HHsearch alignment for GI: 254780613 and conserved domain: PRK13784

>PRK13784 adenylosuccinate synthetase; Provisional.
Probab=100.00  E-value=0  Score=1233.26  Aligned_cols=426  Identities=41%  Similarity=0.704  Sum_probs=409.4

Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCCEECCCCCEEECCCEEECHHHHH
Q ss_conf             96399995775867605666553157888999577687776599898999981032420359882597793896799999
Q gi|254780613|r    1 MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFI   80 (432)
Q Consensus         1 M~~~vVvG~qwGDEGKGkivd~La~~~d~vvR~~GG~NAGHTVv~~~~~~~~hllPSG~~~p~~~~~ig~GvVidp~~L~   80 (432)
T Consensus         1 M~~~vVvG~qwGDEGKGkivD~La~~~d~VvR~~GG~NAGHTVv~~g~k~~lhliPSGvl~~~~~~~ig~GvVidp~~L~   80 (428)
T PRK13784          1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD   80 (428)
T ss_pred             CCCEEEECCCCCCCCCCHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCEECCCCCEEEECCCEEECHHHHH
T ss_conf             98389981773668732633315067999999068678871899899999997068276389973888994999799999


Q ss_pred             HHHHHHHHCCCCCCHHHEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             99999998289888111044033201370007875998876201346567631013567776665456778875098999
Q gi|254780613|r   81 SEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHI  160 (432)
Q Consensus        81 ~Ei~~l~~~Gv~~~~~rL~Is~ra~ii~P~H~~~D~~~E~~rg~~~~~iGTTgrGIGpaY~Dk~~R~giR~~DL~~~~~l  160 (432)
T Consensus        81 ~Ei~~l~~~gv~~~~~~L~Is~ra~li~P~H~~lD~~~E~~~~---~kIGTTgrGIGPaY~DK~~R~giR~~DL~d~~~l  157 (428)
T PRK13784         81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTS---EKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLL  157 (428)
T ss_pred             HHHHHHHHCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCC---CCCCCCCCCCCHHHHHHHHCCCCCHHHHCCHHHH
T ss_conf             9999999619998877769818853288579998999987457---6556578872177765542155514542187999


Q ss_pred             HHHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHCCEEEHHHHHHHHHHHCCEEEEECCCCCEEECCCCCCCC
Q ss_conf             999999999988887523-8765788999999888887430102024999998840078799986653101013687753
Q gi|254780613|r  161 SKKIEQLLLHHNALRRSF-GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF  239 (432)
Q Consensus       161 ~~kl~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~v~d~~~~l~~a~~~g~~ILfEGAQG~lLDid~GtYP~  239 (432)
T Consensus       158 ~~kl~~~~~~~~~~~~~l~~~~~~~~e~~~~~~~~~~~~l~~~i~Dt~~~l~~al~~gk~ILfEGAQG~lLDid~GtYPy  237 (428)
T PRK13784        158 RSRLAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPF  237 (428)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCEEEEECCCEEEECCCCCCCCC
T ss_conf             99999999999999998627787889999999999999872413669999999984699799973650476056684875


Q ss_pred             CCCCCCCCCCHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             34335743101342155878876499999604232378422135668422253430788778645567666547799889
Q gi|254780613|r  240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRR  319 (432)
Q Consensus       240 VTSS~T~~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPFPTEl~~~~~~~lr~~g~E~GttTgR~RR~GWlDlv~lky  319 (432)
T Consensus       238 VTSSnt~~~g~~~g~g~~~~~i~~viGV~KAY~TRVG~GPFPTEl~de~g~~lre~G~E~GttTGRpRR~GWlD~v~lry  317 (428)
T PRK13784        238 VTSSNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKY  317 (428)
T ss_pred             CCCCCCCHHHHHHCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHCCCEECCCCCCCCCCCCCCHHHHHH
T ss_conf             17777415445414777865445289999831044068999853355034666533961788779973245211799887


Q ss_pred             HHHHCCCCCCEECCCCCCCCCCCCEEEEEEEECCEEEECCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHHHHHHHHH
Q ss_conf             99874874000010022135776213523631887850389993576157779988778886511166988854999999
Q gi|254780613|r  320 SVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNY  399 (432)
Q Consensus       320 a~~ing~~~l~lTKlDvL~~~~~ikvC~~Y~~~g~~~~~~P~~~~~~~~~~PvY~~~~GW~~~~~~~~~~~~LP~~a~~y  399 (432)
T Consensus       318 a~~inG~~~lalTKlDvL~~l~~ikic~~Y~~~G~~~~~~~~~-~~l~~~~Pvy~~~~gw~~~--~~~~~~~LP~~a~~y  394 (428)
T PRK13784        318 SAKCSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPG-IDLYKVEPILVEMEPFSID--ETVTKDNMPAALKTY  394 (428)
T ss_pred             HHHHCCCCEEEEECCEECCCCCEEEEEEEEEECCEEEECCCCH-HHHHCCEEEEEECCCCCCC--CCCCHHHCCHHHHHH
T ss_conf             7755489779997103037987255899998499587047972-4365046789974796756--756348789999999


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCEEEEECCCCCC
Q ss_conf             999999978957999756985317980586789
Q gi|254780613|r  400 IRKIEEVLEVPVALLSIGPERENTLIMSNPFED  432 (432)
Q Consensus       400 i~~IE~~~gvpI~~Is~GP~R~~~I~~~~~f~~  432 (432)
T Consensus       395 i~~IE~~~gvpi~~is~Gp~R~q~I~~~~~f~~  427 (428)
T PRK13784        395 LKTIENHVGIPISSLAYGPSREQILFFEDYFKK  427 (428)
T ss_pred             HHHHHHHHCCCEEEEEECCCCHHEEEECCCCCC
T ss_conf             999999979998999878981206974176547