BLAST/PSIBLAST alignment of GI: 254780613 and GI: 86358942 at iteration 1
>gi|86358942|ref|YP_470834.1| adenylosuccinate synthetase [Rhizobium etli CFN 42] Length = 432
>gi|123510977|sp|Q2K4X9|PURA_RHIEC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase; Short=AdSS; AltName: Full=IMP--aspartate ligase Length = 432
>gi|86283044|gb|ABC92107.1| adenylosuccinate synthetase protein [Rhizobium etli CFN 42] Length = 432
 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 284/432 (65%), Positives = 351/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EIE L+ QG+ +TP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIEKLSAQGVTITPDNLRIADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLPGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    E++LPF D +W  L++E RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSVAERVLPFRDTVWLFLDKERRKGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELTDEIGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYVTLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432