RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (503 letters) >gnl|CDD|39853 KOG4654, KOG4654, KOG4654, Uncharacterized conserved protein [Function unknown]. Length = 252 Score = 34.7 bits (79), Expect = 0.058 Identities = 19/92 (20%), Positives = 35/92 (38%), Gaps = 2/92 (2%) Query: 20 PERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKL-EQAILQVEKQNQKSLHTSKQD 78 + S + A N++ +E P++ +L + +V K S+ +KQD Sbjct: 157 KDAASKVL-GALNNILAIIEHFNPKIEDYAAVNHIPQLSADEVEEVIKAELDSIPLAKQD 215 Query: 79 KESDIPKSSVTSKENIFLEPRLRSISSILRSN 110 + KE F + R I+ +LR Sbjct: 216 AFDGVEPFKEQHKEAAFFKEASRGIADLLRRK 247 >gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton]. Length = 1930 Score = 31.7 bits (72), Expect = 0.42 Identities = 19/115 (16%), Positives = 40/115 (34%), Gaps = 2/115 (1%) Query: 27 YEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKS 86 +E LE +K +L + + E + ++E A + +K+ + +Q+ E Sbjct: 1366 FEEEVLQRLEELEELKKKLQQRLQELE-EQIEAANAKNASL-EKAKNRLQQELEDLQLDL 1423 Query: 87 SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLR 141 + LE + + +L K K + R LS + + Sbjct: 1424 ERSRAAVAALEKKQKRFEKLLAEWKKKLEKLQAELDAAQRELRQLSTELQKLKNA 1478 >gnl|CDD|34476 COG4867, COG4867, Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 652 Score = 31.6 bits (71), Expect = 0.57 Identities = 26/127 (20%), Positives = 54/127 (42%), Gaps = 18/127 (14%) Query: 12 VDNLPENTPERRSHIYEHA-RNSVAR-RLESMKPRLPKEILERQFNKLEQAILQVEKQNQ 69 +D LPE+ + + E+ R+ AR + E +K L +E+L+++F ++QA+ ++ Sbjct: 121 LDALPESPAKAVQELAEYRWRSGQAREKYEQIKDLLGRELLDQRFAGMKQALAGATDDDR 180 Query: 70 KSLHT---------SKQDKESDIPK--SSVTSKENIFLEPRLRSISSIL-----RSNKHK 113 + + K + D + +K F R++ +L R+ Sbjct: 181 RRVTEMLDDLNDLLDKHARGEDTQRDFDEFMTKHGEFFPENPRNVEELLDSLAARAAAAS 240 Query: 114 KLANILS 120 + N LS Sbjct: 241 RFRNSLS 247 >gnl|CDD|36151 KOG0933, KOG0933, KOG0933, Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics, Cell cycle control, cell division, chromosome partitioning]. Length = 1174 Score = 30.7 bits (69), Expect = 0.87 Identities = 26/162 (16%), Positives = 48/162 (29%), Gaps = 24/162 (14%) Query: 17 ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSK 76 + ERR E + +R E L K E + +LE L+ E + K Sbjct: 782 KANRERRLKDLEKEIKTAKQRAEESSKELEKRENEYERLQLEHEELEKEISSLKQQLEQL 841 Query: 77 QDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNF 136 + + S + KS + N K+ + K++ Sbjct: 842 EKQISSL-KSEL--------------------GNLEAKVDKVEKDVKKAQAELKDQKAKQ 880 Query: 137 ---SCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGK 175 + +L+ E +EH+ ++L K Sbjct: 881 RDIDTEISGLLTSQEKCLSEKSDGELERKKLEHEVTKLESEK 922 >gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA processing and modification]. Length = 1238 Score = 30.8 bits (69), Expect = 1.0 Identities = 22/125 (17%), Positives = 44/125 (35%), Gaps = 11/125 (8%) Query: 287 IPVADFANTSNIAFKNYIGGDENST-------FVLGKKEIE-EGNPLIGE-GRVFINKGR 337 P FA +N + ++ + +L K E + N + GR+ ++ G Sbjct: 963 HPQLCFAYAANGSTLEHLEEYRAALELATRLIGLLELKLDESQYNVAKPDAGRLELSLGE 1022 Query: 338 GQSSILSGKILWSLQQEKSQGLK-GLVIKGDIPMIDNAFSASMTL-KCNADISLSITHVM 395 +S+ + W E +G L K D F ++++ +D + + V Sbjct: 1023 FESAKKASWKEWMEVDEDIRGTDLTLFFKNDFFSSLEFFEQALSISNSESDKVVLLCKVA 1082 Query: 396 EIMFS 400 M Sbjct: 1083 VCMGL 1087 >gnl|CDD|38923 KOG3719, KOG3719, KOG3719, Carnitine O-acyltransferase CPT2/YAT1 [Lipid transport and metabolism]. Length = 638 Score = 30.3 bits (68), Expect = 1.3 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 32 NSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSK 91 +++ R LES+KP L QF K EQ I E LH ++D +S S+ Sbjct: 33 DTLNRYLESLKPLLD----PEQFRKTEQTIRSFENNIGSKLHEKLLSYDADNKHTSYISQ 88 Query: 92 EN 93 Sbjct: 89 PW 90 >gnl|CDD|177209 MTH00152, ND6, NADH dehydrogenase subunit 6; Provisional. Length = 163 Score = 30.2 bits (69), Expect = 1.3 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Query: 179 IFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFL-IILLGMAIGVSYSIGK 237 F S + F+ + G LSF L + FVFL ++LL + + V Sbjct: 98 FFFLYLYSSGGLSLSSLFDGSSGSLSFGGGLYSSSGWSIFVFLAVLLLIVMVSVVKICYY 157 Query: 238 SKGSI 242 +GS+ Sbjct: 158 EEGSL 162 >gnl|CDD|36983 KOG1772, KOG1772, KOG1772, Vacuolar H+-ATPase V1 sector, subunit G [Energy production and conversion]. Length = 108 Score = 29.5 bits (66), Expect = 1.9 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 7/81 (8%) Query: 21 ERRSH-IYEHARNSVARRLESMKPRLPKEIL------ERQFNKLEQAILQVEKQNQKSLH 73 E+R+ E AR RRL+ K KEI E++F + E A + +K L Sbjct: 15 EKRAAEKVEEARKRKLRRLKQAKEEAEKEIEEYRSQREKEFKEKESAASGSQGALEKRLE 74 Query: 74 TSKQDKESDIPKSSVTSKENI 94 DK + + S+ + +++ Sbjct: 75 QETDDKIAGLKTSAQKNSDDV 95 >gnl|CDD|38868 KOG3664, KOG3664, KOG3664, Predicted patched transmembrane receptor [Signal transduction mechanisms]. Length = 999 Score = 29.6 bits (66), Expect = 2.1 Identities = 18/77 (23%), Positives = 24/77 (31%), Gaps = 6/77 (7%) Query: 162 AAIEHDKSRLRRGKL--AGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFV 219 I D L TGS F + F + LS AL + + Sbjct: 322 ELILTDSLLASLSALLVMASVWIYTGSAFIT----FMSIVAICLSLGVALFFYAVVLGID 377 Query: 220 FLIILLGMAIGVSYSIG 236 F L +A+ V IG Sbjct: 378 FFPYLNLVAVVVIIGIG 394 >gnl|CDD|146016 pfam03179, V-ATPase_G, Vacuolar (H+)-ATPase G subunit. This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialized cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation. Length = 105 Score = 29.5 bits (67), Expect = 2.5 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 7/79 (8%) Query: 21 ERR-SHIYEHARNSVARRLESMKPRLPKEI------LERQFNKLEQAILQVEKQNQKSLH 73 E+ + I AR A+RL+ K KEI E +F + E + +K + Sbjct: 13 EKEAAEIVNEARKRRAKRLKQAKEEAEKEIEEYRAQREAEFKEFEAEHSGSRGELEKKIE 72 Query: 74 TSKQDKESDIPKSSVTSKE 92 ++K ++ +S +KE Sbjct: 73 KETEEKIDELKRSFNKNKE 91 >gnl|CDD|48423 cd03159, TM4SF9_like_LEL, Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF9_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 9 (TM4SF9) or Tetraspanin-5 and related proteins. TM4SF9 is strongly expressed witin the central nervous system, and expression levels appear to correlate with differentiation status of particular neurons, hinting at a role in neuronal maturation.. Length = 121 Score = 28.7 bits (64), Expect = 3.4 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Query: 127 TNTNLSPKN----FSCRLREILSFSVNTQHEYDSSVSPVAAIEHD 167 T++N S + FSC +++ VNTQ YD P ++H Sbjct: 59 TDSNPSRERCGVPFSCCVKDPAEDVVNTQCGYDVRKKPELELQHH 103 >gnl|CDD|144067 pfam00335, Tetraspannin, Tetraspanin family. Length = 221 Score = 28.5 bits (64), Expect = 3.9 Identities = 12/49 (24%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Query: 201 GLLSFYSALSEHH--LFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLR 247 G L A+ E L YF+ L+IL + I + + L+ Sbjct: 61 GFLGCCGAIKESRCLLLTYFILLLILFILEIAAGILAFVYRDKLESSLK 109 >gnl|CDD|38963 KOG3759, KOG3759, KOG3759, Uncharacterized RUN domain protein [Signal transduction mechanisms]. Length = 621 Score = 27.8 bits (61), Expect = 7.1 Identities = 11/59 (18%), Positives = 32/59 (54%) Query: 39 ESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLE 97 + ++LE+Q + ++ I Q+++Q + T+ ++ E ++P++ + K+ L+ Sbjct: 129 LRSESESGNDVLEKQNERQKELIKQLKEQLEDLERTAYENGEGELPQTVILEKQKAILD 187 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 28.0 bits (62), Expect = 7.1 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Query: 264 GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLG--KKEIEE 321 G++ R L++ G+EV V P P+A + N G E ++ ++ +E Sbjct: 181 GLKYNQIRCLVKRGAEVTVVPWDYPIAK-EEYDGLFLSNGPGDPELCPLLVQNVRELLES 239 Query: 322 GNPLIG 327 P+ G Sbjct: 240 NVPVFG 245 >gnl|CDD|38072 KOG2861, KOG2861, KOG2861, Uncharacterized conserved protein [Function unknown]. Length = 399 Score = 27.6 bits (61), Expect = 8.7 Identities = 35/166 (21%), Positives = 56/166 (33%), Gaps = 23/166 (13%) Query: 31 RNSVARRLESMKPRLPKEILERQFNKLEQAILQVE----KQNQKSLHTSKQDKESDIPKS 86 + + + L S L QF + V N + L + +S +P+ Sbjct: 36 KTASKKVLLSEHSILDTAGFREQFLPRREYSSFVTPLSDAPNPRELENLGRRHDSLLPRE 95 Query: 87 SVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSF 146 + E LR K+ K ++L T L F+ L E SF Sbjct: 96 TAYCTEETLGLKELR---------KYFKSTSLL---------TKLGLAEFNECLYEPTSF 137 Query: 147 SVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGS-IFWSV 191 + N S S + + S G+ + IF F G +FW+V Sbjct: 138 NTNYVGLDFSDKSDSSIKPLNGSINGSGEFSEIFVFRYGVVVFWNV 183 >gnl|CDD|132804 cd06894, PX_SNX3_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. This subfamily is composed of SNX3, SNX12, and fungal Grd19. Grd19 is involved in the localization of late Golgi membrane proteins in yeast. SNX3/Grp19 associates with the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, and functions as a cargo-specific adaptor for the retromer. Length = 123 Score = 27.4 bits (61), Expect = 9.3 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 27/93 (29%) Query: 14 NLP-----ENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQF-------------- 54 NLP E++ RR +E R+ + R + + P LP + L+RQ Sbjct: 29 NLPVFKKKESSVRRRYSDFEWLRSELERDSKIVVPPLPGKALKRQLPFRGDDGIFEEEFI 88 Query: 55 ----NKLEQAILQVE----KQNQKSLHTSKQDK 79 LE I +V QN+K LH Q++ Sbjct: 89 EERRKGLETFINKVAGHPLAQNEKCLHMFLQEE 121 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.134 0.374 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,839,256 Number of extensions: 309775 Number of successful extensions: 816 Number of sequences better than 10.0: 1 Number of HSP's gapped: 815 Number of HSP's successfully gapped: 37 Length of query: 503 Length of database: 6,263,737 Length adjustment: 98 Effective length of query: 405 Effective length of database: 4,146,055 Effective search space: 1679152275 Effective search space used: 1679152275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (26.6 bits)