HHsearch alignment of GI: 254780613 and MMDB domain: 2v40_A_

>2v40_A (A:) Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A*
Probab=100.00  E-value=0  Score=1180.16  Aligned_cols=423  Identities=40%  Similarity=0.698  Sum_probs=409.2

Q ss_pred             CC-EEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCCEECCCCCEEECCCEEECHHHH
Q ss_conf             96-39999577586760566655315788899957768777659989899998103242035988259779389679999
Q gi|254780613|r    1 MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAF   79 (432)
Q Consensus         1 M~-~~vVvG~qwGDEGKGkivd~La~~~d~vvR~~GG~NAGHTVv~~~~~~~~hllPSG~~~p~~~~~ig~GvVidp~~L   79 (432)
                      |+ .++|||+|||||||||||||||+++|+|||||||+||||||++++++|+|||||||+|+|+++|+||+|||+||..|
T Consensus        30 ~~~~~vVvG~qwGDEGKGkivD~La~~~d~VvR~nGG~NAGHTVv~~g~k~~lhliPSG~l~~~~~~~ig~GvVidp~~L  109 (459)
T 2v40_A           30 GNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGL  109 (459)
T ss_dssp             CCCEEEEEESSSSCSSHHHHHHHHHTTCSEEEECSBCSCCCEEEEETTEEEEESSSCGGGGSTTCEEEECTTBEEEHHHH
T ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCEEEEECCEEEEEECCCCEECCCCCEEEECCCEEEEHHHH
T ss_conf             98379998277465761176664616899999906877887089989999999457847736997089899789809999


Q ss_pred             HHHHHHHHHCCCCC--CHHHEEECCCCCCCCHHHHHHHHHHHHHHHCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHC-
Q ss_conf             99999999828988--81110440332013700078759988762013-465676310135677766654567788750-
Q gi|254780613|r   80 ISEIESLAHQGICV--TPNNLRIANNASLILSIHRDLDMLREGALSPC-GAHIGTTQRGIGPAYEDRVGRRAIRVMDLT-  155 (432)
Q Consensus        80 ~~Ei~~l~~~Gv~~--~~~rL~Is~ra~ii~P~H~~~D~~~E~~rg~~-~~~iGTTgrGIGpaY~Dk~~R~giR~~DL~-  155 (432)
                      ++||+.|+++|+++  ..+||+||+||||++|||+++|+++|.+|++. +++||||||||||||+||++|.|||++||+ 
T Consensus       110 ~~Ei~~L~~~gi~v~~~~~rL~Is~ra~ii~P~H~~lD~~~E~~rg~~~~~~iGTTg~GIGpay~dk~~r~gir~~DL~~  189 (459)
T 2v40_A          110 FEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVS  189 (459)
T ss_dssp             HHHHHHHHHHCGGGTTGGGSEEEETTCEEECHHHHHHHHHHHHC------------CCCHHHHHHHHHHTCCCBHHHHTS
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEECCCCEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHC
T ss_conf             99999998629986566300320566312786137667988732002346764544652136677654000000244403


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCEEEHHHHHHHHH-HHCCEEEEECCCCCEEECCC
Q ss_conf             98999999999999988887523876578899999988888743010202499999884-00787999866531010136
Q gi|254780613|r  156 DVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERES-RKGAHILFEGAQGFLLDNDH  234 (432)
Q Consensus       156 ~~~~l~~kl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~v~d~~~~l~~a~-~~g~~ILfEGAQG~lLDid~  234 (432)
                      +++.|++|++.+.++++.+   |+..++++++++++++++.++++||++|+..++++++ +++++||||||||+|||+||
T Consensus       190 d~~~l~~kl~~~~~~~~~~---~~~~~~~~e~~~~~~~~~~~~l~~~i~D~~~~l~~al~~~gk~vLfEGaQG~lLDid~  266 (459)
T 2v40_A          190 DFDGFSERFKVLANQYKSI---YPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDF  266 (459)
T ss_dssp             CHHHHHHHHHHHHHHHHHH---CTTCCCCHHHHHHHHHHHHHHHGGGEECHHHHHHHHHHSSCCCEEEECCSCGGGCTTT
T ss_pred             HHHHHHHHHHHHHHHHHHH---CCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEHHHHHHHHHCCC
T ss_conf             4778999999998877653---2433201889999999999874022022089999999718986998112467774026


Q ss_pred             CCCCCCCCCCCCCCCHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCH
Q ss_conf             87753343357431013421558788764999996042323784221356684222534307887786455676665477
Q gi|254780613|r  235 GTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDL  314 (432)
Q Consensus       235 GtYP~VTSS~T~~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPFPTEl~~~~~~~lr~~g~E~GttTgR~RR~GWlDl  314 (432)
                      |||||||||||+++++++|+|++|+.+++||||+|||+||||+||||||++++.++.||+.|+|||+||||||||||||+
T Consensus       267 GtyP~VTSSnt~~~~~~~g~Gi~~~~i~~viGV~KAY~TRVG~GPfpTEl~~e~~~~lr~~g~E~Gt~TGR~RR~GwlD~  346 (459)
T 2v40_A          267 GTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDL  346 (459)
T ss_dssp             SSTTSSCSSCCSTHHHHHHHTCCGGGEEEEEEEEESSEEESSSSCCTTBCCSHHHHHHHHHTTCBCTTTCCBCEEECEEH
T ss_pred             CCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCHH
T ss_conf             73676345763476665326988541121789976641010566677756774445042237764764587545664214


Q ss_pred             HHHHHHHHHCCCCCCEECCCCCCCCCCCCEEEEEEEECCEEEECCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHHHH
Q ss_conf             99889998748740000100221357762135236318878503899935761577799887788865111669888549
Q gi|254780613|r  315 ASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPI  394 (432)
Q Consensus       315 v~lkya~~ing~~~l~lTKlDvL~~~~~ikvC~~Y~~~g~~~~~~P~~~~~~~~~~PvY~~~~GW~~~~~~~~~~~~LP~  394 (432)
                      |++|||+++||+|+|+||||||||++++||||++|+++|++++.||++...+++++|||++||||++|++++++|++||.
T Consensus       347 v~lrya~~ing~~~lalTklDvL~~l~~ikic~~Y~~~g~~~~~~P~~~~~l~~~~Pvy~~~~GW~~d~~~~~~~e~LP~  426 (459)
T 2v40_A          347 VLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPV  426 (459)
T ss_dssp             HHHHHHHHHHCCSEEEEECGGGGGGCSEEEEEEEEEETTEEESSCCSSHHHHTTCEEEEEEEECCCSCCTTCCSGGGSCH
T ss_pred             HHHEEEEEECCCCEEEEEEEEECCCCCCEEEEEEEEECCEECCCCCCCHHHHCCCEEEEEECCCCCCCCCCCCCHHHCCH
T ss_conf             44311015335433888852323788835688888529967244898967852674889976898871005776588169


Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCEEEEE
Q ss_conf             99999999999978957999756985317980
Q gi|254780613|r  395 QARNYIRKIEEVLEVPVALLSIGPERENTLIM  426 (432)
Q Consensus       395 ~a~~yi~~IE~~~gvpI~~Is~GP~R~~~I~~  426 (432)
                      +|++||++||+++|+||++||+||+|+|||++
T Consensus       427 ~a~~yi~~iE~~~g~pv~~is~Gp~r~~~I~~  458 (459)
T 2v40_A          427 NAQNYVRFIEDELQIPVKWIGVGKSRESMIQL  458 (459)
T ss_dssp             HHHHHHHHHHHHHTCCEEEEECSSSTTSEEEC
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCHHHEEEC
T ss_conf             99999999999989988999708985674863