVAEDVEPAEPQPAEPALVEIPVSTETEAPPEPY 174


>gi|297681174|ref|XP_002818341.1| PREDICTED: LOW QUALITY PROTEIN: protein piccolo-like [Pongo abelii]
          Length = 5129

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/304 (6%), Positives = 46/304 (15%), Gaps = 1/304 (0%)

Query: 28  EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
           +HA+  + R     + +    +         Q+  +   Q         Q    +  +  
Sbjct: 268 DHAKLPLQRDASRPQTKQADIVRGESVKPSLQSPSKPPIQQPTPGKPPAQQPGHEKSQPG 327

Query: 88  VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
                                     +         +         +        +    
Sbjct: 328 PAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTKPPAQPVGPAKPPAQPTGSEKPSLEQP- 386

Query: 148 VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
                     V    A +  +++    ++             S           +     
Sbjct: 387 GPKALAQPPGVGKTPAQQPGQAKPPTQQVGTPKPLAQQPGPQSPAKAPGPAKTPVQQPGP 446

Query: 208 ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
                             G    +S   G +K         +         K       P
Sbjct: 447 GKIPAQQAGPGKTSAQQTGPTKPLSQLPGPAKPPPQQPGSAKPPPQQPGSTKPSAQQPSP 506

Query: 268 KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
                     ++                S             S    GK           
Sbjct: 507 AKPSAQQPGSAKPPSQQPGSAKPSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTMSPSA 566

Query: 328 EGRV 331
           +   
Sbjct: 567 KQPP 570



 Score = 74.7 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/356 (7%), Positives = 63/356 (17%), Gaps = 7/356 (1%)

Query: 37  RLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96
            L+   P       + +  K +        Q       +   K      +S    +   +
Sbjct: 229 PLQQDGPPKSVSSQQPEKIKSQPPGTGKPIQGPAQTSQTDHAKLPLQRDASRPQTKQADI 288

Query: 97  EPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDS 156
                   S+   +K              +     S    +    +    +     +  +
Sbjct: 289 VRGESVKPSLQSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGT 348

Query: 157 SVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFK 216
              PV      K   +    A   + PTGS   S+                  ++     
Sbjct: 349 VKPPVQPPGTTKPPAQPVGPAKPPAQPTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGQA 408

Query: 217 YFVFL---IILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRL 273
                               S  K+ G     +++         +         +     
Sbjct: 409 KPPTQQVGTPKPLAQQPGPQSPAKAPGPAKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTK 468

Query: 274 LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGE----G 329
                     P                       + S      ++     P   +     
Sbjct: 469 PLSQLPGPAKPPPQQPGSAKPPPQQPGSTKPSAQQPSPAKPSAQQPGSAKPPSQQPGSAK 528

Query: 330 RVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNA 385
                    + S        S            +              ++   CN 
Sbjct: 529 PSAQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTMSPSAKQPPSQGLPKTICPLCNT 584



 Score = 53.1 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/300 (5%), Positives = 39/300 (13%), Gaps = 7/300 (2%)

Query: 79  KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
                 + +   ++ +  E       +   S +                     P     
Sbjct: 181 DSEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPVPKQQGPGRDPLQQDGPPKSVS 240

Query: 139 RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +     S               +         +   +   +     +           
Sbjct: 241 SQQPEKIKSQPPGTGKPIQGPAQTSQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQS 300

Query: 199 TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES--LDGGNV 256
                       +    +                 S      +      +      G   
Sbjct: 301 PSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTK 360

Query: 257 DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVL-- 314
                    +P       E  S    GP  +        +                    
Sbjct: 361 PPAQPVGPAKPPAQPTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGQAKPPTQQVGTPKP 420

Query: 315 ---GKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                                   G G+          +  Q+         + G     
Sbjct: 421 LAQQPGPQSPAKAPGPAKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPLSQLPGPAKPP 480



 Score = 47.3 bits (110), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/310 (7%), Positives = 55/310 (17%), Gaps = 6/310 (1%)

Query: 101 RSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSP 160
              S    + K K +              +          ++        Q     SVS 
Sbjct: 182 SEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPVPKQQGPGRDPLQQDGPPKSVSS 241

Query: 161 VAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVF 220
               +        GK     +  + +    +                   E         
Sbjct: 242 QQPEKIKSQPPGTGKPIQGPAQTSQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLQSP 301

Query: 221 LIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD--KKNVFSGIRPKITRRLLEDGS 278
               +           +     +      +          K +                +
Sbjct: 302 SKPPIQQPTPGKPPAQQPGHEKSQPG--PAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTT 359

Query: 279 EVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRG 338
           +    P          T +        G +      G  +     P  G+ +    +   
Sbjct: 360 KPPAQPVGPAKPPAQPTGSEKPSLEQPGPKALAQPPGVGKTPAQQP--GQAKPPTQQVGT 417

Query: 339 QSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIM 398
              +       S  +        +   G   +         T       +  ++ +    
Sbjct: 418 PKPLAQQPGPQSPAKAPGPAKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPLSQLPGPA 477

Query: 399 FSFPKESQDA 408
              P++   A
Sbjct: 478 KPPPQQPGSA 487



 Score = 46.2 bits (107), Expect = 0.013,   Method: Composition-based stats.
 Identities = 32/371 (8%), Positives = 84/371 (22%), Gaps = 14/371 (3%)

Query: 9    QRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +RA+       P       + A  +    +    P+  +   ++     +  + +  +  
Sbjct: 633  KRALGGDLAPVPSSPQPKPKTAPVTATSAVSKSSPQPQQTSPKKDAAPKQD-LSKAPEPK 691

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            +      +          +    E I  +P L         ++          +    T 
Sbjct: 692  KPPPLVKQPTLHGSASAKAKQPXEQILRQPALPKNFCPSEHDRPCADDKPKQPKMVKPTT 751

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
              +S  + + +     S   +   E  +      + +  +S    G+    F        
Sbjct: 752  DLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKAIPRP 811

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRR 248
             S      +      S      +    K               +  + K   +       
Sbjct: 812  ASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPVPKGSPTPPGPRPT 871

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF-----------ANTSN 297
                     +         + +  L          P+T                 +  SN
Sbjct: 872  AGQTVPTPQQSPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASN 931

Query: 298  IAFKNYIGGDENSTFV--LGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
            +       G  + +      K+      P I +G          +   S  +    +   
Sbjct: 932  LISTAGQPGPHSQSGPGAPMKQAPAPSQPPISQGTPKSTGQAPPAPAKSISVKKETKAPA 991

Query: 356  SQGLKGLVIKG 366
            ++ L+    + 
Sbjct: 992  AEKLEPKAEQA 1002



 Score = 44.6 bits (103), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/320 (8%), Positives = 71/320 (22%), Gaps = 7/320 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES-----DIPKSSVTSKENIFLEPRLRSISS 105
           E +  ++   + + +   + S+  +  +  S     ++  S    +     +P   +   
Sbjct: 50  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPG 109

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIE 165
           + +S       +   + G+S +  +L         +E    S+      + +     +  
Sbjct: 110 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDFKEEHKSSMMPGFLSEVNPLSAVSSV 169

Query: 166 HDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILL 225
            +K            S    +    V      K  G+    S                  
Sbjct: 170 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGITKPPSQQQPPKPVPKQQGPGRDP 229

Query: 226 GMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIR--PKITRRLLEDGSEVDVG 283
               G   S+   +          +        +   +     P           + D+ 
Sbjct: 230 LQQDGPPKSVSSQQPEKIKSQPPGTGKPIQGPAQTSQTDHAKLPLQRDASRPQTKQADIV 289

Query: 284 PSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSIL 343
                     + S    +    G   +     +K          +          Q   +
Sbjct: 290 RGESVKPSLQSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTV 349

Query: 344 SGKILWSLQQEKSQGLKGLV 363
              +      +      G  
Sbjct: 350 KPPVQPPGTTKPPAQPVGPA 369


>gi|123232573|emb|CAM24264.1| titin [Mus musculus]
 gi|123232655|emb|CAM23453.1| titin [Mus musculus]
          Length = 8268

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/363 (8%), Positives = 74/363 (20%), Gaps = 25/363 (6%)

Query: 16   PENTPERRSHI--YEHARNS------------------VARRLESMKPRLPKEILERQFN 55
                PE    I   E  R +                  V  + + + P++P+ +  +   
Sbjct: 7174 APKAPEVPKKITPEEKVREAVPKKPEVPPPKVPEAPREVVAKKKVLPPQVPEVVPVKVPG 7233

Query: 56   KLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKL 115
              ++ + + +   +     + +          V  ++ + L P  +  +  +   +  K 
Sbjct: 7234 APKEVVSERKSLEEPPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPKE 7293

Query: 116  ANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGK 175
                            +P        + +                 AA   +  +    +
Sbjct: 7294 VVPEKKVSVVPPKKPEAPPAKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQ 7353

Query: 176  LAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSI 235
                 + P       +      KTR +                    +   +        
Sbjct: 7354 KKIPEAIPPKPESPPLEETVPEKTRPMAPPK-----KPEATTLPVPEVQETVPEKTRPVG 7408

Query: 236  GKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
               K   T     E  +      +      +P+ T        +                
Sbjct: 7409 PPKKPEATTVPVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRPEATTVP 7468

Query: 296  SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
               A +  +   +       K E            V   K                  E 
Sbjct: 7469 VPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEA 7528

Query: 356  SQG 358
             + 
Sbjct: 7529 PEE 7531



 Score = 74.3 bits (180), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/362 (6%), Positives = 72/362 (19%), Gaps = 21/362 (5%)

Query: 21   ERRSHIYEHARNSV-ARRLESMKPR---LPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76
            E  + + E  + +V   ++ + +      PK     +    E+ + +   +  +      
Sbjct: 7146 EPPAKVPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITPEEKVREAVPKKPEVPPPKV 7205

Query: 77   QDKESDIPK---------------SSVTSKENIFLEPRLRSISSILRSNKHKKLANILSV 121
             +   ++                     + + +  E +         + +   +      
Sbjct: 7206 PEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEPPKKPAVRPVTVPEEPKE 7265

Query: 122  --QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
                K  +                    V  + +              K      K+   
Sbjct: 7266 VIPEKKVSLVPPKKPAAPPVTVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKKVVPE 7325

Query: 180  FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
               P  +                 +         +        +   +           K
Sbjct: 7326 KKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEETVPEKTRPMAPPKK 7385

Query: 240  GSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIA 299
               T     E  +      + V    +P+ T   + +  E     +          +   
Sbjct: 7386 PEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPAAPPKKPEATAV 7445

Query: 300  FKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGL 359
             +               +      P   +  V   K              ++ +E  + +
Sbjct: 7446 PETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVI 7505

Query: 360  KG 361
              
Sbjct: 7506 PE 7507



 Score = 74.3 bits (180), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/315 (6%), Positives = 56/315 (17%), Gaps = 1/315 (0%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +  +      PE         +   A   +   P L + + E+          +      
Sbjct: 7334 KKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEETVPEKTRPMAPPKKPEATTLPV 7393

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
              +  +  +K   +          + +     +I    R     K     +V       T
Sbjct: 7394 PEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKT 7453

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                         +     +     +  V  V   + +   +   +              
Sbjct: 7454 RPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLV 7513

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY-SIGKSKGSITHFLRR 248
                          +     SE                 +  +   +   K       ++
Sbjct: 7514 PPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKK 7573

Query: 249  ESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDE 308
                   V +    +    K+     +      V     P                    
Sbjct: 7574 PEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAP 7633

Query: 309  NSTFVLGKKEIEEGN 323
             +      K      
Sbjct: 7634 AAEVPEVPKAAVPQK 7648



 Score = 70.8 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/386 (6%), Positives = 72/386 (18%), Gaps = 17/386 (4%)

Query: 16   PENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE-----------QAILQV 64
            P   PE    +    + S+    +   P +      ++    +               +V
Sbjct: 7256 PVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPKEVVPEKKVSVVPPKKPEAPPAKV 7315

Query: 65   EKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS-SILRSNKHKKLANILSVQG 123
             +  +K +   K    +     +  ++     +  +           K +      +V  
Sbjct: 7316 PEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEETVPE 7375

Query: 124  KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
            K+R          +      +  +V  +           A       ++           
Sbjct: 7376 KTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPAA 7435

Query: 184  TGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
                  +         +          E            ++           K +    
Sbjct: 7436 PPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPI 7495

Query: 244  HFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                             V           + E   EV               +  A    
Sbjct: 7496 TVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPE 7555

Query: 304  IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
               +      +     ++      +      +   +  +         + E         
Sbjct: 7556 APKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKK---KPEAPPVKVPEA 7612

Query: 364  IKGDIPMIDNAFSASMTLKCNADISL 389
             K  +   +     +   K  A  + 
Sbjct: 7613 PKKVV--PEKKLPVAAPKKPEAPAAE 7636



 Score = 70.8 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 16/332 (4%), Positives = 67/332 (20%), Gaps = 18/332 (5%)

Query: 46   PKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI----------------PKSSVT 89
              + +  +   LE+   +   +        K+                      P++   
Sbjct: 7234 APKEVVSERKSLEEPPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPKE 7293

Query: 90   SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVN 149
                      +          K  +    +  + K        P+  +  + E+   +V 
Sbjct: 7294 VVPEKK-VSVVPPKKPEAPPAKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVP 7352

Query: 150  TQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSAL 209
             +   ++      +   +++   + +       P  +             +         
Sbjct: 7353 QKKIPEAIPPKPESPPLEETVPEKTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKK 7412

Query: 210  SEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKI 269
             E            +       +        ++   +  ++       +    +   P+ 
Sbjct: 7413 PEATTVPVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEA 7472

Query: 270  TRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEG 329
             + ++ +     V P  +                     +              P   E 
Sbjct: 7473 DQAVVPEKKVPRVPPKKVEAPPITVPEEPKEV-IPEKKVSLVPPKKPAAPPVTVPEAPEE 7531

Query: 330  RVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                ++               + +   + +  
Sbjct: 7532 VFSEDEETLAPPQEPEAPPAKVPEAPKEVVPE 7563



 Score = 68.5 bits (165), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/278 (6%), Positives = 56/278 (20%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +     P   PE  +      + +V  +   + P    E       ++++ I +  +   
Sbjct: 7376 KTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPAA 7435

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
                         IP+ +         E     +    ++   +K    +  +       
Sbjct: 7436 PPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPI 7495

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
             +  +       + +S     +        P A  E                 P   +  
Sbjct: 7496 TVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPE 7555

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
            +       K   ++      +                          ++         ++
Sbjct: 7556 APKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKK 7615

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTI 287
             +    +          P      +   +         
Sbjct: 7616 VVPEKKLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEA 7653



 Score = 67.7 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/358 (6%), Positives = 78/358 (21%), Gaps = 1/358 (0%)

Query: 34   VARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKEN 93
            +       +     E + R    LE   ++V ++ +       +  E  IP     +K  
Sbjct: 7083 IRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKGPEVSEKVIPPKKPPTKVI 7142

Query: 94   IFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHE 153
               EP  +      ++   +K+      +  +     +  K                   
Sbjct: 7143 PRKEPPAKVPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITPEEKVREAVPKKPEVPP 7202

Query: 154  YDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH 213
                 +P   +   K    +         P              +     +         
Sbjct: 7203 PKVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEPPKKPAVRPVTVPEE 7262

Query: 214  LFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRL 273
              +      + L      +        +    +  + +      K        P+  +++
Sbjct: 7263 PKEVIPEKKVSLVPPKKPAAPPVTVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKKV 7322

Query: 274  LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFI 333
            + +       P                         +     +    E         +  
Sbjct: 7323 VPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEETVPEKTRPMAP 7382

Query: 334  NKGRGQSSILSGKILWSLQQEK-SQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLS 390
             K    +++   ++  ++ ++    G         +P+ +   +     +  A     
Sbjct: 7383 PKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPAAPPKKP 7440



 Score = 61.6 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/372 (7%), Positives = 68/372 (18%), Gaps = 7/372 (1%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLE----QAILQVE 65
            +     P   PE  +      + ++  +     P    E         E    +A  +  
Sbjct: 7403 KTRPVGPPKKPEATTVPVPEVQETIPEKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRP 7462

Query: 66   KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
            +     +  + Q    +     V  K+       +      +   K   L          
Sbjct: 7463 EATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPP 7522

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
             T      + FS     +               +P   +   K  +   K          
Sbjct: 7523 VTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVP 7582

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                 +   +       V     L +A         ++      
Sbjct: 7583 EAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPK 7642

Query: 246  LRRESLDGGNV--DKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNY 303
                          K         +     +      +        A     +    K  
Sbjct: 7643 AAVPQKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPV 7702

Query: 304  IGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLV 363
                     V   +      P + +      K   +        +  + +E     K + 
Sbjct: 7703 PEKKAPPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKPEAPPAKVPEVPKEVVTEKK-VA 7761

Query: 364  IKGDIPMIDNAF 375
            +     +     
Sbjct: 7762 VPKKPEVPPAKV 7773



 Score = 60.8 bits (145), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/357 (7%), Positives = 80/357 (22%), Gaps = 9/357 (2%)

Query: 15   LPENTPER-RSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
            L E  PE+ R         +    +  ++  +P++       K  +A      + Q+++ 
Sbjct: 7369 LEETVPEKTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIP 7428

Query: 74   TSKQDKESDIPKSSVT-----SKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
               +         +        ++     P  R  ++ +   +  +         +    
Sbjct: 7429 EKTRPAAPPKKPEATAVPETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPK 7488

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR-RGKLAGIFSFPTGSI 187
               +P        + +              +       +            +        
Sbjct: 7489 KVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEA 7548

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
              +       +            +                A      +   K      ++
Sbjct: 7549 PPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVK 7608

Query: 248  RESLDGGNVDKK--NVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                    V +K   V +  +P+     + +  +  V    IP A      +   + Y  
Sbjct: 7609 VPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEAIPPKPESPPPEVYEE 7668

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
             +E        +E  E        +V     +      +   +    +     +  +
Sbjct: 7669 PEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPVPEKKAPPAVVKKPEPPPAKVPEV 7725



 Score = 54.6 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 34/400 (8%), Positives = 76/400 (19%), Gaps = 46/400 (11%)

Query: 10   RAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69
            +  +      PE +  I E  R +   +       +P+ I E+      +A  +  +   
Sbjct: 7411 KKPEATTVPVPEVQETIPEKTRPAAPPKKPEATA-VPETIPEKTR---PEAPPKRPEATT 7466

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
              +  + Q    +     V  K+       +      +   K   L           T  
Sbjct: 7467 VPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEEPKEVIPEKKVSLVPPKKPAAPPVTVP 7526

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                + FS     +               +P   +   K  +   K              
Sbjct: 7527 EAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPK 7586

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                             +   +       V     L +A         ++          
Sbjct: 7587 EAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKAAVP 7646

Query: 250  SLDGGNV------------------------------------DKKNVFSGIRPKITRRL 273
                                                           V    +  +  + 
Sbjct: 7647 QKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPVPEKK 7706

Query: 274  LEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFI 333
                      P    V +    +    K      E     +     E    ++ E +V +
Sbjct: 7707 APPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKPEAPPAKV----PEVPKEVVTEKKVAV 7762

Query: 334  NKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDN 373
             K          ++      E  +     V++        
Sbjct: 7763 PKKPEVPPAKVPEVPKKPVIE--EKPAIPVVEKVASPPAE 7800



 Score = 53.9 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/307 (8%), Positives = 58/307 (18%), Gaps = 11/307 (3%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVA--RRLESMKPRLPKEILERQFNKLEQAILQVE 65
            IQ+ +  LP   PE    + E         R  + +   + K  ++ +    E  I    
Sbjct: 6474 IQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVTEPVAKVPMKPKRVVPEAKIPAPT 6533

Query: 66   KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
            K+    +      K+ ++ +  V  +E    E  +          +          + + 
Sbjct: 6534 KEVAVPVRVPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEEYVHEEEY 6593

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                    +       E  + +            PV   +      +   +      P  
Sbjct: 6594 VHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKVPVVPKKPVPEEKKPVPVPKKKEAPPA 6653

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS---------YSIG 236
             +              +     A            +                      + 
Sbjct: 6654 KVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPPAKVPEVP 6713

Query: 237  KSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS 296
            K                     K      +P    +      +    P            
Sbjct: 6714 KKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAPKKREVVP 6773

Query: 297  NIAFKNY 303
                   
Sbjct: 6774 VPVALPR 6780



 Score = 48.5 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/323 (9%), Positives = 72/323 (22%), Gaps = 14/323 (4%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEK-QNQ 69
            AV               E A   + ++L+ + P+ P+E  +    K++ +I + EK Q  
Sbjct: 6464 AVP-------------EEKAPLPIQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVT 6510

Query: 70   KSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNT 129
            + +       +  +P++ + +       P         R  +   +        +     
Sbjct: 6511 EPVAKVPMKPKRVVPEAKIPAPTKEVAVPVRVPGVPKKRELEEVVVFKEEVEAHEEYIVE 6570

Query: 130  NLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFW 189
                            +    ++ +             +      +   +   P      
Sbjct: 6571 EEEEYVHEEEYVHKEEYVHEEEYVHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKVPVV 6630

Query: 190  SVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRE 249
                    K    +          + +        + + I        +K          
Sbjct: 6631 PKKPVPEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVP 6690

Query: 250  SLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDEN 309
                     K V                 +    P+   V           K  I  ++ 
Sbjct: 6691 EEKPPVPVPKKVEPPPAKVPEVPKKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPIPEEKK 6750

Query: 310  STFVLGKKEIEEGNPLIGEGRVF 332
             T +L K E            V 
Sbjct: 6751 PTALLKKMEAPPPKAPKKREVVP 6773



 Score = 46.5 bits (108), Expect = 0.009,   Method: Composition-based stats.
 Identities = 30/357 (8%), Positives = 77/357 (21%), Gaps = 7/357 (1%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHT 74
            LP   PE        A   V ++ E+   ++PK+I E +     Q       +  +    
Sbjct: 6947 LPPRAPEVVKKAVPEAPTPVPKKAEAPPAKVPKKIPEEKVPVPVQKKEAPPAKVPEKKKI 7006

Query: 75   SKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPK 134
             ++       ++   +K     E ++          + +    ++  + +         +
Sbjct: 7007 PEKKVPVPKKEAVPPAKGKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEEFHE 7066

Query: 135  NFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNY 194
                   E            +        +E     +   +   +  +    I       
Sbjct: 7067 VQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKGPE 7126

Query: 195  FFNKTRGLLSFYSALSEHHLFKYFVFL-------IILLGMAIGVSYSIGKSKGSITHFLR 247
               K        + +         V            +           K+         
Sbjct: 7127 VSEKVIPPKKPPTKVIPRKEPPAKVPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITP 7186

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             E +      K  V     P+  R ++     +      +                   +
Sbjct: 7187 EEKVREAVPKKPEVPPPKVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLE 7246

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
            E       +       P        ++    +        +    +E     K  V+
Sbjct: 7247 EPPKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPKEVVPEKKVSVV 7303



 Score = 41.5 bits (95), Expect = 0.32,   Method: Composition-based stats.
 Identities = 34/319 (10%), Positives = 64/319 (20%), Gaps = 3/319 (0%)

Query: 8    IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
            + +  +  P   PE +  +    + ++  + E   P    EI      K+ +    V ++
Sbjct: 6021 VTKKKEAPPAKVPEVQKKVVTEEKIAIITQREESPPPAVPEIP---KKKVPEEKRPVPRK 6077

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +          +  +P++ V +       PR       +   K       LSV    R 
Sbjct: 6078 EEVPPPKVPVPPKKAVPEAVVPAPIPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRV 6137

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                  +       E    SV+   E +         E++        +           
Sbjct: 6138 ELMRHEEEEWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKMHFISKK 6197

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
                      K         A  E             +     V     K          
Sbjct: 6198 VEVEPAKVPEKKIIPKPKVPAKIEEPPPTKVPEPPKKIVPEKKVPAPAPKKVPPAKAPEE 6257

Query: 248  RESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGD 307
             +                 P  T+               + V                  
Sbjct: 6258 SKRPVPEKRAPAEEVGIEEPPPTKVAERHMKITQEEKVLVAVTKKEAPPRARVPEEPKKV 6317

Query: 308  ENSTFVLGKKEIEEGNPLI 326
                     K   E  P  
Sbjct: 6318 APEERFPKLKPRREEEPPA 6336



 Score = 40.8 bits (93), Expect = 0.49,   Method: Composition-based stats.
 Identities = 26/347 (7%), Positives = 64/347 (18%), Gaps = 5/347 (1%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDK 79
            PE    +    + +V ++ E    ++P+ + ++   + + AI  VEK         ++ +
Sbjct: 7748 PEVPKEVVTEKKVAVPKKPEVPPAKVPE-VPKKPVIEEKPAIPVVEKVASPPAEVYEEPE 7806

Query: 80   ESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCR 139
            E    +                  + +    K         V  K        P+     
Sbjct: 7807 EVTAEEEEPAPAVEEEEYEAPPPPAPVPEEPKKVVPEKKFPVIKKPEAPPPKEPEPEKKV 7866

Query: 140  LREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT 199
            + +                  V         + + K+              +      K 
Sbjct: 7867 IEKPKLKPRPPARPPSPPKEDVKEKMFQLKAVSKKKVPEKPEVVEKVEPAPLKVPTAEKK 7926

Query: 200  RGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKK 259
               L                 L                 K       +            
Sbjct: 7927 VRKLLPEPKPQPKEEVVLKSVLRKKPEEEEPKVEPKKVEKAKKPEEPQPPPKAVEVEAPP 7986

Query: 260  NVFS-GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKE 318
                   +     ++ E    + +               +               +    
Sbjct: 7987 EPTPKERKVPEPAKVPEIKPAIPLPGPEPKPKPEPEVKTMKAPPIEPAPTPIAAPVTAPV 8046

Query: 319  I---EEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
            +    E  P     +             S       +     G +  
Sbjct: 8047 VGKKAEAKPKDEAAKPKGPIKGVAKKTPSPIEAERKKLRPGSGGEKP 8093



 Score = 38.8 bits (88), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/205 (7%), Positives = 45/205 (21%), Gaps = 8/205 (3%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAIL--QVEKQNQK 70
            +  P   PE    +         ++L    P+ P+          + A+   ++ +    
Sbjct: 7603 EAPPVKVPEAPKKV------VPEKKLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEAIPP 7656

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
               +   +   +  +  V  +                 +   KK                
Sbjct: 7657 KPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPPKVTEPPKKPVPEKKAPPAVVKKPE 7716

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
              P       +E          + ++  + V  +  +    ++  +      P   +   
Sbjct: 7717 PPPAKVPEVPKEAPPEKKVPPKKPEAPPAKVPEVPKEVVTEKKVAVPKKPEVPPAKVPEV 7776

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLF 215
                   +   +       S     
Sbjct: 7777 PKKPVIEEKPAIPVVEKVASPPAEV 7801



 Score = 38.4 bits (87), Expect = 2.5,   Method: Composition-based stats.
 Identities = 25/235 (10%), Positives = 66/235 (28%), Gaps = 2/235 (0%)

Query: 10   RAVDNLP-ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68
            +AV        PE    + E A   V    + ++  LP+   + +   + +++L+ + + 
Sbjct: 7896 KAVSKKKVPEKPEVVEKV-EPAPLKVPTAEKKVRKLLPEPKPQPKEEVVLKSVLRKKPEE 7954

Query: 69   QKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTN 128
            ++     K+ +++  P+      + + +E          +  +  K+  I          
Sbjct: 7955 EEPKVEPKKVEKAKKPEEPQPPPKAVEVEAPPEPTPKERKVPEPAKVPEIKPAIPLPGPE 8014

Query: 129  TNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIF 188
                P+     ++        T      +   V      K +    K  G          
Sbjct: 8015 PKPKPEPEVKTMKAPPIEPAPTPIAAPVTAPVVGKKAEAKPKDEAAKPKGPIKGVAKKTP 8074

Query: 189  WSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSIT 243
              +         G             ++     +  +     +  +  +S GS  
Sbjct: 8075 SPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSA 8129



 Score = 37.7 bits (85), Expect = 4.3,   Method: Composition-based stats.
 Identities = 31/359 (8%), Positives = 74/359 (20%), Gaps = 3/359 (0%)

Query: 8    IQRAVDNLPENT--PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE 65
            I +     P       ++    E     V +++E    ++P+   +    K   A    +
Sbjct: 6670 IPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPPAKVPEVPKKPVPEKKVPAPTPKK 6729

Query: 66   KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
             +   +       K     K      + +   P        +              +   
Sbjct: 6730 VEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAPKKREVVPVPVALPREEEEEEVPF 6789

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
                            E  +       E +  +     +  ++  +   +          
Sbjct: 6790 EEVPEEEILPEEEVPSEEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPEEEAL 6849

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
                                          +      +           I   K      
Sbjct: 6850 PEIKPKVPKPAPVPEIKKKVPEKKVVVPKKEEAPPTKVPEVSKKVEERRIIPPKEEEVPP 6909

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                        ++        +    + E+  E +V P   P          A      
Sbjct: 6910 AEVYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRAPEVVKKAVPE-APTPVPK 6968

Query: 306  GDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI 364
              E     + KK  EE  P+  + +        +   +  K +   ++E     KG  +
Sbjct: 6969 KAEAPPAKVPKKIPEEKVPVPVQKKEAPPAKVPEKKKIPEKKVPVPKKEAVPPAKGKAV 7027


>gi|117553210|gb|ABK35136.1| rendezvin [Lytechinus variegatus]
          Length = 1839

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 7/173 (4%), Positives = 16/173 (9%), Gaps = 6/173 (3%)

Query: 118  ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
               V        N        +     +   +     +                   +  
Sbjct: 1673 HAEVMAIPSYIENPQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPP 1732

Query: 178  GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
              +  P                    +   A                             
Sbjct: 1733 APYQPPNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAP 1792

Query: 238  SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
                             N           P             +  P+     
Sbjct: 1793 PAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAP------YQPPNAPPAPYQPP 1839



 Score = 73.9 bits (179), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 8/142 (5%), Positives = 13/142 (9%), Gaps = 4/142 (2%)

Query: 66   KQNQKSLH--TSKQDKESDIPKSSVTS--KENIFLEPRLRSISSILRSNKHKKLANILSV 121
            + N          Q      P +        N    P     +                 
Sbjct: 1698 QPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPPNAPPAPYQT 1757

Query: 122  QGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
                       P       +         Q                            + 
Sbjct: 1758 PNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQ 1817

Query: 182  FPTGSIFWSVHNYFFNKTRGLL 203
             P                    
Sbjct: 1818 PPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 73.9 bits (179), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 10/162 (6%), Positives = 22/162 (13%), Gaps = 8/162 (4%)

Query: 60   AILQVEKQNQKSLHTSKQDKESDIPKSSVTS--------KENIFLEPRLRSISSILRSNK 111
            AI    +  Q   +  +   + + P S              N    P             
Sbjct: 1678 AIPSYIENPQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPPAPYQP 1737

Query: 112  HKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRL 171
                                     +   +   +     Q   +                
Sbjct: 1738 PNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQ 1797

Query: 172  RRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHH 213
                    +  P                    +   A  +  
Sbjct: 1798 PPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 3/169 (1%), Positives = 21/169 (12%), Gaps = 2/169 (1%)

Query: 142  EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRG 201
                      +  +  V       +++                     +    +      
Sbjct: 1672 YHAEVMAIPSYIENPQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEP 1731

Query: 202  LLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNV 261
               +    +    ++                    +   +     +  +         N 
Sbjct: 1732 PAPYQPPNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNA 1791

Query: 262  FSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTS-NIAFKNYIGGDEN 309
                               +  P+     +                   
Sbjct: 1792 PPAPYQPPNAPPAP-YQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 68.1 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 13/174 (7%), Positives = 26/174 (14%), Gaps = 3/174 (1%)

Query: 22   RRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKES 81
             R+  Y     ++   +E+ +          Q N    +  Q   Q       +      
Sbjct: 1667 VRASGYHAEVMAIPSYIENPQVPYNPYQPYNQPNA-PPSPYQPPNQPTPYQPPNAPPAPY 1725

Query: 82   DIPKSSVTS--KENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCR 139
              P          N    P     +                    +       P      
Sbjct: 1726 QPPNEPPAPYQPPNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAP 1785

Query: 140  LREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
             +   +     Q                            +  P          
Sbjct: 1786 YQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 67.7 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 4/154 (2%), Positives = 14/154 (9%), Gaps = 6/154 (3%)

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            P             N         +  + +                              
Sbjct: 1686 PQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPY 1745

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITR------RLLEDGSEVDVGPSTIPVADFANTS 296
                   +                                    +  P+     +     
Sbjct: 1746 QPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPPNAPPAP 1805

Query: 297  NIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGR 330
                       +         +     P   +  
Sbjct: 1806 YQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 60.4 bits (144), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 5/156 (3%), Positives = 21/156 (13%)

Query: 206  YSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGI 265
             +    ++ ++ +             +        +      +   +     +       
Sbjct: 1684 ENPQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPPAPYQPPNAPPA 1743

Query: 266  RPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPL 325
              +            +  P+       A  +     N                     P 
Sbjct: 1744 PYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPPNAPP 1803

Query: 326  IGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                         Q                +     
Sbjct: 1804 APYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839



 Score = 55.0 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 3/150 (2%), Positives = 12/150 (8%)

Query: 222  IILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVD 281
               +                       +  +     +         +            +
Sbjct: 1680 PSYIENPQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQPPNEPPAPYQPPN 1739

Query: 282  VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSS 341
              P+     +                                P              Q  
Sbjct: 1740 APPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPP 1799

Query: 342  ILSGKILWSLQQEKSQGLKGLVIKGDIPMI 371
                          +               
Sbjct: 1800 NAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1829



 Score = 54.6 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 10/168 (5%), Positives = 34/168 (20%), Gaps = 7/168 (4%)

Query: 10   RAVDNLPENTPERRSHIYEH--ARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
             A+ +  EN P+   + Y+     N+     +      P +         +    +    
Sbjct: 1677 MAIPSYIEN-PQVPYNPYQPYNQPNAPPSPYQPPNQPTPYQPPNAPPAPYQP-PNEPPAP 1734

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             Q         +  + P +   +       P     +         +             
Sbjct: 1735 YQPPNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPP- 1793

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGK 175
                     +         +    ++  ++        +      +  
Sbjct: 1794 --APYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPP 1839


>gi|1100971|gb|AAC44099.1| SspA [Streptococcus gordonii]
          Length = 1569

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 78/269 (28%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQK 70
            +      P      YE+      +  +  +P  P+E        LE A      E +   
Sbjct: 838  EVEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTP 897

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             + T  Q + S   + +  +++ +   P   S  +              S   +   +  
Sbjct: 898  PVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKIPDQPEPSKPEEPTYDPL 957

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 958  PTPPLAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 1017

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 1018 LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1076

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1077 LATYNADLTKPVETLHPTVVGRVLNDGAT 1105



 Score = 44.2 bits (102), Expect = 0.049,   Method: Composition-based stats.
 Identities = 10/206 (4%), Positives = 40/206 (19%), Gaps = 1/206 (0%)

Query: 63  QVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ 122
            V   +  ++    +  +     ++   + NI+     +  +  +     +K    ++  
Sbjct: 771 TVGATSATNVMPVAEMPQVPGRDNTEGKRPNIWYSLNGKIRAVNVPKITKEKPTPPVAPT 830

Query: 123 GKSRTNTNLSPKNFSCRL-REILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFS 181
                   +        +     +         D            ++           +
Sbjct: 831 EPQAPTYEVEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPT 890

Query: 182 FPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
           +                ++     Y                      + +      SK  
Sbjct: 891 YENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPSYENEPTPPVKIPDQPEPSKPE 950

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRP 267
              +    +       K+     + P
Sbjct: 951 EPTYDPLPTPPLAPTPKQLPTPPVVP 976


>gi|160707980|ref|NP_001104267.1| protein piccolo isoform 2 [Rattus norvegicus]
 gi|7493836|gb|AAF07822.2|AF138789_1 multidomain presynaptic cytomatrix protein Piccolo [Rattus
           norvegicus]
          Length = 4880

 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/354 (6%), Positives = 53/354 (14%), Gaps = 12/354 (3%)

Query: 42  KPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLR 101
                +E   ++   +++   + E   +  L                   +       + 
Sbjct: 177 DSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEVIQQDSSPKSVS 236

Query: 102 SISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPV 161
           S  +     +                    SP     +       +V       S   P 
Sbjct: 237 SQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQPGPAKSPAQPA 296

Query: 162 AAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKT----------RGLLSFYSALSE 211
              +       +          T S                       +           
Sbjct: 297 GTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVKSPAQQPGTAKH 356

Query: 212 HHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITR 271
                       + G     +   G  K         +      +  K          T+
Sbjct: 357 PAQQPGPQTAAKVPGPTKTPAQQSGPGKTPAQQPGPTKPSPQQPIPAKPQPQQPVATKTQ 416

Query: 272 RLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRV 331
                 ++                +    +                   +  P       
Sbjct: 417 PQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQPPTATKPQPQPPTATKPH 476

Query: 332 FINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNA 385
               G  + S        S                         S ++   CN 
Sbjct: 477 HQQPGLAKPSAQQPTKSISQTVTGRPLQPPP--TSAAQTPAQGLSKTICPLCNT 528



 Score = 69.3 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/344 (6%), Positives = 63/344 (18%), Gaps = 7/344 (2%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSN 110
           + + ++ E    Q   Q ++             P      K+   ++  ++  SS    +
Sbjct: 177 DSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEVIQQDSSPKSVS 236

Query: 111 KHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSR 170
             +         G  + +     +  + +       +        +   P  A    +  
Sbjct: 237 SQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQPGPAKSPAQPA 296

Query: 171 LRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIG 230
                 A   +   G            +        +                  G A  
Sbjct: 297 GTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVKSPAQQPGTAKH 356

Query: 231 VSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVA 290
            +   G    +       ++    +   K       P          ++           
Sbjct: 357 PAQQPGPQTAAKV-PGPTKTPAQQSGPGKTPAQQPGPTKPSPQQPIPAKPQPQQPVATKT 415

Query: 291 DFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWS 350
               ++    +                   +  P              +           
Sbjct: 416 QPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQPPTATKPQPQPPTATKP 475

Query: 351 LQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHV 394
             Q+                   + S ++T +       S    
Sbjct: 476 HHQQPGLAKPS------AQQPTKSISQTVTGRPLQPPPTSAAQT 513



 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/334 (7%), Positives = 63/334 (18%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
            +        P++ +  +    +    + + Q         Q      P+    +     
Sbjct: 387 AQQPGPTKPSPQQPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQ 446

Query: 96  LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
            +P   +          K      +          L+  +     + I         +  
Sbjct: 447 PQPPTPAKPQPQPPTATKPQPQPPTATKPHHQQPGLAKPSAQQPTKSISQTVTGRPLQPP 506

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
            + +     +     +                           T   L  ++        
Sbjct: 507 PTSAAQTPAQGLSKTICPLCNTTELLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEI 566

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
           K ++ L   +  A+G   +               +                PK      +
Sbjct: 567 KEWLCLNCQMQRALGGDLAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQ 626

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
           D  +                                 + G          + E       
Sbjct: 627 DSPKALESKKPPEPKKPPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAP 686

Query: 336 GRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIP 369
            +  S  L  +    +   + +  K    + DI 
Sbjct: 687 PKEPSGPLPEQAKAPVGDVEPKQPKMTETRADIQ 720



 Score = 47.3 bits (110), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/304 (8%), Positives = 58/304 (19%)

Query: 28  EHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSS 87
           +        +        P++    +    + A  + + Q         Q      P+  
Sbjct: 399 QPIPAKPQPQQPVATKTQPQQSAPAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQ 458

Query: 88  VTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFS 147
             +      +P   +     +    K  A   +                +   +      
Sbjct: 459 PPTATKPQPQPPTATKPHHQQPGLAKPSAQQPTKSISQTVTGRPLQPPPTSAAQTPAQGL 518

Query: 148 VNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYS 207
             T     ++   +  I    +     +         G                      
Sbjct: 519 SKTICPLCNTTELLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQR 578

Query: 208 ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
           AL                  A   + +  KS         ++         K + S   P
Sbjct: 579 ALGGDLAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQDSPKALESKKPP 638

Query: 268 KITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIG 327
           +  +            P  +      +    A    +   E        KE     P   
Sbjct: 639 EPKKPPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAPPKEPSGPLPEQA 698

Query: 328 EGRV 331
           +  V
Sbjct: 699 KAPV 702



 Score = 44.2 bits (102), Expect = 0.053,   Method: Composition-based stats.
 Identities = 23/349 (6%), Positives = 64/349 (18%), Gaps = 9/349 (2%)

Query: 22   RRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKES 81
                + E A           + + P   +E +  K+ +    ++  +           +S
Sbjct: 677  VAEALPEPAPPKEPSGPLPEQAKAPVGDVEPKQPKMTETRADIQSSSTTKPDILSSQVQS 736

Query: 82   DIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLR 141
                 + +  +    +P      +  ++      A           +             
Sbjct: 737  QAQVKTASPLKTDSAKPSQSFPPTGEKTTPLDSKAMPRPASDSKIISQPGPGSESKDPKH 796

Query: 142  EILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTR- 200
                   +   +     SP    +               +                  R 
Sbjct: 797  IDPIQKKDEPKKAQPKGSPKPETKPVPKGSPTPSGTRPTAGQAAPPSQQPPKPQEQSRRF 856

Query: 201  --------GLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                              +  +          +        S    +G            
Sbjct: 857  SLNLGGITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQQGPHPQTGPAAPSK 916

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                  ++  +    K T +L    ++          A   N  +   +           
Sbjct: 917  QAPTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLESKPEQAPTAKKTEKDK 976

Query: 313  VLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKG 361
                 ++ +  P   E  V  +K    +       L   +         
Sbjct: 977  KPPPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLGSQEPP 1025



 Score = 43.5 bits (100), Expect = 0.083,   Method: Composition-based stats.
 Identities = 21/313 (6%), Positives = 68/313 (21%), Gaps = 2/313 (0%)

Query: 51  ERQFNKLEQAILQVEKQNQKSLHTSKQDKES--DIPKSSVTSKENIFLEPRLRSISSILR 108
           E +  ++   + + +   + S+  +  +  S     +   +       +P      +   
Sbjct: 46  EEERRQIAAVMSRAQGLPKGSVPPAAAESPSMHRKQELDSSQAPQQPGKPPDPGRPTQPG 105

Query: 109 SNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDK 168
            +K +      S Q     + +      S    +      ++      S     +     
Sbjct: 106 LSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDFKEEYKSSMMPGFFSDVNPLSAVSSV 165

Query: 169 SRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMA 228
                       S  +             +            +    K        +   
Sbjct: 166 VNKFNPFDLISDSEASQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEV 225

Query: 229 IGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIP 288
           I    S           ++ ++   G   +++       + +              +   
Sbjct: 226 IQQDSSPKSVSSQQAEKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQ 285

Query: 289 VADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKIL 348
                + +  A          +     +  +E+ +     G   + +  G      G + 
Sbjct: 286 PGPAKSPAQPAGTGKSPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVK 345

Query: 349 WSLQQEKSQGLKG 361
              QQ  +     
Sbjct: 346 SPAQQPGTAKHPA 358



 Score = 40.0 bits (91), Expect = 0.95,   Method: Composition-based stats.
 Identities = 26/351 (7%), Positives = 74/351 (21%), Gaps = 14/351 (3%)

Query: 17   ENTPERRSHIYEHARNSV-ARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTS 75
               P +++     +  +    +     P  P +    +      A   +E + +++    
Sbjct: 911  PAAPSKQAPTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLESKPEQAPTAK 970

Query: 76   KQDKESDIPKSS-VTSKENIFLEPRLRSISSILRSNKHKKL------------ANILSVQ 122
            K +K+   P +       +   +             K                    +  
Sbjct: 971  KTEKDKKPPPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLGSQEPPNFNTC 1030

Query: 123  GKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSF 182
             + +                 +   +    +   ++S              G  A     
Sbjct: 1031 TECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMGKMPPAPSGPKASPMPA 1090

Query: 183  PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSI 242
            P              K +   +     +E  + +     I      +     + +S+G  
Sbjct: 1091 PAEPSSQKTPTGTQVKGKKKEAEGKTEAEKPVPEKETASIEKTPPMVTTDQKLEESEGKK 1150

Query: 243  THFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKN 302
            +             +K         K          E    P    +   A   +   + 
Sbjct: 1151 SKVSALPEKKPSEEEKAISADKKERKPPAEEKPPLEEKKPIPVDKKLPPEAKPLSSEGEE 1210

Query: 303  YIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQ 353
                 +    +  ++   +     GE     +         +   L    +
Sbjct: 1211 KHEILKAHVQIPEEEPTGKVAAKAGEEEQQPDSRPEALPGATPLTLPKAGE 1261



 Score = 38.1 bits (86), Expect = 3.1,   Method: Composition-based stats.
 Identities = 39/359 (10%), Positives = 78/359 (21%), Gaps = 5/359 (1%)

Query: 8   IQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQ 67
           +  A+ + P+ TP+  +     A  S     ++   + P    +     LE       K+
Sbjct: 584 LAAAIPSSPQPTPKAATAPTATASKSPVPSQQASPKKEPPSKQDSP-KALESKKPPEPKK 642

Query: 68  NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +     +  K   + K            P+L    ++      K+ +  L  Q K+  
Sbjct: 643 PPEPKKPPEPKKPPPLVKQPTLHGPTPATAPQLPVAEALPEPAPPKEPSGPLPEQAKAPV 702

Query: 128 NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                 +      R  +  S  T+ +  SS     A     S L+        SFP    
Sbjct: 703 GDVEPKQPKMTETRADIQSSSTTKPDILSSQVQSQAQVKTASPLKTDSAKPSQSFPPTGE 762

Query: 188 FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV---FLIILLGMAIGVSYSIGKSKGSITH 244
             +  +          S   +                I                  +   
Sbjct: 763 KTTPLDSKAMPRPASDSKIISQPGPGSESKDPKHIDPIQKKDEPKKAQPKGSPKPETKPV 822

Query: 245 FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYI 304
                +  G            +     +       +++G  T        T        +
Sbjct: 823 PKGSPTPSGTRPTAGQAAPPSQQPPKPQEQSRRFSLNLGGITDAPKSQPTTPQETVTGKL 882

Query: 305 GGDENST-FVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGL 362
            G   S            G              +   +           +   Q     
Sbjct: 883 FGFGASIFSQASNLISTAGQQGPHPQTGPAAPSKQAPTPSQSPAAQGPAKSTGQLPPAP 941


>gi|218661960|ref|ZP_03517890.1| hypothetical protein RetlI_21973 [Rhizobium etli IE4771]
          Length = 94

 Score = 75.8 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/91 (46%), Positives = 60/91 (65%)

Query: 1  MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
          M DFI VI+RAVD L ENTPE R  +YE AR +V R+LE+MKPR P+ +L+RQ  KLE A
Sbjct: 1  MADFIAVIRRAVDGLAENTPEMRVKVYERARGAVQRQLENMKPRPPEAMLQRQLEKLEAA 60

Query: 61 ILQVEKQNQKSLHTSKQDKESDIPKSSVTSK 91
          I +VE ++ ++L   +  +    P +   ++
Sbjct: 61 IREVEGEHSEALSVGEASEAVAAPGARRGTR 91


>gi|299116344|emb|CBN76146.1| Mucin-1 [Ectocarpus siliculosus]
          Length = 3036

 Score = 75.4 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/308 (7%), Positives = 62/308 (20%), Gaps = 14/308 (4%)

Query: 78  DKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFS 137
           D+++  P  + T    +   P        L     +           +          F+
Sbjct: 512 DEDTPRPSPAPTPAPFVAPTPGPIFTEPPLTPAPTRDTRRPSPAPSPAPFVAPTPGPIFT 571

Query: 138 CRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFN 197
                    +     +                           +                
Sbjct: 572 EPP-----LTPAPTRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTRRRSPAPSP 626

Query: 198 KTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVD 257
                 +    L++  L             A   +  +  + G +            +  
Sbjct: 627 APFVAPTPGPMLTQAPLTPAPSRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTR 686

Query: 258 KKNVFSGIRPKITRRLLEDGSEVDVGPSTI-----PVADFANTSNIAFKNYIGGDENSTF 312
           +++      P +        ++  + P+         +     S +  +      E++  
Sbjct: 687 RRSPAPSPAPFVAPTPGPMLTQAPLTPAPTREETLQPSPGETVSPVFDRTLPPAPESTVP 746

Query: 313 VLGKKEIEEGN----PLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDI 368
               +              E  +  + G   S +L      S+    SQ    +  +   
Sbjct: 747 PTLSRTAPPVAFHTLSPNSEETLQPSPGETMSPVLPPVPESSVPPTLSQSTPPVAFQTLS 806

Query: 369 PMIDNAFS 376
           P  +    
Sbjct: 807 PNSEETLQ 814



 Score = 71.6 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/326 (6%), Positives = 59/326 (18%), Gaps = 12/326 (3%)

Query: 67  QNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRS-------NKHKKLANIL 119
           ++      +        P       E        R       +                 
Sbjct: 513 EDTPRPSPAPTPAPFVAPTPGPIFTEPPLTPAPTRDTRRPSPAPSPAPFVAPTPGPIFTE 572

Query: 120 SVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGI 179
                + T               +         +   + +P                   
Sbjct: 573 PPLTPAPTRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTRRRSPAPSPAPFVAP 632

Query: 180 FSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
              P  +          +  R   +   A          +    L       +     + 
Sbjct: 633 TPGPMLTQAPLTPAPSRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTRRRSPAP 692

Query: 240 GSITHFLRRESLDGGNVDKKNVFS-----GIRPKITRRLLEDGSEVDVGPSTIPVADFAN 294
                                  +        P  T   + D +      ST+P      
Sbjct: 693 SPAPFVAPTPGPMLTQAPLTPAPTREETLQPSPGETVSPVFDRTLPPAPESTVPPTLSRT 752

Query: 295 TSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQE 354
              +AF       E +      + +    P + E  V     +    +    +  + ++ 
Sbjct: 753 APPVAFHTLSPNSEETLQPSPGETMSPVLPPVPESSVPPTLSQSTPPVAFQTLSPNSEET 812

Query: 355 KSQGLKGLVIKGDIPMIDNAFSASMT 380
                   +     P+ ++    +++
Sbjct: 813 LQPLPGETMSPVLPPVPESTVPPTLS 838



 Score = 67.7 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/296 (7%), Positives = 58/296 (19%), Gaps = 4/296 (1%)

Query: 66  KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQ--G 123
           +       T    + S  P  +               ++     +  ++           
Sbjct: 572 EPPLTPAPTRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTRRRSPAPSPAPFVA 631

Query: 124 KSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFP 183
            +               R+    S         + +P   +          +     S  
Sbjct: 632 PTPGPMLTQAPLTPAPSRDTRRRSPAPTPAPFVAPTPGPMLTQAPLTPAPTRDTRRRSPA 691

Query: 184 TGSIFWSVHNYFFNKTRGLLSFYSALSE--HHLFKYFVFLIILLGMAIGVSYSIGKSKGS 241
                +         T+  L+      E         V  +    +      ++  +   
Sbjct: 692 PSPAPFVAPTPGPMLTQAPLTPAPTREETLQPSPGETVSPVFDRTLPPAPESTVPPTLSR 751

Query: 242 ITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFK 301
               +   +L   + +      G         + + S       + P   F   S  + +
Sbjct: 752 TAPPVAFHTLSPNSEETLQPSPGETMSPVLPPVPESSVPPTLSQSTPPVAFQTLSPNSEE 811

Query: 302 NYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
                   +   +     E   P            +  S      +  S  +  S 
Sbjct: 812 TLQPLPGETMSPVLPPVPESTVPPTLSQSTPPVAFQTLSPNSEETLQPSPGETMSP 867



 Score = 58.1 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/315 (7%), Positives = 61/315 (19%), Gaps = 1/315 (0%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
            + LP +  E  S +++     V      ++  +P+  ++   +   Q     E+      
Sbjct: 998  ETLPPSPGETMSPVFDRTLPPVPEPPVPVQTPVPQSAVD-PLSPSVQTPSPAEEVTVAPG 1056

Query: 73   HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
             T+          +          E    +++    S          +  G +       
Sbjct: 1057 ATASPGATVAPITTIAPGTTLAPGETWAPALTIRTPSPGATSAPGATASPGATVAPIITI 1116

Query: 133  PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                     E  + ++  +     +     A     + +         +       W+  
Sbjct: 1117 APGTILAPGETWAPALTIRTPSPGATYAPGATASPGATVAPITTIAPGTTLAPGETWAPA 1176

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                  + G  S   A +        +  I                           +  
Sbjct: 1177 LTIRTPSPGATSAPGATASPGASVAPITTIAPGTTLAPGETWAPALTIRTPSPGATSAPG 1236

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                    V   I       L    +         P                    + + 
Sbjct: 1237 ATASPGATVAPIITIAPGTTLAPGETWAPALTIRTPSPGATYAPGATASPGATPAPSGST 1296

Query: 313  VLGKKEIEEGNPLIG 327
               +         + 
Sbjct: 1297 GEVESPGTTAAGAVS 1311



 Score = 55.4 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/415 (6%), Positives = 79/415 (19%), Gaps = 26/415 (6%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKP----------RLPKEILERQFNKLEQAI--- 61
                TP         +         +  P            P     R+      A    
Sbjct: 606  QAPLTPAPTRDTRRRSPAPSPAPFVAPTPGPMLTQAPLTPAPSRDTRRRSPAPTPAPFVA 665

Query: 62   ----LQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLAN 117
                  + +       T    + S  P  +               ++             
Sbjct: 666  PTPGPMLTQAPLTPAPTRDTRRRSPAPSPAPFVAPTPGPMLTQAPLTPAPT-------RE 718

Query: 118  ILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLA 177
                     T + +  +         +  +++      +  +     E          ++
Sbjct: 719  ETLQPSPGETVSPVFDRTLPPAPESTVPPTLSRTAPPVAFHTLSPNSEETLQPSPGETMS 778

Query: 178  GIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGK 237
             +      S      +             ++              +L  +          
Sbjct: 779  PVLPPVPESSVPPTLSQSTPPVAFQTLSPNSEETLQPLPGETMSPVLPPVPESTVPPTLS 838

Query: 238  SKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
                   F          +      +      T   + + S       T P A F   S 
Sbjct: 839  QSTPPVAFQTLSPNSEETLQPSPGETMSPIDRTLPPVPESSVPPTLSQTTPPATFQTLSP 898

Query: 298  IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
             + +        +   +  + +           +           LS     +      +
Sbjct: 899  TSEETLPPSPGETMSPVFDRTLPPVPESSVPPTLLQTTPPVAFQTLSPTSEETFPPSPGE 958

Query: 358  GLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDL 412
             +  +  +   P+ ++  +   TL        S +       + P    + +  +
Sbjct: 959  TMSPVFDRTLPPVPES--TVPPTLSQTTPPIPSPSLAPMSEETLPPSPGETMSPV 1011



 Score = 50.4 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/370 (5%), Positives = 65/370 (17%), Gaps = 19/370 (5%)

Query: 15   LPENTPERRSHIYEHARNSVARRLESMKP-RLPKEILERQFNKLEQAILQVEKQNQKSLH 73
                TP         +         +  P  +  +         E+ +     +    + 
Sbjct: 674  QAPLTPAPTRDTRRRSPAPSPAPFVAPTPGPMLTQAPLTPAPTREETLQPSPGETVSPVF 733

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
                    +       S+    +     S +S               +     ++   + 
Sbjct: 734  DRTLPPAPESTVPPTLSRTAPPVAFHTLSPNSEETLQPSPGETMSPVLPPVPESSVPPTL 793

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSV-H 192
               +  +        + +         ++ +                + P      S   
Sbjct: 794  SQSTPPVAFQTLSPNSEETLQPLPGETMSPVLPPVPESTVPPTLSQSTPPVAFQTLSPNS 853

Query: 193  NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                  + G        +   + +  V   +          ++  +          E++ 
Sbjct: 854  EETLQPSPGETMSPIDRTLPPVPESSVPPTLSQTTPPATFQTLSPTSEETLPPSPGETMS 913

Query: 253  GG-----------------NVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANT 295
                                     V        +           + P           
Sbjct: 914  PVFDRTLPPVPESSVPPTLLQTTPPVAFQTLSPTSEETFPPSPGETMSPVFDRTLPPVPE 973

Query: 296  SNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEK 355
            S +            +  L     E   P  GE    +              + +   + 
Sbjct: 974  STVPPTLSQTTPPIPSPSLAPMSEETLPPSPGETMSPVFDRTLPPVPEPPVPVQTPVPQS 1033

Query: 356  SQGLKGLVIK 365
            +       ++
Sbjct: 1034 AVDPLSPSVQ 1043


>gi|229843951|ref|ZP_04464092.1| recombination protein F [Haemophilus influenzae 6P18H1]
 gi|229812945|gb|EEP48633.1| recombination protein F [Haemophilus influenzae 6P18H1]
          Length = 1774

 Score = 75.4 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/321 (8%), Positives = 80/321 (24%), Gaps = 3/321 (0%)

Query: 9    QRAVDNLPENTPERRS---HIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVE 65
             + V+   ++  E  +    + + A+ SV    ++ +        E       +   +VE
Sbjct: 1055 SKTVEKNEQDATETTAQNGEVAQEAKPSVEANTQTNELAQSGSETEETQTTETKETAKVE 1114

Query: 66   KQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKS 125
            K   +       +      + +             +  +     +         S   K 
Sbjct: 1115 KDEIQEAPQMTSETSPKQAEPAPEKVSTDTKVEETQVQAQPQTQSTTVVAVEATSPNSKL 1174

Query: 126  RTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTG 185
               T  S K  +  +  +       +    +     A +E +K++      + +      
Sbjct: 1175 AAETQPSEKANAEPVTSVSQNQPENKVSQPTETEKTAKVEKEKTQEAPKVTSQVSPKQEQ 1234

Query: 186  SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHF 245
            S          ++    ++   A  +                +  V     ++  +    
Sbjct: 1235 SETVQPQAVLESEKVPTVNNAEAQPQTQPSATVSTEQPAKETSSNVEQPAPENSINTGSA 1294

Query: 246  LRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIG 305
                     +   +   +      ++      ++  V  ++  V    N+S  A +    
Sbjct: 1295 TAMTETAEKSDKPQTQTAATTEDASQHKANTVADNSVANNSTSVKPTENSSTKAERPVTE 1354

Query: 306  GDENSTFVLGKKEIEEGNPLI 326
                +T     +  E      
Sbjct: 1355 STTVNTGNSVVENPENTTQPA 1375



 Score = 70.0 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/335 (7%), Positives = 81/335 (24%), Gaps = 5/335 (1%)

Query: 59   QAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANI 118
            + I +VE         +  +    + ++S    + +    +  + ++       ++    
Sbjct: 1023 EEIARVEAPVPPPAPATPSETTETVAENSKQESKTVEKNEQDATETTAQNGEVAQEAKPS 1082

Query: 119  LSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAG 178
            +    ++        +    +  E    +   + E   +    +     ++     K++ 
Sbjct: 1083 VEANTQTNELAQSGSETEETQTTETKETAKVEKDEIQEAPQMTSETSPKQAEPAPEKVST 1142

Query: 179  IFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKS 238
                    +                +  ++                +            S
Sbjct: 1143 DTKVEETQVQAQPQTQSTTVVAVEATSPNSKLAAETQPSEKANAEPVTSVSQNQPENKVS 1202

Query: 239  KGSITH-FLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSN 297
            + + T    + E        K       + + +  +            T+  A+    + 
Sbjct: 1203 QPTETEKTAKVEKEKTQEAPKVTSQVSPKQEQSETVQPQAVLESEKVPTVNNAEAQPQTQ 1262

Query: 298  IAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
             +           T    ++   E +   G           + S        +  ++ SQ
Sbjct: 1263 PSATVSTEQPAKETSSNVEQPAPENSINTGSATAMTE--TAEKSDKPQTQTAATTEDASQ 1320

Query: 358  GLKGLVIKGDIPMIDNAFSASMTLKCNADISLSIT 392
                 V   D  + +N+ S   T   +      +T
Sbjct: 1321 HKANTV--ADNSVANNSTSVKPTENSSTKAERPVT 1353



 Score = 48.9 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/285 (7%), Positives = 69/285 (24%), Gaps = 6/285 (2%)

Query: 14   NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLH 73
            + P  T E+ + + +       +    + P+  +    +    LE      EK    +  
Sbjct: 1202 SQPTET-EKTAKVEKEKTQEAPKVTSQVSPKQEQSETVQPQAVLES-----EKVPTVNNA 1255

Query: 74   TSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSP 133
             ++   +     S+    +         +  + + +     +        K +T T  + 
Sbjct: 1256 EAQPQTQPSATVSTEQPAKETSSNVEQPAPENSINTGSATAMTETAEKSDKPQTQTAATT 1315

Query: 134  KNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHN 193
            ++ S      ++ +    +      +  ++ + ++       +    S        +   
Sbjct: 1316 EDASQHKANTVADNSVANNSTSVKPTENSSTKAERPVTESTTVNTGNSVVENPENTTQPA 1375

Query: 194  YFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDG 253
                 +        ++S+          +           S   +K              
Sbjct: 1376 VNSESSESKSRRRRSVSQPQETSAEETTVTSTNETTVADNSESSNKPKSRRKRSISQSQE 1435

Query: 254  GNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
             + D+  V    +     R                     + S +
Sbjct: 1436 TSTDETTVADNSKSSKPNRRSRRSVRSVPHNVEPATTSSNDRSAV 1480


>gi|326431963|gb|EGD77533.1| hypothetical protein PTSG_12763 [Salpingoeca sp. ATCC 50818]
          Length = 1409

 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/311 (6%), Positives = 57/311 (18%), Gaps = 1/311 (0%)

Query: 46  PKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISS 105
              +   +    + A          ++        +  P         +   P  +   +
Sbjct: 37  TSAMQNMRLQPPQPAQSAAPSMAPPTMLAPPTTSMAAPPTPVSQPPRTMQPPPMTQPPRA 96

Query: 106 ILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEY-DSSVSPVAAI 164
           +      +          +  + +   P   S         S  +Q        +     
Sbjct: 97  MQPPPMSQPPTMSQPPTMQPPSTSMAQPPTMSQPPTMQPPQSSMSQPPTMSQPPTMQPPQ 156

Query: 165 EHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIIL 224
               +             PT +      +    + +   + Y       +      +   
Sbjct: 157 SSMAAPPPTSMAQPPAGPPTSAPPARTASAGGRRRQYPTTPYGMTQPAAVPPTQPPVSTQ 216

Query: 225 LGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGP 284
                GV                             +    +P   ++            
Sbjct: 217 PYGGQGVQQPAAVPPTQPPTRPGMVQPPPPMAGAVTMPPTGQPLQPQQPGVPPPPPPAAT 276

Query: 285 STIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILS 344
           ++            A    +    N       ++    +P      V + +        +
Sbjct: 277 ASGGGGGMRGPQPPAAMPGVAQPANGLAPPRAQKRRGVDPEAVPSPVVVAREDQARYRDA 336

Query: 345 GKILWSLQQEK 355
             +  S Q   
Sbjct: 337 PFMTSSKQNPP 347



 Score = 67.7 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/271 (8%), Positives = 44/271 (16%), Gaps = 5/271 (1%)

Query: 113 KKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLR 172
           +      S        T L+P   S               +      P  A++       
Sbjct: 46  QPPQPAQSAAPSMAPPTMLAPPTTSMAAPPTPVSQPPRTMQPPPMTQPPRAMQPPPMSQP 105

Query: 173 RGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVS 232
                     P  +            T        +          +        A   +
Sbjct: 106 PTMSQPPTMQPPSTSMAQPPTMSQPPTMQPPQSSMSQPPTMSQPPTMQPPQSSMAAPPPT 165

Query: 233 YSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADF 292
                  G  T      +   G   ++   +                    P +      
Sbjct: 166 SMAQPPAGPPTSAPPARTASAGGRRRQYPTTP-----YGMTQPAAVPPTQPPVSTQPYGG 220

Query: 293 ANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQ 352
                 A             V     +     +   G+    +  G           S  
Sbjct: 221 QGVQQPAAVPPTQPPTRPGMVQPPPPMAGAVTMPPTGQPLQPQQPGVPPPPPPAATASGG 280

Query: 353 QEKSQGLKGLVIKGDIPMIDNAFSASMTLKC 383
               +G +       +    N  +     K 
Sbjct: 281 GGGMRGPQPPAAMPGVAQPANGLAPPRAQKR 311



 Score = 54.6 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/311 (7%), Positives = 56/311 (18%), Gaps = 8/311 (2%)

Query: 36  RRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIF 95
            +  +M+P     + +         +   +    +   T  Q      P+SS+ +     
Sbjct: 109 SQPPTMQPP-STSMAQPPTMSQPPTMQPPQSSMSQP-PTMSQPPTMQPPQSSMAAPPPTS 166

Query: 96  LEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYD 155
           +        +     +             +             +                
Sbjct: 167 MAQPPAGPPTSAPPARTASAGGRRRQYPTTPYGMTQPAAVPPTQPPVSTQPYGGQG---- 222

Query: 156 SSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLF 215
             V   AA+   +   R G +                     +  G+       +     
Sbjct: 223 --VQQPAAVPPTQPPTRPGMVQPPPPMAGAVTMPPTGQPLQPQQPGVPPPPPPAATASGG 280

Query: 216 KYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLE 275
              +          GV+              R    +                     + 
Sbjct: 281 GGGMRGPQPPAAMPGVAQPANGLAPPRAQKRRGVDPEAVPSPVVVAREDQARYRDAPFMT 340

Query: 276 DGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINK 335
              +     +T         ++             T  L K        +I         
Sbjct: 341 SSKQNPPLANTRVRVVDEGNASFRAVRPTISAVPCTKELLKLSKIPLALVINPLADPAEG 400

Query: 336 GRGQSSILSGK 346
            +  ++   G 
Sbjct: 401 EQPIATADHGA 411


>gi|157150597|ref|YP_001449531.1| streptococcal surface protein B [Streptococcus gordonii str. Challis
            substr. CH1]
 gi|157075391|gb|ABV10074.1| streptococcal surface protein B [Streptococcus gordonii str. Challis
            substr. CH1]
          Length = 1499

 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 77/269 (28%), Gaps = 3/269 (1%)

Query: 13   DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAI--LQVEKQNQK 70
            +      P      YE+      +  +  +P  P+E        LE A      E +   
Sbjct: 771  ETEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTP 830

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             +    Q + S   + +  +++ +   P   +  +              S   +   +  
Sbjct: 831  PVKIPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKPEEPTYDPL 890

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
             +P       +      V T H + SS+     I  +        +          + + 
Sbjct: 891  PTPPLAPTPKQLPTPPVVPTVHFHYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFE 950

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
            +        R   +    L +     Y   L      + G   +  ++  ++T     E+
Sbjct: 951  LKTEALTAGRPKTT-SFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDET 1009

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
            L   N D       + P +  R+L DG+ 
Sbjct: 1010 LATYNADLTKPVETLHPTVVGRVLNDGAT 1038



 Score = 42.3 bits (97), Expect = 0.21,   Method: Composition-based stats.
 Identities = 7/154 (4%), Positives = 22/154 (14%)

Query: 114 KLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRR 173
               +              P   +  +    +         D            ++    
Sbjct: 756 PTKPVAPTAPTQPMYETEKPLEPAPVVPTYENEPTPPVKTPDQPEPSKPEEPTYETEKPL 815

Query: 174 GKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSY 233
                  ++                ++     Y                      +    
Sbjct: 816 EPAPVAPTYENEPTPPVKIPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPD 875

Query: 234 SIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRP 267
               SK     +    +       K+     + P
Sbjct: 876 QPEPSKPEEPTYDPLPTPPLAPTPKQLPTPPVVP 909


>gi|313113890|ref|ZP_07799450.1| hypothetical protein HMPREF9436_01301 [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623793|gb|EFQ07188.1| hypothetical protein HMPREF9436_01301 [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 900

 Score = 74.7 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/309 (7%), Positives = 72/309 (23%), Gaps = 7/309 (2%)

Query: 13  DNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSL 72
           +N PE  P++R  ++   +        + +   P+E+   +    E A  + E   +  L
Sbjct: 37  ENQPEEKPQKRFGLFGRGKEKQETDEAAAE--QPQEMPTGEVRLGEDAQPEPEADLELML 94

Query: 73  HTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLS 132
                 ++   P   +  +                 +++  +    +  +   ++     
Sbjct: 95  KPEADPEQELAPWPFLEKEAEDTQPEAPAKKPEEKSASQTAEPPAAVKPETPRQSAVPA- 153

Query: 133 PKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVH 192
                           + ++  +  +      + + ++L+          P      +  
Sbjct: 154 --ARPAEQHSTAKPLRHPKNAPEVLLPQEEQEQQEMAQLKAMINGLSDQKPEKPAPRAEA 211

Query: 193 NYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLD 252
                          + +      +         +      +              ++  
Sbjct: 212 APAAETEPAESKKKPSGAPLPAAVFAAVKETAPELQPEK--TEQPVADFFGKAQSEDAPQ 269

Query: 253 GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTF 312
                 +   +         L  DG E    P   P A        A       +   T 
Sbjct: 270 APLAPAEEPAAKEDTMSLPLLPLDGEEPQQAPEKAPAAPQPELKAEAEDAVSPEEHAETE 329

Query: 313 VLGKKEIEE 321
           +   +   +
Sbjct: 330 LTEPEATAD 338


>gi|118093534|ref|XP_001234116.1| PREDICTED: similar to titin isoform N2-A [Gallus gallus]
          Length = 13256

 Score = 74.7 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/377 (6%), Positives = 51/377 (13%), Gaps = 46/377 (12%)

Query: 43   PRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDI-----PKSSVTSKENIFLE 97
            P +    + ++    E+  + V K+           K+        P            E
Sbjct: 7061 PPVIVPEVPKRPLPEEKVPVPVPKKEAPPAKVPALPKKPVPKEKVLPAVPKKETVPPAEE 7120

Query: 98   PRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSS 157
            P                +                                    HE    
Sbjct: 7121 PEFYEDVPTEELPAIIPIKPEAPAPKAPTVTKKTVSLKKIPAAVPKKEAPPPQVHEVYEE 7180

Query: 158  VSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKY 217
            +     I     +                            T       S      + K 
Sbjct: 7181 IYIEEEISPVHRKEEAPPPRVPEVVKVAPEVPIAVPKKPEPTPVSRKPESPPKVPDVPKK 7240

Query: 218  FVFLIILLGMAIGVSYSIGKSKG-----------SITHFLRRESLDGGNVD--------- 257
                 + + +      +  K              S              V          
Sbjct: 7241 IPEEKVPITVPKKPEPTPAKEPEVHKKIEEKIKVSEPKKPEVPPAKVPEVPKKVVKEEVS 7300

Query: 258  -----------------KKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAF 300
                              K V    +  +      +            +           
Sbjct: 7301 VEVPKKPEPPPAKVPEVPKKVVPEEKVHVEVPKKAEPPPPKEPEVPKKIVPEKKLPEPVA 7360

Query: 301  KNYIGGD-ENSTFVLGKKEIE---EGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKS 356
                       T    KK  E      P   E      +           +     +   
Sbjct: 7361 VPEKPEPLPEKTPEPEKKIPEKRKPAVPAPTEDIKLAKELLKAPEARKKVVTAKPVEAPQ 7420

Query: 357  QGLKGLVIKGDIPMIDN 373
                   + G +     
Sbjct: 7421 LEPPPAKVPGLVKKPRR 7437



 Score = 69.7 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/367 (5%), Positives = 72/367 (19%), Gaps = 14/367 (3%)

Query: 20   PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK-QD 78
            PE++  + +       +  E  K  +P+E L +     E    +V    +K +   K   
Sbjct: 6264 PEKKVAVPKREAAPPPKAPEVPKKPVPEEKLPQIPKVEEAPPAKVPAVPKKPVPKEKVPP 6323

Query: 79   KESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSC 138
                  ++       +           I        +   +    +         +    
Sbjct: 6324 AVPKKVEAPPAKVPEVQKRATFEERMLITEERISIAVPEEIPSPEEPIVEEWSEEETEEV 6383

Query: 139  RLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNK 198
             +            E    +     +   K                     +        
Sbjct: 6384 SVSIHREEVSEVTEEESYYIEEKVTVPKRKEAPPPKVPEKPRRIAPEPEIPAAPKEAPAA 6443

Query: 199  TRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES------LD 252
                +   +A  E         +               +         +          +
Sbjct: 6444 KVPEVHKKAAPKEKVPVPVPKKVEAPPARERPEEVPTVEIAVEEPPSTKVTQVHRQIITE 6503

Query: 253  GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI-----AFKNYIGGD 307
                  K   +  +  + ++ + +          +                  +  I   
Sbjct: 6504 EKVAVAKKDEAPPKRAVPKKTVPEEKVPVPVSRKVAAPPAKVPEEPKKMIREERVPIAVP 6563

Query: 308  ENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSL--QQEKSQGLKGLVIK 365
            +       +   EE +  + E        + + S     +      ++         + +
Sbjct: 6564 KRKVSPPLEVPTEEEHWAMSEEVSVSLHTKDEISYTVPDVPERAIIEERVPISPPKKMPR 6623

Query: 366  GDIPMID 372
                + +
Sbjct: 6624 PPAKVPE 6630



 Score = 67.0 bits (161), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/316 (7%), Positives = 72/316 (22%), Gaps = 4/316 (1%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESM---KPRLPKEILERQFNKLEQAILQVEKQ 67
            A+  +    P  ++        S+ +   ++   +   P+     +   +E+ I  V ++
Sbjct: 7134 AIIPIKPEAPAPKAPTVTKKTVSLKKIPAAVPKKEAPPPQVHEVYEEIYIEEEISPVHRK 7193

Query: 68   NQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRT 127
             +       +  +          K+        +  S     +  KK+          + 
Sbjct: 7194 EEAPPPRVPEVVKVAPEVPIAVPKKPEPTPVSRKPESPPKVPDVPKKIPEEKVPITVPKK 7253

Query: 128  NTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSI 187
                  K      +      V+   + +   + V  +     +            P  + 
Sbjct: 7254 PEPTPAKEPEVHKKIEEKIKVSEPKKPEVPPAKVPEVPKKVVKEEVSVEVPKKPEPPPAK 7313

Query: 188  FWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247
               V      + +  +            +  V   I+    +    ++ +    +     
Sbjct: 7314 VPEVPKKVVPEEKVHVEVPKKAEPPPPKEPEVPKKIVPEKKLPEPVAVPEKPEPLPEKTP 7373

Query: 248  RESLD-GGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGG 306
                                 K+ + LL+         +  PV         A    +  
Sbjct: 7374 EPEKKIPEKRKPAVPAPTEDIKLAKELLKAPEARKKVVTAKPVEAPQLEPPPAKVPGLVK 7433

Query: 307  DENSTFVLGKKEIEEG 322
                         +E 
Sbjct: 7434 KPRRVIPEVTPPPKEE 7449



 Score = 61.6 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/331 (6%), Positives = 67/331 (20%), Gaps = 17/331 (5%)

Query: 54   FNKLEQAILQVEKQNQKSLHTSKQDKESDI-------PKSSVTSKENIFLEPRLRSISSI 106
                E+ +   +++        +  K+          PK        +   P+       
Sbjct: 6261 RAPPEKKVAVPKREAAPPPKAPEVPKKPVPEEKLPQIPKVEEAPPAKVPAVPKKPVPKEK 6320

Query: 107  LRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEH 166
            +     KK+    +   + +       +      R  ++         +  V   +  E 
Sbjct: 6321 VPPAVPKKVEAPPAKVPEVQKRATFEERMLITEERISIAVPEEIPSPEEPIVEEWSEEET 6380

Query: 167  DKSRLRRGKLAGIFSF-------PTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219
            ++  +   +                             K        +   E        
Sbjct: 6381 EEVSVSIHREEVSEVTEEESYYIEEKVTVPKRKEAPPPKVPEKPRRIAPEPEIPAAPKEA 6440

Query: 220  FLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSE 279
                +  +    +                 + +          +   P  T+        
Sbjct: 6441 PAAKVPEVHKKAAPKEKVPVPVPKKVEAPPARERPEEVPTVEIAVEEPPSTKVTQVHRQI 6500

Query: 280  VDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQ 339
            +      +   D A       K  +  ++    V  K             ++   +    
Sbjct: 6501 ITEEKVAVAKKDEAPPKRAVPKKTVPEEKVPVPVSRKVAAPPAKVPEEPKKMIREER--- 6557

Query: 340  SSILSGKILWSLQQEKSQGLKGLVIKGDIPM 370
              I   K   S   E     +   +  ++ +
Sbjct: 6558 VPIAVPKRKVSPPLEVPTEEEHWAMSEEVSV 6588



 Score = 59.3 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 42/411 (10%), Positives = 96/411 (23%), Gaps = 20/411 (4%)

Query: 11   AVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQK 70
            AV   PE TP  R             ++  +  ++P+E +     K  +     E +  K
Sbjct: 7214 AVPKKPEPTPVSRKP-------ESPPKVPDVPKKIPEEKVPITVPKKPEPTPAKEPEVHK 7266

Query: 71   SLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTN 130
             +    +  E   P+        +  +     +S  +        A +  V  K      
Sbjct: 7267 KIEEKIKVSEPKKPEVPPAKVPEVPKKVVKEEVSVEVPKKPEPPPAKVPEVPKKVVPEEK 7326

Query: 131  LSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWS 190
            +  +                +        P      +K      K       P   I   
Sbjct: 7327 VHVEVPKKAEPPPPKEPEVPKKIVPEKKLPEPVAVPEKPEPLPEKT----PEPEKKIPEK 7382

Query: 191  VHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRES 250
                    T  +      L      K  V    +    +    +           +  E 
Sbjct: 7383 RKPAVPAPTEDIKLAKELLKAPEARKKVVTAKPVEAPQLEPPPAKVPGLVKKPRRVIPEV 7442

Query: 251  LDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENS 310
                  +   V   +  K          +                               
Sbjct: 7443 TPPPKEE--VVLKRVLRKKPEEEEPKPEKEPKPEVKPVPTPVEKIKKPEVPEVPKKKTEI 7500

Query: 311  TFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVI---KGD 367
              +  +++     P   +      +     +          ++  ++      +   KG 
Sbjct: 7501 PVIKKEEKHVPEPPKALKSPKPAAEPAPAITTAPVTTPVVGKKAAAEKPDAPSLLKHKGK 7560

Query: 368  IPMIDNAFSASMTLKCNADISLSITHVMEI