BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (432 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|163746032|ref|ZP_02153391.1| adenylosuccinate synthetase [Oceanibulbus indolifex HEL-45]
 gi|161380777|gb|EDQ05187.1| adenylosuccinate synthetase [Oceanibulbus indolifex HEL-45]
          Length = 431

 Score =  517 bits (1332), Expect = e-144,   Method: Composition-based stats.
 Identities = 236/432 (54%), Positives = 304/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ + P NL IA N  LIL  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETIEGQGVEINPENLMIAENTPLILPFHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGP YED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPCYEDKVGRRAIRVADLADPATLEARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++ +L     KI+PF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDALIAQLQEIAPKIMPFAAPVWKVLAEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ P ++ YVLG+VKAYTTRVG GPFPTEL++  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPTAIDYVLGIVKAYTTRVGEGPFPTELEDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A +R++   +G+ GI LTKLDVLDG + LK+CVGY +DG  +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALLRQTCATSGITGICLTKLDVLDGFETLKVCVGYDLDGERLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  L GW +ST G R +A+LP  A  Y+R+IEE+++ PVAL+S  PER
Sbjct: 360 TAAEQQARCVPIYEELPGWSESTEGARSWAELPANAIKYVRRIEELIQCPVALVSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|260433191|ref|ZP_05787162.1| adenylosuccinate synthetase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417019|gb|EEX10278.1| adenylosuccinate synthetase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 430

 Score =  516 bits (1329), Expect = e-144,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 302/432 (69%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LIL  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETIRSQGVDITPETLMIAENTPLILPFHGELDRARES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGP YED+VGRR IRV DL D   ++ ++++ L+HHNALR   G 
Sbjct: 121 --QNSVAKIGTTGRGIGPCYEDKVGRRVIRVADLADDATLALRVDRALVHHNALRNGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++ +L      ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 EPIDRDALIAQLKEIAPLILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN +S QA+ G GI PGS+ +VLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 239 TSSNVISGQAATGVGIGPGSIDFVLGIVKAYTTRVGEGPFPTELHDADGQRLGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++   +GV GI+LTKLDVLDG + LKICV Y +DG+ +D+LP
Sbjct: 299 TTTGRKRRCGWFDACLVRQTCATSGVNGISLTKLDVLDGFETLKICVAYELDGKRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE++E PVALLS  PER
Sbjct: 359 TAADQQARCTPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIECPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 419 DDTILVTDPFAD 430


>gi|114771699|ref|ZP_01449103.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
 gi|114547771|gb|EAU50661.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
          Length = 431

 Score =  516 bits (1329), Expect = e-144,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 308/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD+I RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADIIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   ++EI+++  QGI + P NL IA N  LIL +H +LD LRE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLNEIKTIESQGISINPENLMIAENTPLILPLHGELDRLREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D+  +  +I++ L HHN LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADMTTLEARIDRALQHHNPLRKGLGF 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    +L +L     KILP+   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 DEIDRDKLLSDLKEIAPKILPYAAPVWKVLNEKRKSGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ P ++ YVLG+VKAYTTRVG GPFP+EL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPTAIDYVLGIVKAYTTRVGEGPFPSELDDDDGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A +R++   +G+ GI LTKLDVLDG + LKICV Y +DG+ +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALLRQTCATSGITGICLTKLDVLDGFETLKICVAYDLDGKRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +   +R  P+Y  + GW +ST G R + DLP  A  Y+R++EE+++ PVAL+S  PER
Sbjct: 360 TAAEDQSRCVPIYEDMPGWSESTEGARSWNDLPAAAIKYVRRVEELIDCPVALVSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|254464539|ref|ZP_05077950.1| adenylosuccinate synthetase [Rhodobacterales bacterium Y4I]
 gi|206685447|gb|EDZ45929.1| adenylosuccinate synthetase [Rhodobacterales bacterium Y4I]
          Length = 431

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 304/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ +TP  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIATVQAQGVEITPETLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLVARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V    ++ +L     +ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 DPVDRDALIAQLKEIAPQILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G GI PGS+ YVLG+VKAYTTRVG GPFPTEL++  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGIGPGSINYVLGIVKAYTTRVGEGPFPTELEDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TTTGRKRRCGWFDACLVRQTCATSGINGISLTKLDVLDGFETLKICVGYELDGERLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R + DLP  A  Y++++EE++E PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEMPGWSESTEGARSWNDLPANAIKYVKRVEELIECPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 420 DDTILVTDPFAD 431


>gi|227823297|ref|YP_002827269.1| adenylosuccinate synthetase [Sinorhizobium fredii NGR234]
 gi|254788717|sp|C3MI14|PURA_RHISN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|227342298|gb|ACP26516.1| adenylosuccinate synthetase [Sinorhizobium fredii NGR234]
          Length = 432

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 282/432 (65%), Positives = 351/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV+DPHA I+EI+ L  QG+ +TP+NLRIA+NA+LILS+HR+LD  RE 
Sbjct: 61  RPGKLAVIGNGVVIDPHALIAEIDKLGKQGVQITPDNLRIADNATLILSLHRELDGFRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K+++LL HHNALRR  GE
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDTLPAKVDRLLTHHNALRRGLGE 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+ ++ I++EL     ++LPFMD +W LL++E RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEISHQAIMDELSSVAARVLPFMDTVWLLLDKERRKGARILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG+LGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGALGYILGITKAYTTRVGEGPFPTELHDEVGQFLGERGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY +DG+E+D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVAANGITGIALTKLDVLDGLDELKICVGYTLDGQEIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    +PVY+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQAQQASVKPVYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|15966481|ref|NP_386834.1| adenylosuccinate synthetase [Sinorhizobium meliloti 1021]
 gi|307300482|ref|ZP_07580262.1| adenylosuccinate synthetase [Sinorhizobium meliloti BL225C]
 gi|307318347|ref|ZP_07597782.1| adenylosuccinate synthetase [Sinorhizobium meliloti AK83]
 gi|21263891|sp|Q92MA5|PURA_RHIME RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|15075752|emb|CAC47307.1| Probable adenylosuccinate synthetase IMP--aspartate ligase
           [Sinorhizobium meliloti 1021]
 gi|306896029|gb|EFN26780.1| adenylosuccinate synthetase [Sinorhizobium meliloti AK83]
 gi|306904648|gb|EFN35232.1| adenylosuccinate synthetase [Sinorhizobium meliloti BL225C]
          Length = 432

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 286/432 (66%), Positives = 353/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV+DPHA ++EI+ LA QG+ VTP NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKLAVIGNGVVIDPHALLAEIDKLAAQGVKVTPENLRIADNATLILSLHRELDGIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K+++LL HHNALRR  GE
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDTLPAKVDRLLTHHNALRRGLGE 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+ ++ I++EL    E++LPFMD IW LL+RE RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEISHQAIMDELSSVAERVLPFMDTIWLLLDRERRKGARILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELDDEIGRFLGERGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY +DG+++D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVAANGITGIALTKLDVLDGLDELKICVGYTLDGQQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    +PVY+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQAQQASAKPVYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|13473317|ref|NP_104884.1| adenylosuccinate synthetase [Mesorhizobium loti MAFF303099]
 gi|21263903|sp|Q98F97|PURA_RHILO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|14024065|dbj|BAB50670.1| adenylosuccinate synthetase [Mesorhizobium loti MAFF303099]
          Length = 432

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 274/432 (63%), Positives = 337/432 (78%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+  VYKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVVDGKVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DPHAF++E+  L  QG+ VTP+ L+IA N +LILS+HR+LD  RE 
Sbjct: 61  RQGKLSIIGNGVVFDPHAFVAEVAKLKAQGVEVTPDRLKIAENTALILSLHRELDGFRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRA+RVMDL D+E +  K+++LL HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAVRVMDLADLETLPLKVDRLLTHHNALRRGLGH 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV +  I+ EL    ++ILP+MD +W +L+ + R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 181 GEVTHDAIMAELTSVADEILPYMDRVWKILDDKRRAGERILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTE KN+ G+FL   G EFG
Sbjct: 241 TSSNTVAGQAAAGSGVGPGAIGYVLGITKAYTTRVGEGPFPTEQKNEIGEFLGTRGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V +NG+KGIALTKLDVLDGLDE+K+C GYR+DG  +D+LP
Sbjct: 301 VVTGRKRRCGWFDAVLVRQAVAVNGIKGIALTKLDVLDGLDEIKVCTGYRLDGEMIDYLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  LEGWK +TAG R + DLP QA  Y+R IEE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPVYETLEGWKGTTAGARSWNDLPAQAVKYVRYIEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF+D
Sbjct: 421 DDTILVTDPFQD 432


>gi|222149603|ref|YP_002550560.1| adenylosuccinate synthetase [Agrobacterium vitis S4]
 gi|254784028|sp|B9JRD7|PURA_AGRVS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|221736585|gb|ACM37548.1| adenylosuccinate synthetase [Agrobacterium vitis S4]
          Length = 432

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 289/432 (66%), Positives = 354/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++ I YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIDGISYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EI  LA QG+ VTP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIAKLAAQGVTVTPDNLRIADNATLILSLHRELDGMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +  G  IGTT+RGIGPAYED+VGRRAIRVMDL D E +++K+ ++L HHNALRR FG 
Sbjct: 121 AATNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADPEGLAEKVARILPHHNALRRGFGA 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV + TI+EEL+   +K+LPF + +W +L++E R+GA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 PEVEHSTIMEELLSVADKVLPFRETVWLMLDKERRRGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELTDEVGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY++DG E+D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLDELKICVGYKLDGVEIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 AAQAAQARVEPIYVTLEGWKESTVGARKWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|209965016|ref|YP_002297931.1| adenylosuccinate synthetase [Rhodospirillum centenum SW]
 gi|226709085|sp|B6ITA0|PURA_RHOCS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|209958482|gb|ACI99118.1| adenylosuccinate synthetase [Rhodospirillum centenum SW]
          Length = 430

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 304/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL + D+ YKLSLLPSGVV
Sbjct: 1   MANVAVVGSQWGDEGKGKIVDWLSSRADVVVRFQGGHNAGHTLVIGDVEYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VVVDP A + EI+++  +G+ VTP  L +A N +LIL +H  +D  RE 
Sbjct: 61  RPGKLSVIGNGVVVDPWALLREIDTIRAKGVTVTPETLLVAENCALILPLHGAVDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     + IGTT RGIGPAYED+V RRAIR+ DL D   +  K++ LL HHNAL R  G 
Sbjct: 121 AR--GASKIGTTGRGIGPAYEDKVARRAIRLCDLADDRVLEDKVDHLLFHHNALLRGLGA 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    ++ ++     +ILP+  V+W  L+   R    ILFEGAQG +LD DHGTYPFV
Sbjct: 179 AEIDKAELMAQIAEVAPRILPYAAVVWQRLDEAKRARKRILFEGAQGAMLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ GSG+ PG +GYVLG+ KAYTTRVG GPFPTEL + TG+ L   G+EFG
Sbjct: 239 TSSNTVAGNAAAGSGMGPGVVGYVLGITKAYTTRVGSGPFPTELTDATGEQLGLRGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+++   G+ GIALTKLDVLDG  ELK+C GYR  G  +  LP
Sbjct: 299 TVTGRKRRCGWFDAVMVRQAIKTGGITGIALTKLDVLDGFSELKVCTGYRYQGEIIHHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EPVY   +GW +ST G R +ADLP  A  Y+R+IEE++E PV LLS  PER
Sbjct: 359 AGQTAQAAVEPVYETFQGWSESTRGARSWADLPATAVKYVRRIEELVEAPVTLLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 419 DDTILMRDPFED 430


>gi|328951924|ref|YP_004369258.1| Adenylosuccinate synthetase [Desulfobacca acetoxidans DSM 11109]
 gi|328452248|gb|AEB08077.1| Adenylosuccinate synthetase [Desulfobacca acetoxidans DSM 11109]
          Length = 431

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 205/431 (47%), Positives = 279/431 (64%), Gaps = 3/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVD L+E+AD++VR+QGGNNAGHTL V    +   L+PSG++
Sbjct: 1   MANVVVVGTQWGDEGKGKIVDLLTEHADIVVRYQGGNNAGHTLVVQGQKFIFHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VVVDP   + EI+ L  QG+ V P+NL ++  A +I+  H+ LD  RE 
Sbjct: 61  HVGKKCLIGNGVVVDPEVLLMEIDRLKTQGLEVGPHNLVLSEKAHIIMPYHQRLDHARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-G 179
             +     IGTT RGIGP YED++ R  +RV+DL D E +  K+E  L   N L   F  
Sbjct: 120 -RAKGAGKIGTTGRGIGPCYEDKISRCGVRVVDLIDPETLKAKVEHNLKEKNFLLERFLE 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +  +    + +      E + P +  +  LL    RKG +ILFEGAQG  LD DHGTYPF
Sbjct: 179 DAPLDAAEVYDRYRQMGEHLRPLVGNVSLLLAEAIRKGQNILFEGAQGTHLDIDHGTYPF 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++  A  G+GI PG L  VLG+ KAYTTRVGGGPF TE  +  G+ ++  G EF
Sbjct: 239 VTSSNPVAGGACTGAGIGPGKLNRVLGISKAYTTRVGGGPFITEALDADGEHMQVQGAEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G+ T R+RR GWLD   +  SV +NG+ G A+TKLDVL GLD LKICV Y ++G+ +  +
Sbjct: 299 GSTTGRKRRTGWLDAVVLNDSVRLNGLTGFAITKLDVLTGLDPLKICVAYDLNGKRLQNV 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + +PVY  L GW++   G R F +LP +AR Y+R++EE+  +P+ ++S+GP+
Sbjct: 359 PASLSALEQCQPVYEELPGWQEDLTGKRRFEELPEEARRYLRRVEELTGIPIQIVSVGPD 418

Query: 420 RENTLIMSNPF 430
           RE T++++NPF
Sbjct: 419 REETILLANPF 429


>gi|319781041|ref|YP_004140517.1| adenylosuccinate synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166929|gb|ADV10467.1| adenylosuccinate synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 432

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 274/432 (63%), Positives = 337/432 (78%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+  VYKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVVDGKVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DPHAF++E+  L  QG+ V P+ L+IA N +LILS+HR+LD  RE 
Sbjct: 61  RQGKLSIIGNGVVFDPHAFVAEVAKLKAQGVEVAPDRLKIAENTALILSLHRELDGFRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRA+RVMDL D+E +  K+++LL HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAVRVMDLADLETLPLKVDRLLTHHNALRRGLGH 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV + TI++EL    + ILP+MD +W +L+ + R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVTHDTIMQELTSVADDILPYMDRVWKILDDKRRAGERILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTE KN+ G+FL   G EFG
Sbjct: 241 TSSNTVAGQAAAGSGVGPGAIGYVLGITKAYTTRVGEGPFPTEQKNEVGEFLGTRGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V +NG+KGIALTKLDVLDGLDE+K+C GYR+DG  +D+LP
Sbjct: 301 VVTGRKRRCGWFDAVLVRQAVAVNGIKGIALTKLDVLDGLDEIKVCTGYRLDGEMIDYLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  LEGWK +TAG R + DLP QA  Y+R IEE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPVYETLEGWKGTTAGARSWNDLPAQAVKYVRYIEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF+D
Sbjct: 421 DDTILVTDPFQD 432


>gi|218780677|ref|YP_002431995.1| adenylosuccinate synthetase [Desulfatibacillum alkenivorans AK-01]
 gi|226724584|sp|B8FB83|PURA_DESAA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|218762061|gb|ACL04527.1| Adenylosuccinate synthase [Desulfatibacillum alkenivorans AK-01]
          Length = 430

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 273/431 (63%), Gaps = 4/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M N+VVVG QWGDEGKGKIVD L+E AD++ RFQGGNNAGHT+ V+       L+PSG++
Sbjct: 1   MANIVVVGTQWGDEGKGKIVDMLAEKADMVTRFQGGNNAGHTVVVDGTQTITHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K  +IG+ VVVDP   + E++ L   G+ +  +NL I+  A +I+  H+ +D  RE 
Sbjct: 61  -QNKTCLIGNGVVVDPKVLLEEVDKLLGMGVEINADNLLISERAQIIMPYHQAMDHARE- 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT RGIGP YED+  R+ +R +DL D       + +     N L   F +
Sbjct: 119 -AKKGAQKIGTTGRGIGPCYEDKAARKGVRFVDLLDPAVFDSMVREACEEKNFLLTEFFK 177

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              V    I+ E     +++ P +  +  +L +  + G  +LFEGAQG  LD DHGTYPF
Sbjct: 178 ADPVDPDAIIAEYTEYAKRLAPHVVDVSVVLNQGVKDGKQVLFEGAQGTHLDIDHGTYPF 237

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT++     GSG+ PG +  VLG+VKAYTTRVG GPFPTEL+++ G+ ++E G EF
Sbjct: 238 VTSSNTVAGNVCAGSGVGPGQVNEVLGIVKAYTTRVGMGPFPTELEDEVGNRIQEKGAEF 297

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R+RRCGWLD+  +  +  +NG+ G+A+TKLDVL GLD L IC  Y  +G  ++F 
Sbjct: 298 GATTGRRRRCGWLDMVLLEATARLNGLTGVAITKLDVLGGLDSLNICTAYECEGETLNFF 357

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D     + +PVY  + GW +  +G+R F DLP  ARNY+ ++EE+L  P+ ++S+GP 
Sbjct: 358 PADLKVLAKCKPVYETMPGWTEDISGVRNFDDLPENARNYLNRVEELLGAPIKIISVGPG 417

Query: 420 RENTLIMSNPF 430
           R+ T+++ +PF
Sbjct: 418 RDETMVVKDPF 428


>gi|222053947|ref|YP_002536309.1| Adenylosuccinate synthase [Geobacter sp. FRC-32]
 gi|254788707|sp|B9M1R2|PURA_GEOSF RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|221563236|gb|ACM19208.1| Adenylosuccinate synthase [Geobacter sp. FRC-32]
          Length = 431

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 195/432 (45%), Positives = 276/432 (63%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VD  +E AD +VR+QGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MANVVVVGAQWGDEGKGKVVDIYTEFADDVVRYQGGNNAGHTLVVGDEKIVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  IIG+ VV+DP  FI EI +L  +G       L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HKGKRCIIGNGVVLDPEVFIREITNLKAKGKFQDDGVLLLSESLHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-G 179
                   IGTT RGIGPAYED++GRR IR+MDL D +  ++K+++ L   N L     G
Sbjct: 120 -AKSGAKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDKQVFTRKLKESLEEKNFLLEKMLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           EK   ++ I +E     + +  ++     +L ++ + G  +LFEGAQG LLD DHGTYP+
Sbjct: 179 EKPFSFEEIFDEYSAFADTLRTYVADTTLVLHQDLKAGKKLLFEGAQGTLLDVDHGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T +  A  G+G SP  +  ++G+ KAY TRVG GPFPTEL++  G+ L++ G EF
Sbjct: 239 VTSSSTCAGGACTGTGASPRDINEIIGISKAYVTRVGSGPFPTELEDADGEKLRQTGGEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   ++ +V +NG+ GIALTKLDVL   + +KIC GY  +G+ +  L
Sbjct: 299 GATTGRPRRCGWFDALVIKYAVRVNGLTGIALTKLDVLSDFETIKICTGYSYNGKFLSEL 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + +PVY  + GW+      R F DLP +AR Y++++EE+   P+ L+S+GP 
Sbjct: 359 PANLDIFEKCQPVYEEMPGWQTDITAARSFDDLPEKARTYVKRLEELAGCPIVLVSVGPR 418

Query: 420 RENTLIMSNPFE 431
           R+ T+++ NPFE
Sbjct: 419 RDQTIMLKNPFE 430


>gi|56696204|ref|YP_166561.1| adenylosuccinate synthetase [Ruegeria pomeroyi DSS-3]
 gi|81820093|sp|Q5LTU4|PURA_SILPO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|56677941|gb|AAV94607.1| adenylosuccinate synthetase [Ruegeria pomeroyi DSS-3]
          Length = 430

 Score =  511 bits (1317), Expect = e-143,   Method: Composition-based stats.
 Identities = 237/432 (54%), Positives = 301/432 (69%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ +TP  L IA N  LIL  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIATIRDQGVEITPETLMIAENTPLILPFHGELDRAREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR IRV DL D   +  ++++ L+HHNALR   G 
Sbjct: 121 --QNSVAKIGTTGRGIGPAYEDKVGRRVIRVADLADAATLELRVDRALVHHNALRSGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    +L  L     +ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 DPIDRDALLVSLREIAPQILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G GI PG++ YVLG+VKAYTTRVG GPFPTEL +  G+ L   G EFG
Sbjct: 239 TSSNVIAGQAATGVGIGPGAIDYVLGIVKAYTTRVGEGPFPTELDDADGERLGTRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A +R++   +G+ GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 299 TTTGRKRRCGWFDAALLRQTCATSGINGIALTKLDVLDGFETLKICVGYDLDGTRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE+++ PVA++S  PER
Sbjct: 359 TAADQQARCTPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIDCPVAMVSTSPER 418

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 419 EDTILVTDPFAD 430


>gi|218509559|ref|ZP_03507437.1| adenylosuccinate synthetase [Rhizobium etli Brasil 5]
          Length = 432

 Score =  511 bits (1317), Expect = e-143,   Method: Composition-based stats.
 Identities = 280/432 (64%), Positives = 352/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EIE LA QG+ +TP+NLR+A+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIEKLAGQGVTITPDNLRVADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLPGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    E++LPF D +W  L++E R+GA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSVAERVLPFRDTVWLFLDKERRRGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTELK++ G+FL + G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELKDEIGEFLGQKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKIC+GY +DG ++D LP
Sbjct: 301 VVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICIGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|327190966|gb|EGE58020.1| adenylosuccinate synthetase [Rhizobium etli CNPAF512]
          Length = 432

 Score =  511 bits (1317), Expect = e-143,   Method: Composition-based stats.
 Identities = 279/432 (64%), Positives = 352/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EIE LA QG+ +TP+NLR+A+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIEKLAGQGVTITPDNLRVADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLPGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    E++LPF D +W  L++E R+GA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSVAERVLPFRDTVWLFLDKERRRGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG+LGY+LG+ KAYTTRVG GPFPTELK++ G+FL + G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGALGYILGITKAYTTRVGEGPFPTELKDEIGEFLGQKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKIC+GY +DG ++D LP
Sbjct: 301 VVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICIGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|190893170|ref|YP_001979712.1| adenylosuccinate synthetase [Rhizobium etli CIAT 652]
 gi|229576753|sp|B3PY13|PURA_RHIE6 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|190698449|gb|ACE92534.1| adenylosuccinate synthetase protein [Rhizobium etli CIAT 652]
          Length = 432

 Score =  511 bits (1317), Expect = e-143,   Method: Composition-based stats.
 Identities = 281/432 (65%), Positives = 352/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EIE LA QG+ +TP+NLR+A+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIEKLAGQGVTITPDNLRVADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLPGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    E++LPF D +W  L++E R+GA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSVAERVLPFRDTVWLFLDKERRRGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTELK++ G+FL + G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELKDEIGEFLGQKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 VVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|86358942|ref|YP_470834.1| adenylosuccinate synthetase [Rhizobium etli CFN 42]
 gi|123510977|sp|Q2K4X9|PURA_RHIEC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|86283044|gb|ABC92107.1| adenylosuccinate synthetase protein [Rhizobium etli CFN 42]
          Length = 432

 Score =  511 bits (1316), Expect = e-142,   Method: Composition-based stats.
 Identities = 284/432 (65%), Positives = 351/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EIE L+ QG+ +TP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIEKLSAQGVTITPDNLRIADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLPGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    E++LPF D +W  L++E RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSVAERVLPFRDTVWLFLDKERRKGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELTDEIGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYVTLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|209550665|ref|YP_002282582.1| adenylosuccinate synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226709084|sp|B5ZMS8|PURA_RHILW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|209536421|gb|ACI56356.1| Adenylosuccinate synthase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 432

 Score =  511 bits (1315), Expect = e-142,   Method: Composition-based stats.
 Identities = 281/432 (65%), Positives = 350/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EI  L  QG+ VTP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIGRLEAQGVTVTPDNLRIADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ ++ K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLAGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    +++LPF D +W  L++E RKG+ ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSIADRVLPFRDTVWLFLDKERRKGSRILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTELK+  G+FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELKDAIGEFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR+S+  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 VVTGRKRRCGWFDAALVRQSIATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPVYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|300023912|ref|YP_003756523.1| adenylosuccinate synthetase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525733|gb|ADJ24202.1| adenylosuccinate synthetase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 429

 Score =  510 bits (1314), Expect = e-142,   Method: Composition-based stats.
 Identities = 259/431 (60%), Positives = 321/431 (74%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++   +KLSLLPSGVV
Sbjct: 1   MTNVVVVGAQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIDGTTFKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R DK+S+IG+ VVVDP A ++EI+ L  QG+ +T +NLR+A NA+LIL +HR+LD LRE 
Sbjct: 61  RSDKLSVIGNGVVVDPWALVAEIDKLKKQGLSITRDNLRVAENATLILPLHRELDQLREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+VGRRAIRV DL   E +  KI+++L HHNALRR  G+
Sbjct: 121 AA--GTEKIGTTGRGIGPAYEDKVGRRAIRVQDLASPETLGPKIDRVLAHHNALRRGLGQ 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    ++ +L     ++LP+MDV W LL+   R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEVAKDKLIADLNGIAPQVLPYMDVSWELLDIARRQGKRILFEGAQGALLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ GSGI P   GYVLG+ KAYTTRVG GPFPTEL +  G+ + E G EFG
Sbjct: 239 TSSNTVAAQAATGSGIGPRYAGYVLGIAKAYTTRVGSGPFPTELTDAVGEKIGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+   ++G+ GIALTKLDVLDG D ++ICVGY +DG  ++ LP
Sbjct: 299 TVTGRKRRCGWFDSVLVRQVAKVSGIDGIALTKLDVLDGFDTIRICVGYTLDGERLNRLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  PVY   EGW +ST G R +ADLP QA  Y+R++EE++E PV LLS  PER
Sbjct: 359 ASASAQARIIPVYEDFEGWSESTQGARRWADLPAQAVKYVRRVEELIECPVTLLSTSPER 418

Query: 421 ENTLIMSNPFE 431
            +T++M +PFE
Sbjct: 419 ADTILMKDPFE 429


>gi|170752006|ref|YP_001758266.1| adenylosuccinate synthase [Methylobacterium radiotolerans JCM 2831]
 gi|229576727|sp|B1M1K0|PURA_METRJ RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|170658528|gb|ACB27583.1| Adenylosuccinate synthase [Methylobacterium radiotolerans JCM 2831]
          Length = 430

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 263/432 (60%), Positives = 330/432 (76%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++ + YKL+LLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVIDGVTYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDP   I EIE +  QG+ V+P++LRIA+NA+LIL +HR+LD  RE 
Sbjct: 61  RGGKLSVIGNGVVVDPWHLIDEIERIKAQGVDVSPSSLRIADNATLILPLHRELDHFRET 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT+RGIGPAYED+VGRRAIRV+DL D + +  KIE++L HHNALRR  G 
Sbjct: 121 A--NAGLKIGTTKRGIGPAYEDKVGRRAIRVVDLADPDALPAKIERVLTHHNALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV  + +L EL     KILPF D +WSLL+ E R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 179 DEVNAEALLSELKAIAPKILPFADTVWSLLDEERRAGKRILFEGAQGALLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++AQA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTEL ++ G+ +   G+EFG
Sbjct: 239 TSSNIVAAQAATGSGLGPGAIGYVLGIAKAYTTRVGEGPFPTELFDEIGETIGSRGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V  +G+ GIALTKLD+LDG +E+++C GY +DG+ VD LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTSGIHGIALTKLDILDGFEEIRVCTGYMLDGQPVDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY ++ GW ++TAG R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 ASQAAQARIEPVYEVIPGWSETTAGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M NPFED
Sbjct: 419 DDTILMHNPFED 430


>gi|15600131|ref|NP_253625.1| adenylosuccinate synthetase [Pseudomonas aeruginosa PAO1]
 gi|107104037|ref|ZP_01367955.1| hypothetical protein PaerPA_01005110 [Pseudomonas aeruginosa PACS2]
 gi|116053087|ref|YP_793406.1| adenylosuccinate synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894033|ref|YP_002442902.1| adenylosuccinate synthetase [Pseudomonas aeruginosa LESB58]
 gi|254238347|ref|ZP_04931670.1| adenylosuccinate synthetase [Pseudomonas aeruginosa C3719]
 gi|254244171|ref|ZP_04937493.1| adenylosuccinate synthetase [Pseudomonas aeruginosa 2192]
 gi|296391778|ref|ZP_06881253.1| adenylosuccinate synthetase [Pseudomonas aeruginosa PAb1]
 gi|313109940|ref|ZP_07795868.1| adenylosuccinate synthetase [Pseudomonas aeruginosa 39016]
 gi|21263917|sp|Q9HUM6|PURA_PSEAE RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122256900|sp|Q02F80|PURA_PSEAB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724592|sp|B7V201|PURA_PSEA8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|9951218|gb|AAG08323.1|AE004907_1 adenylosuccinate synthetase [Pseudomonas aeruginosa PAO1]
 gi|115588308|gb|ABJ14323.1| adenylosuccinate synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170278|gb|EAZ55789.1| adenylosuccinate synthetase [Pseudomonas aeruginosa C3719]
 gi|126197549|gb|EAZ61612.1| adenylosuccinate synthetase [Pseudomonas aeruginosa 2192]
 gi|218774261|emb|CAW30078.1| adenylosuccinate synthetase [Pseudomonas aeruginosa LESB58]
 gi|310882370|gb|EFQ40964.1| adenylosuccinate synthetase [Pseudomonas aeruginosa 39016]
          Length = 430

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 278/430 (64%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VV+ P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVLAPDALLREITKLEEKGVPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN + + + ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFVLQHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + + L    + G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDEAMEYAELLKPMMADVAATLHDLRKHGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG+ KAYTTRVG GPFPTEL +  G +L + G EFG
Sbjct: 240 TSSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFDDVGAYLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGLD +++CVGY+    +V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLDVVRLCVGYKNADGDVLEAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   +PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYIGLQPVYEEMPGWSESTVGAKTLEELPANARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+I+ +PF
Sbjct: 420 NETIILRHPF 429


>gi|83954109|ref|ZP_00962829.1| adenylosuccinate synthetase [Sulfitobacter sp. NAS-14.1]
 gi|83841146|gb|EAP80316.1| adenylosuccinate synthetase [Sulfitobacter sp. NAS-14.1]
          Length = 431

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 237/432 (54%), Positives = 304/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LI+  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETIRAQGVEITPETLMIAENTPLIMPYHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGP YED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPCYEDKVGRRAIRVADLADTATLEARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++E L     KIL +   +W ++  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDGLVELLKEIAPKILEYAAPVWKVMNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G GI PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGIGPGAINYVLGIVKAYTTRVGEGPFPTELHDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKIC GY +DG ++D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICTGYELDGEQLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIQCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 420 DDTILVTDPFAD 431


>gi|152986609|ref|YP_001350986.1| adenylosuccinate synthetase [Pseudomonas aeruginosa PA7]
 gi|166232486|sp|A6VD51|PURA_PSEA7 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|150961767|gb|ABR83792.1| adenylosuccinate synthetase [Pseudomonas aeruginosa PA7]
          Length = 430

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 205/430 (47%), Positives = 278/430 (64%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VV+ P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVLAPDALLREITKLEEKGVPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN + + + ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFVLQHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + + L    + G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDEAMEYAELLKPMMADVAATLHDLRKHGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG+ KAYTTRVG GPFPTEL +  G +L + G EFG
Sbjct: 240 TSSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFDDVGAYLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGLD +++CVGYR    +V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLDVVRLCVGYRNADGDVLEAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   +PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYIGLQPVYEEMPGWSESTVGAKTLEELPANARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+I+ +PF
Sbjct: 420 NETIILRHPF 429


>gi|116253509|ref|YP_769347.1| adenylosuccinate synthetase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|166232491|sp|Q1MCS2|PURA_RHIL3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|115258157|emb|CAK09258.1| putative adenylosuccinate synthetase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 432

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 280/432 (64%), Positives = 349/432 (80%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EI  L  QG+ VTP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIGRLEAQGVTVTPDNLRIADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +S K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDSLSGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++ I++EL    +++LPF D +W  L++E RKG+ ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQAIMDELTSVADRVLPFRDTVWLFLDKERRKGSRILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTELK+  G+FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELKDAIGEFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR+S+  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 VVTGRKRRCGWFDAALVRQSIATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYITLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|83942934|ref|ZP_00955394.1| adenylosuccinate synthetase [Sulfitobacter sp. EE-36]
 gi|83845942|gb|EAP83819.1| adenylosuccinate synthetase [Sulfitobacter sp. EE-36]
          Length = 431

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 304/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LI+  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETIRAQGVEITPETLMIAENTPLIMPYHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGP YED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPCYEDKVGRRAIRVADLADTATLEARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++E L     KIL +   +W ++  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDGLVELLKEIAPKILEYAAPVWKVMNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G GI PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGIGPGAINYVLGIVKAYTTRVGEGPFPTELHDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKIC GY +DG ++D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICTGYELDGEQLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIQCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|15889718|ref|NP_355399.1| adenylosuccinate synthetase [Agrobacterium tumefaciens str. C58]
 gi|24212126|sp|Q8UCN6|PURA_AGRT5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|15157630|gb|AAK88184.1| adenylosuccinate synthetase [Agrobacterium tumefaciens str. C58]
          Length = 432

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 288/432 (66%), Positives = 353/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE ADV+VR+QGG+NAGHTL ++ I YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADVVVRYQGGHNAGHTLVIDGISYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VVVDPHA I+EI  L  QG+ VTP NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKLAVIGNGVVVDPHALIAEIGRLEVQGVKVTPENLRIADNATLILSLHRELDGMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D+E +S K++++L HHNALRR FG 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADMEALSAKVDRILTHHNALRRGFGA 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI+EEL    E+ILPF + +W LL+++ R GA ILFEGAQG LLD DHGTYP+V
Sbjct: 181 TEVSHETIMEELGSIAERILPFSETVWLLLDKKRRAGARILFEGAQGSLLDIDHGTYPYV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELHDEIGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY++DG+E+D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLDELKICVGYKLDGQEIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYVTLEGWKESTVGARKWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|84688022|ref|ZP_01015884.1| adenylosuccinate synthetase [Maritimibacter alkaliphilus HTCC2654]
 gi|84663962|gb|EAQ10464.1| adenylosuccinate synthetase [Rhodobacterales bacterium HTCC2654]
          Length = 431

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 241/432 (55%), Positives = 304/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVICRFQGGHNAGHTLVIDGTVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LIL  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLGEIETIRKQGVEITPETLMIAENTPLILPFHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT RGIGPAYED+VGRR IRV DL D   +  ++++ L HHN LR+  G 
Sbjct: 121 AA-STGTKIGTTGRGIGPAYEDKVGRRVIRVADLADDATLEARVDRALQHHNPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    ++ +L     KIL +    W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 DEIDRDALIAQLKEIAPKILEYAAPAWKVLNEKRKAGNRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFP+EL +  GD L   G EFG
Sbjct: 240 TSSNVIAGQAATGVGMGPGAIDYVLGIVKAYTTRVGEGPFPSELFDADGDRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++  I+G+ GI LTKLDVLDG + LKICV Y +DG+ +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCAISGINGICLTKLDVLDGFETLKICVAYDLDGKRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R +P+Y  LEGW +ST G R +ADLP  A  Y+R++EE++E PVALLS  PER
Sbjct: 360 TAADEQARCKPIYEELEGWSESTEGARSWADLPAAAIKYVRRVEELIECPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|163758776|ref|ZP_02165863.1| adenylosuccinate synthetase protein [Hoeflea phototrophica DFL-43]
 gi|162284066|gb|EDQ34350.1| adenylosuccinate synthetase protein [Hoeflea phototrophica DFL-43]
          Length = 432

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 281/432 (65%), Positives = 345/432 (79%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VV+DPHA +SEI+ LA Q + V  +NLRIA+NA+LILS+HR+LD LRE 
Sbjct: 61  RPGKMAVIGNGVVIDPHALVSEIDRLAKQDVVVNGDNLRIADNATLILSLHRELDALRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL ++E +  K+++LL HHNALRR  G+
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLANLETLPAKVDRLLTHHNALRRGLGQ 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+  KTIL+EL+   E+ILPF + +W LL++E R+GA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 PEIAVKTILDELIAVAERILPFRETVWLLLDKERRRGARILFEGAQGSLLDVDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSL YVLG+ KAYTTRVG GPFPTEL ++TG FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGLGPGSLDYVLGITKAYTTRVGEGPFPTELNDETGQFLGERGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV +NG  GIALTKLDVLDGL +LKICVGY +DG  +D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVAVNGTTGIALTKLDVLDGLKQLKICVGYELDGVRIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  +EGW+ +T G R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 361 ASQGAQARVTPIYETIEGWEDTTVGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|325293798|ref|YP_004279662.1| adenylosuccinate synthetase [Agrobacterium sp. H13-3]
 gi|325061651|gb|ADY65342.1| adenylosuccinate synthetase [Agrobacterium sp. H13-3]
          Length = 432

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 288/432 (66%), Positives = 353/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE ADV+VR+QGG+NAGHTL ++ I YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADVVVRYQGGHNAGHTLVIDGISYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VVVDPHA I+EI  L  QG+ VTP NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKLAVIGNGVVVDPHALIAEIGRLEVQGVKVTPENLRIADNATLILSLHRELDGMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D+E +S K++++L HHNALRR FG 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADMEALSAKVDRILTHHNALRRGFGA 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI+EEL    E+ILPF + +W LL+++ R GA ILFEGAQG LLD DHGTYP+V
Sbjct: 181 AEVSHETIMEELSSVAERILPFSETVWLLLDKKRRAGARILFEGAQGSLLDIDHGTYPYV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELHDEIGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY++DG+E+D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLDELKICVGYKLDGQEIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYVTLEGWKESTVGARKWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|254452217|ref|ZP_05065654.1| adenylosuccinate synthetase [Octadecabacter antarcticus 238]
 gi|198266623|gb|EDY90893.1| adenylosuccinate synthetase [Octadecabacter antarcticus 238]
          Length = 431

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 303/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ ++P  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIATVRAQGVEISPETLMIAENTPLILPMHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGP YED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 ASSK-GTKIGTTGRGIGPCYEDKVGRRAIRVADLADPATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           K V    ++ EL      ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 KAVDRDQLIAELQAISADILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ +VLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGAIDFVLGIVKAYTTRVGEGPFPTELHDADGQMLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   +R++   +GV GIALTKLDVLDG + LKICV Y +DG  +D+LP
Sbjct: 300 TTTGRKRRCGWFDACLLRQTCATSGVTGIALTKLDVLDGFETLKICVAYDLDGVRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  ++GW  ST G R +ADLP +A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEMKGWSDSTEGARSWADLPAEAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|288961938|ref|YP_003452248.1| adenylosuccinate synthase [Azospirillum sp. B510]
 gi|288914218|dbj|BAI75704.1| adenylosuccinate synthase [Azospirillum sp. B510]
          Length = 430

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 249/432 (57%), Positives = 318/432 (73%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL +N + YKLSLLPSGVV
Sbjct: 1   MANVAVVGAQWGDEGKGKIVDWLSSRADVVVRFQGGHNAGHTLVINGVEYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R +K+S+IG+ VV DP AFI E+ ++  +G+ VTP NL +A N  LIL +H  LD  RE 
Sbjct: 61  RQNKLSVIGNGVVFDPWAFIREVNAIKEKGVSVTPENLIVAENVPLILPVHSALDKAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+V RRAIR+ DLTD   + +K++ LL HHNAL R+ G 
Sbjct: 121 A--KGAGKIGTTGRGIGPAYEDKVARRAIRLCDLTDDAVLVEKVDALLAHHNALFRALGA 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    ILE L     ++LP+  V+W  L+   R G  ILFEGAQG +LD DHGTYP+V
Sbjct: 179 PEMTPADILEPLREIAPQVLPYAAVVWKRLDELRRAGKRILFEGAQGTMLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTELK++ G+ + + GKEFG
Sbjct: 239 TSSNTVAGNAAAGSGMGPRAVGYVLGICKAYTTRVGSGPFPTELKDEIGELIGQKGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR+++   G+ GIALTKLDVLDG DE+K+CVGYR+DG+E+D+ P
Sbjct: 299 VVTGRKRRCGWFDAVMVRQAIKTGGIDGIALTKLDVLDGFDEVKVCVGYRLDGQEIDYYP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            ++    R EP+Y   EGWK +T G R +A+LP QA  Y+R IEE+++ PVALLS  PER
Sbjct: 359 SNAGAQARVEPIYETFEGWKDTTRGARSWAELPAQAVKYVRHIEELIQAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M++PF D
Sbjct: 419 DDTILMTDPFAD 430


>gi|163794489|ref|ZP_02188460.1| Adenylosuccinate synthase [alpha proteobacterium BAL199]
 gi|159180213|gb|EDP64736.1| Adenylosuccinate synthase [alpha proteobacterium BAL199]
          Length = 432

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 253/432 (58%), Positives = 312/432 (72%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL + + VYKLSLLPSGVV
Sbjct: 1   MSNVAVIGAQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIGNQVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IGS VVVDP AF+ E+E +  QG+ + P NL IA+ A+LIL +HR LD  RE 
Sbjct: 61  RPGKLSVIGSGVVVDPWAFLDELERVRGQGLDLKPGNLLIADTAALILPVHRRLDQAREA 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+VGRRA+RV DL + E +  K+E L  HHNA  R FGE
Sbjct: 121 AR--GDGKIGTTGRGIGPAYEDKVGRRAVRVADLGEPETMKAKVEYLAEHHNAYLRGFGE 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    +L  L     KILP+   +W  LE        ILFEGAQ  +LD D+GTYP+V
Sbjct: 179 AEIDPVELLAALTEIAPKILPYAGRVWERLEAARVANKRILFEGAQAVMLDVDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G  L E GKEFG
Sbjct: 239 TSSNTVAGQAATGSGMGPTNIGYVLGITKAYTTRVGSGPFPTELTDEVGRTLGERGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+++   G+ GIALTK DVLDG + LK+C GYR+DG+E+D+LP
Sbjct: 299 TVTGRRRRCGWFDAVMVRQAIKTGGINGIALTKPDVLDGFETLKVCTGYRLDGQELDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  +EGWK ST G R +A LP  A  YIR+IEE++E PVALLS  PER
Sbjct: 359 AGQAAQARVEPVYETMEGWKDSTRGARSWAQLPANAIKYIRRIEELIEAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ +PF D
Sbjct: 419 DDTILVRDPFAD 430


>gi|146276924|ref|YP_001167083.1| adenylosuccinate synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|166232493|sp|A4WQW4|PURA_RHOS5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|145555165|gb|ABP69778.1| Adenylosuccinate synthetase [Rhodobacter sphaeroides ATCC 17025]
          Length = 430

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 248/432 (57%), Positives = 319/432 (73%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP   + EI  L  +G+ +TP+NL IA NA LIL +H +LD  RE 
Sbjct: 61  RPGKLSVIGNGVVLDPWHLVGEIAKLRGEGVEITPDNLMIAENAVLILPLHGELDRARES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRRAIRV DL D   ++ ++++L++HH+ALRR  G 
Sbjct: 121 --HNAVAKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLALRVDRLMVHHDALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +  + +L +L     ++LP+   +W ++    + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 EPIDREALLAQLREIAPQVLPYAKPVWKVMNEMRKAGKRILFEGAQGALLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++G+VLG+VKAYTTRVG GPFP ELK+  G+ L E G+EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAIGFVLGIVKAYTTRVGEGPFPAELKDADGERLGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG  +D LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVSGIALTKLDVLDGFETLKICVGYDLDGERLDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  LEGW +STAG R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 359 IAADQQARCTPIYEELEGWSESTAGARSWADLPGAAVKYVRRIEELIQCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 419 DDTILVTDPFED 430


>gi|148262741|ref|YP_001229447.1| adenylosuccinate synthetase [Geobacter uraniireducens Rf4]
 gi|189038305|sp|A5GC19|PURA_GEOUR RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|146396241|gb|ABQ24874.1| Adenylosuccinate synthetase [Geobacter uraniireducens Rf4]
          Length = 431

 Score =  508 bits (1307), Expect = e-142,   Method: Composition-based stats.
 Identities = 193/432 (44%), Positives = 279/432 (64%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VD  +E AD +VR+QGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MANVVVVGAQWGDEGKGKVVDIYTEFADDVVRYQGGNNAGHTLVVGDEKIVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  IIG+ VV+DP  FI EI +L  +G       L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HQGKRCIIGNGVVLDPEVFIREITNLKAKGKFQDDGVLLLSESLHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
             +     IGTT RGIGPAYED++GRR IR+MDL D +  S+K+++ L   N +  +  G
Sbjct: 120 -ANSGAKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDKQVFSRKLKEFLEEKNFILEKLLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           E+   ++ I +E     + +  ++     +L ++ + G  +LFEGAQG LLD DHGTYP+
Sbjct: 179 ERPFTFEEIFDEYSAYADTLRNYVADTTLVLHQDLKAGKKLLFEGAQGTLLDVDHGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T +  A  G+G SP  +  ++G+ KAY TRVG GPFPTEL++  G+ L+  G EF
Sbjct: 239 VTSSSTCAGGACTGTGASPRDINEIIGISKAYVTRVGSGPFPTELEDADGEKLRHTGGEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   ++ +V +NG+ GIALTKLDVL   + +KIC GY  + + ++ L
Sbjct: 299 GATTGRPRRCGWFDALVIKYAVRVNGLTGIALTKLDVLSDFESIKICTGYSYNDKFLNEL 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     +  PVY  + GW+    G+R F +LP +A+NY++++EE+   P+ L+S+GP 
Sbjct: 359 PANLDVFEKCRPVYEEMPGWQSDITGVRSFEELPEKAKNYVKRLEELAGCPIVLVSVGPR 418

Query: 420 RENTLIMSNPFE 431
           R+ T+++ NPFE
Sbjct: 419 RDETIMLKNPFE 430


>gi|241206036|ref|YP_002977132.1| adenylosuccinate synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859926|gb|ACS57593.1| adenylosuccinate synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 432

 Score =  508 bits (1307), Expect = e-141,   Method: Composition-based stats.
 Identities = 284/432 (65%), Positives = 350/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VR+QGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGTSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP KM++IG+ VVVDPHA I+EI  L  QG+ VTP+NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RPGKMAVIGNGVVVDPHALIAEIGRLEAQGVTVTPDNLRIADNATLILSLHRELDAMRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D+E +S K++++L HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADIESLSGKVDRILTHHNALRRGLGV 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++TI++EL    +++LPF D +W  L++E RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVSHQTIMDELTSIADRVLPFRDTVWLFLDKERRKGARILFEGAQGSLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELTDEIGQFLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGL+ELKICVGY +DG ++D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVATNGITGIALTKLDVLDGLEELKICVGYMLDGEQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPIYVTLEGWKESTVGARSWADLPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|84502704|ref|ZP_01000823.1| adenylosuccinate synthetase [Oceanicola batsensis HTCC2597]
 gi|84389099|gb|EAQ01897.1| adenylosuccinate synthetase [Oceanicola batsensis HTCC2597]
          Length = 430

 Score =  507 bits (1306), Expect = e-141,   Method: Composition-based stats.
 Identities = 237/432 (54%), Positives = 308/432 (71%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL +   VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIEGEVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVEEIATIRAQGVEITPETLMIAENTPLILPIHGELDRGRE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR +RV DL D   ++ ++++LL+HHNALR   G 
Sbjct: 120 -AQNSVAKIGTTGRGIGPAYEDKVGRRVVRVADLADDATLATRVDRLLVHHNALRHGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L     +ILP+   +W ++  + + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 EPVDRDGLIAKLKEIAPEILPYAAPVWKVMNEKRKAGKRILFEGAQGSLLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++ +VLG+VKAYTTRVG GPFPTEL +  G+ L + G EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAVDFVLGIVKAYTTRVGEGPFPTELDDADGERLGQRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A +R++   +G+ GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 299 TTTGRKRRCGWFDAALLRQTCTTSGMNGIALTKLDVLDGFETLKICVGYDLDGTRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  L GW +ST G R +ADLP  A  Y+R++EE++E PVALLS  PER
Sbjct: 359 TAADQQARCTPIYEELPGWSESTEGARSWADLPANAIKYVRRVEELIECPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 419 DDTILVTDPFAD 430


>gi|27382163|ref|NP_773692.1| adenylosuccinate synthetase [Bradyrhizobium japonicum USDA 110]
 gi|46396893|sp|Q89EM1|PURA_BRAJA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|27355333|dbj|BAC52317.1| adenylosuccinate synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 430

 Score =  507 bits (1306), Expect = e-141,   Method: Composition-based stats.
 Identities = 252/431 (58%), Positives = 322/431 (74%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGKTYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DP AF+ E+  L  QG+ V+P NLR+A N +LIL +HR+LD  RE 
Sbjct: 61  REHKLSVIGNGVVFDPAAFLDEVTKLRAQGVAVSPENLRVAENVTLILPLHRELDAHRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIR+MDL D++ +  KI++LL HHNALRR    
Sbjct: 121 A--NAATAIGTTRRGIGPAYEDKVGRRAIRLMDLADLDTLPHKIDRLLAHHNALRRGLNL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E   K IL+EL     ++LP+ + +W LL+ + R+G  +LFEGAQG LLD DHGTYP+V
Sbjct: 179 PEFDGKDILKELTALAPQLLPYAETVWRLLDIKRREGKRMLFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTE  N+ G  + E G+EFG
Sbjct: 239 TSSNTVAAQAATGSGLGPGAVGYVLGLCKAYTTRVGQGPFPTEQDNEIGRKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++C GY++DG+E+D  P
Sbjct: 299 TNTGRPRRCGWFDAVLVRQAVRTCGINGLALTKLDILDGFDSIEVCTGYKLDGKEIDHFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTASARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|254477769|ref|ZP_05091155.1| adenylosuccinate synthetase [Ruegeria sp. R11]
 gi|214032012|gb|EEB72847.1| adenylosuccinate synthetase [Ruegeria sp. R11]
          Length = 437

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 239/438 (54%), Positives = 305/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EIE++  QG+ ++P  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLIKEIETVRAQGVDISPETLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLVARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L    ++ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDGLIAQLKEIAKEILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI PGS+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQAATGVGIGPGSIDYVLGIVKAYTTRVGEGPFPTELLKEDGTPDADGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGITGISLTKLDVLDGFETLKICVGYELDGE 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R  P+Y  + GW +ST G R + DLP  A  Y++++EE++E PVALL
Sbjct: 360 RLDYLPTAADQQARCTPIYEEMPGWSESTEGARSWNDLPANAIKYVKRVEELIECPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|110635488|ref|YP_675696.1| adenylosuccinate synthetase [Mesorhizobium sp. BNC1]
 gi|123353164|sp|Q11DJ4|PURA_MESSB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|110286472|gb|ABG64531.1| Adenylosuccinate synthetase [Chelativorans sp. BNC1]
          Length = 432

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 269/432 (62%), Positives = 338/432 (78%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VR+QGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRYQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DPHAF++EIE L  QGI VTP +L++A N +LILS+HR+LD  RE 
Sbjct: 61  RSGKLSLIGNGVVFDPHAFVAEIERLKGQGISVTPESLKVAENTALILSLHRELDAFRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D E +S K+++LL HHNALRR  G 
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADPETLSLKVDRLLTHHNALRRGLGH 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV ++ I++EL    +KILPF+D +W +LE   R G+ ILFEGAQG +LD DHGTYPFV
Sbjct: 181 AEVSHEAIMQELTSVADKILPFVDRVWKILEDARRAGSRILFEGAQGTMLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTE  N+ G+FL   G EFG
Sbjct: 241 TSSNTVAGQAATGSGLGPGAVGYVLGITKAYTTRVGEGPFPTEQDNEIGEFLGNRGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+SV+ NG+ GIALTKLDVLDG++E+K+C GYR+DG+ +D+LP
Sbjct: 301 TVTGRKRRCGWFDAVQVRQSVVTNGMSGIALTKLDVLDGMEEIKVCTGYRLDGQVIDYLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  LEGWK++T G R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 361 ASQGAQARLDPIYETLEGWKETTRGARKWNDLPAQAVKYVRHIEELIGAPVAILSTSPER 420

Query: 421 ENTLIMSNPFED 432
           E+ +++ +PF+D
Sbjct: 421 EDAILVKDPFQD 432


>gi|307545949|ref|YP_003898428.1| adenylosuccinate synthetase [Halomonas elongata DSM 2581]
 gi|307217973|emb|CBV43243.1| adenylosuccinate synthetase [Halomonas elongata DSM 2581]
          Length = 431

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 281/432 (65%), Gaps = 4/432 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E+AD +VRFQGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTESADAVVRFQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            DK  +IG+ VV+ P A I EI  L  +G+ V    LR++    LIL  H  LD  RE A
Sbjct: 63  DDKTCVIGNGVVLSPEALIEEIRELEAKGVPVR-ERLRLSPACPLILPYHVRLDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                A IGTT RGIGPAYED+V RR +R+ D+   E  + K+ ++L +HN  L +  GE
Sbjct: 122 R--GVAKIGTTGRGIGPAYEDKVARRGLRLGDMLHRERFASKLGEVLDYHNFVLTKYHGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V ++ +L++ M   +++   +    +L+    + G +ILFEGAQG LLD DHGTYPFV
Sbjct: 180 PAVDFQQVLDDAMRMADELRDMVCDTVTLVHNVRKAGENILFEGAQGSLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L YVLG+ KAYTTRVG GPFPTEL ++ G  L E G EFG
Sbjct: 240 TSSNTTAGGTATGSGVGPLYLDYVLGITKAYTTRVGSGPFPTELFDEHGRHLAEKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D  ++R +V IN V G+ LTKLDVLDGL+ +++CVGYR    +V   P
Sbjct: 300 ATTGRARRCGWFDAVALRHAVQINSVSGLCLTKLDVLDGLENIRVCVGYRSKDGDVLDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            DS  +   EPVY  L GW +ST G++   +LP  AR YI  +EE +  P+ ++S GP+R
Sbjct: 360 VDSEGYEAIEPVYEDLPGWNESTIGVKSVDELPANARAYIHFLEEQVGTPIDIISTGPDR 419

Query: 421 ENTLIMSNPFED 432
             T+++ NPF +
Sbjct: 420 NETIVLRNPFAE 431


>gi|254463562|ref|ZP_05076978.1| adenylosuccinate synthetase [Rhodobacterales bacterium HTCC2083]
 gi|206680151|gb|EDZ44638.1| adenylosuccinate synthetase [Rhodobacteraceae bacterium HTCC2083]
          Length = 431

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 306/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++ RFQGG+NAGHTL V+  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADIVARFQGGHNAGHTLVVDGEVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIETIRAQGVSITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 ASSK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADEATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++  L     K+L +   +W +L    +KG  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDGLIAMLKEIAPKVLEYAAPVWKVLNERKKKGQRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PGS+ YVLG+VKAYTTRVG GPFPTEL++  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGSIDYVLGIVKAYTTRVGEGPFPTELEDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKIC GY ++G  +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICTGYMLEGERIDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             + +  R  P+Y  + GW +ST G R +ADLP  A  Y+R+IEE+++ P AL+S  PER
Sbjct: 360 TAADHQARCMPIYEEMPGWSESTEGARSWADLPANAIKYVRRIEELIDCPAALVSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PFED
Sbjct: 420 EDTILVTDPFED 431


>gi|86136601|ref|ZP_01055180.1| adenylosuccinate synthetase [Roseobacter sp. MED193]
 gi|85827475|gb|EAQ47671.1| adenylosuccinate synthetase [Roseobacter sp. MED193]
          Length = 437

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 238/438 (54%), Positives = 304/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ ++P  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETVQAQGVEISPETLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADAATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++ +L     KILP+   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDALVAQLKEIAPKILPYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QAS G GI PGS+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQASTGVGIGPGSIDYVLGIVKAYTTRVGEGPFPTELLDAEGKPDADGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGITGISLTKLDVLDGFETLKICVGYDLDGT 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R  P+Y  + GW +ST G R + DLP  A  Y++++EE++E PVALL
Sbjct: 360 RLDYLPTAADQQARCTPIYEEMPGWSESTEGARSWNDLPANAIKYVKRVEELIECPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|316935811|ref|YP_004110793.1| adenylosuccinate synthetase [Rhodopseudomonas palustris DX-1]
 gi|315603525|gb|ADU46060.1| adenylosuccinate synthetase [Rhodopseudomonas palustris DX-1]
          Length = 430

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 256/431 (59%), Positives = 329/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++ RFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVARFQGGHNAGHTLVINGETYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+ +IG+ VV DP AF+ E++ L  QG+ ++P+NLRIA N +LIL +HR+LD LRE 
Sbjct: 61  RPSKLGVIGNGVVFDPQAFLDEVKKLQGQGVSISPDNLRIAENVTLILPLHRELDSLREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + + +KI++LL HHNALRR F  
Sbjct: 121 AAKAGA--IGTTQRGIGPAYEDKVGRRAIRLMDLADPDTLPQKIDRLLAHHNALRRGFNL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E     IL++LM    ++LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEFDGAAILKDLMAMAPQLLPYAETVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTEL N+ G+ +   GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPGAVGYVLGICKAYTTRVGAGPFPTELLNEIGEEIGRRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++CVGYR+DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFDSVEVCVGYRLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TAG R +A+LP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTAGARSWAELPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|258541415|ref|YP_003186848.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632493|dbj|BAH98468.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635550|dbj|BAI01519.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638605|dbj|BAI04567.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641659|dbj|BAI07614.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644714|dbj|BAI10662.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647769|dbj|BAI13710.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650822|dbj|BAI16756.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653813|dbj|BAI19740.1| adenylosuccinate synthetase [Acetobacter pasteurianus IFO 3283-12]
          Length = 429

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 307/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWL+  AD++VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 1   MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGNQVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ IIG+ VVVDP A ++EI  +  QG+ VTP+ L+IA NA LIL +H  LD  RE 
Sbjct: 61  N-NKLGIIGNGVVVDPQALLAEIGRIQEQGLEVTPDTLKIAENAPLILPVHGALDRAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+V RRAIR+ DL + E +  K+++LLLHHN L    G 
Sbjct: 120 AR--GDRKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDELLLHHNTLLAGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
                + +L+ L     K+LP+M   W +L+   R G  ILFEGAQ  +LD DHGTYPFV
Sbjct: 178 PVFTKEELLKFLTDIAPKVLPYMAPTWDILDDARRAGRRILFEGAQAVMLDVDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A  GSG+ P + G+VLG+ KAY TRVG GPFPTEL ++TG  L E G EFG
Sbjct: 238 TSSNTVAANAGTGSGMGPTAAGFVLGIAKAYCTRVGEGPFPTELHDETGRRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR +V + GV G+ALTKLDVLDGLDE++ICVGY +DG++++  P
Sbjct: 298 TNTGRPRRCGWFDSVLVRHAVRVGGVNGLALTKLDVLDGLDEIRICVGYELDGQKIERFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  LEGWK++T G R +ADLP QA  Y+R+IEE++  PV LLS  P+R
Sbjct: 358 SAPAAQQRVRPVYETLEGWKETTHGARRWADLPAQAIKYVRRIEELVGAPVTLLSTSPDR 417

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 418 DDTILMRDPFED 429


>gi|226942908|ref|YP_002797981.1| adenylosuccinate synthetase [Azotobacter vinelandii DJ]
 gi|259546998|sp|C1DLQ8|PURA_AZOVD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226717835|gb|ACO77006.1| Adenylosuccinate synthetase [Azotobacter vinelandii DJ]
          Length = 430

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 201/430 (46%), Positives = 279/430 (64%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTDQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VVV P A + EI  L  +G+ V    LRI+ + +LIL  H  LD  RE  
Sbjct: 63  DNVECLIGNGVVVAPDALLREIAKLEEKGVPVR-ERLRISPSCTLILPYHVALDQAREAV 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
            S     IGTT RGIGPAYED+V RR +R+ DL + E  +KK+ +LL +HN + ++F + 
Sbjct: 122 RSEG--KIGTTGRGIGPAYEDKVARRGLRIGDLFNPERFAKKLHELLEYHNFVLQNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V ++  L+E +   E + P +  + + L    ++GA I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVDFQKTLDEALGYAESLKPMIADVAARLHELRKQGARIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G  L   G EFG
Sbjct: 240 TSSSTTAGGTATGSGFGPLYLDYILGITKAYTTRVGSGPFPTELFDDIGAHLASKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           + T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL  +K+CV YR     V   P
Sbjct: 300 STTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLKTVKLCVAYRNAEGVVIEAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G++  A+LP  A  YI++IE ++  P+ ++S GP+R
Sbjct: 360 TDADSYVGLEPVYEEMPGWSESTVGIKSLAELPANALAYIKRIEALVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|149202638|ref|ZP_01879610.1| adenylosuccinate synthetase [Roseovarius sp. TM1035]
 gi|149143920|gb|EDM31954.1| adenylosuccinate synthetase [Roseovarius sp. TM1035]
          Length = 431

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 245/432 (56%), Positives = 309/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI S+  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIASIREQGVTITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LRR  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADEATLIARVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V  + ++ +L     +ILP+   +W +L  + R G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 APVDREALIAQLKDIAAQILPYAAPVWKVLNEQRRAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPGAIDYVLGIVKAYTTRVGEGPFPTELHDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++ + +GV GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TVTGRKRRCGWFDACLVRQTCVTSGVTGIALTKLDVLDGFETLKICVGYDLDGTRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  L GW QST G R +ADLP +A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEELPGWSQSTEGARSWADLPAEAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|110679201|ref|YP_682208.1| adenylosuccinate synthetase [Roseobacter denitrificans OCh 114]
 gi|109455317|gb|ABG31522.1| adenylosuccinate synthetase [Roseobacter denitrificans OCh 114]
          Length = 454

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 306/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 24  MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 83

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EI+ +  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 84  RGGKLSVIGNGVVLDPWHLIKEIDIIRGQGVDISPETLMIAENTPLILPIHGELDRAREE 143

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 144 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADTATLEARVDRALQHHDPLRKGLGI 202

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L+     IL +   +W +L  + R G  ILFEGAQG LLD D GTYPFV
Sbjct: 203 EPVDRDALVAQLVEIAPHILKYAAPVWKVLNEKRRAGKRILFEGAQGALLDIDFGTYPFV 262

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFP EL +  G  L E G EFG
Sbjct: 263 TSSNVIAGQAATGVGVGPGAINYVLGIVKAYTTRVGEGPFPAELDDADGQRLGERGHEFG 322

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 323 TVTGRKRRCGWFDAVLVRQTCATSGVNGIALTKLDVLDGFETLKICVGYELDGKRMDYLP 382

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             + +  R  P+Y  + GW  ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 383 TAADHQARCRPIYEEMPGWSDSTEGARSWADLPANAIKYVRRVEELIDCPVALLSTSPER 442

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 443 EDTILVTDPFAD 454


>gi|221639793|ref|YP_002526055.1| adenylosuccinate synthetase [Rhodobacter sphaeroides KD131]
 gi|332558810|ref|ZP_08413132.1| adenylosuccinate synthetase [Rhodobacter sphaeroides WS8N]
 gi|254788719|sp|B9KKA7|PURA_RHOSK RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|221160574|gb|ACM01554.1| Adenylosuccinate synthetase [Rhodobacter sphaeroides KD131]
 gi|332276522|gb|EGJ21837.1| adenylosuccinate synthetase [Rhodobacter sphaeroides WS8N]
          Length = 430

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 317/432 (73%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP   + EI  L   G+ ++P +L IA NA LIL +H +LD  RE 
Sbjct: 61  RPGKLSVIGNGVVLDPWHLVQEIAKLRADGVEISPESLMIAENAVLILPLHGELDRARES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRRAIRV DL D   ++ ++++L++HH+ALRR  G 
Sbjct: 121 --QNSVAKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLALRVDRLMVHHDALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V  + +L +L     ++LP+   +W ++    + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 EPVDREALLAQLREIAPQVLPYAKPVWKVMNEMRKAGKRILFEGAQGALLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++G+VLG+VKAYTTRVG GPFP EL++  G+ L E G+EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAIGFVLGIVKAYTTRVGEGPFPAELQDADGERLGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG  +D LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVSGIALTKLDVLDGFETLKICVGYELDGERLDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P++  LEGW +STAG R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 359 IAADQQARCTPIFEELEGWSESTAGARSWADLPGAAVKYVRRIEELIQCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 419 DDTILVTDPFED 430


>gi|83949469|ref|ZP_00958202.1| adenylosuccinate synthetase [Roseovarius nubinhibens ISM]
 gi|83837368|gb|EAP76664.1| adenylosuccinate synthetase [Roseovarius nubinhibens ISM]
          Length = 431

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 312/432 (72%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   ++EI  +  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVAEIAKIREQGVEITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRA+RV DL D   +  ++++ L HH+ LRR  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAVRVADLADDATLEARVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L    ++ILP+   +W +L    +KG  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPVDRDGLIAQLKEIAKEILPYAAPVWKVLNERKKKGERILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PGS+ YVLG+VKAYTTRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGSIDYVLGIVKAYTTRVGEGPFPTELDDEDGNRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICVGYDLDGKRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R +P+Y  + GW +ST G R +ADLP  A  Y+R++EE++E PVALLS  PER
Sbjct: 360 TAAEEQARCQPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIECPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|89067832|ref|ZP_01155276.1| adenylosuccinate synthetase [Oceanicola granulosus HTCC2516]
 gi|89046430|gb|EAR52486.1| adenylosuccinate synthetase [Oceanicola granulosus HTCC2516]
          Length = 430

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 246/432 (56%), Positives = 308/432 (71%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGAVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE+L  QG+ +TP  L IA N  LIL  H +LD  REG
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLEEIETLRGQGVDITPETLMIAENTPLILPFHGELDRAREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR IRV DL D   + +++++ L+HHNALR   G 
Sbjct: 121 --MNSVAKIGTTGRGIGPAYEDKVGRRVIRVADLADGPTLERRVDRALVHHNALRSGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    +L +L     KIL +   +W +L    + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 EPVDRDALLTKLREVAPKILAYAQPVWKVLNDRRKAGQRILFEGAQGALLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PGS+ +VLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGSIDFVLGIVKAYTTRVGEGPFPTELDDADGQRLGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++   +GV GI+LTKLDVLDG DELKIC GYR+DG  +D+LP
Sbjct: 299 TTTGRKRRCGWFDACLVRQTCATSGVSGISLTKLDVLDGFDELKICTGYRLDGEVLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R EP+Y  + GW+ STAG R +ADLP +A  Y+R+IEE+++ PVAL+S  PER
Sbjct: 359 TAAERQARVEPIYETIPGWQGSTAGARSWADLPAEAIKYVRRIEELIQCPVALVSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 419 DDTILVTDPFAD 430


>gi|39998397|ref|NP_954348.1| adenylosuccinate synthetase [Geobacter sulfurreducens PCA]
 gi|81831943|sp|Q747F9|PURA_GEOSL RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|39985343|gb|AAR36698.1| adenylosuccinate synthetase [Geobacter sulfurreducens PCA]
 gi|298507339|gb|ADI86062.1| adenylosuccinate synthetase [Geobacter sulfurreducens KN400]
          Length = 433

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 197/433 (45%), Positives = 283/433 (65%), Gaps = 3/433 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VD  +E+AD +VR+QGGNNAGHTL V +    L L+PSG++
Sbjct: 1   MANVVVVGAQWGDEGKGKVVDIYTEHADDVVRYQGGNNAGHTLVVGEEKVVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  IIG+ VV+DP  FI EI  L  +G       L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HEGKRCIIGNGVVLDPEVFIQEITRLKDKGRLKDDRALLVSESIHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT RGIGP YED++GRR IR+MDL D +  ++K+++ L   N +  +  G
Sbjct: 120 -AKSGEKKIGTTGRGIGPTYEDKIGRRGIRLMDLLDRDVFARKLKENLEEKNVILEKLLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +K   ++ I E+     + +  ++     +L  +S+ G  +LFEGAQG LLD DHGTYPF
Sbjct: 179 DKPFTFEEIYEQYCGYADILRNYVADTSLILYNDSKAGKKLLFEGAQGTLLDVDHGTYPF 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T +  A  G+G+SP  +  ++G+ KAY TRVG GPFPTEL +  G+ L++VG EF
Sbjct: 239 VTSSSTCAGGACTGTGVSPRDIHEIIGISKAYVTRVGSGPFPTELLDADGEKLRQVGHEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   VR +V +NG+ G+ALTKLDVL+  + +K+C GY  +G+ +  L
Sbjct: 299 GATTGRPRRCGWFDAMVVRYAVRVNGLTGVALTKLDVLNDFETIKVCTGYTFEGKPLADL 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW    +G R F +LP +A++Y++++E+++  P+ L+SIGP 
Sbjct: 359 PANLAVFEKCEPVYEELPGWMSDISGARTFEELPEKAKSYVKRLEQLIGCPIVLVSIGPR 418

Query: 420 RENTLIMSNPFED 432
           R+ T+I+SNPF+D
Sbjct: 419 RDQTIIISNPFQD 431


>gi|83859782|ref|ZP_00953302.1| adenylosuccinate synthetase [Oceanicaulis alexandrii HTCC2633]
 gi|83852141|gb|EAP89995.1| adenylosuccinate synthetase [Oceanicaulis alexandrii HTCC2633]
          Length = 429

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 256/431 (59%), Positives = 323/431 (74%), Gaps = 3/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NVVVVG QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL V+ + YKLSL+PSGVV
Sbjct: 1   MSNVVVVGAQWGDEGKGKIVDWLSHRADVVVRFQGGHNAGHTLVVDGVTYKLSLMPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           +  K+S+IG+ VVVDP AFISEIE +  QG+ ++P  +R+A  A+LIL +HR+LD +RE 
Sbjct: 61  QK-KLSLIGNGVVVDPWAFISEIEKVREQGVDISPKLVRVAETATLILPVHRELDAMREN 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGPAYED+VGRR++RV+DL D + + +++ +LL HHNALRR  G 
Sbjct: 120 R--DDGMKIGTTRRGIGPAYEDKVGRRSVRVIDLADEKQLRRRVTELLHHHNALRRGMGV 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E     ++ EL+    KILPF D +W  L++       ILFEGAQG  LD DHGTYPFV
Sbjct: 178 EEADPDALVAELLEIAPKILPFADPVWRTLDKAMSDDKKILFEGAQGAFLDVDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG +GYVLG+VKAYTTRVG GPFPTEL +  G  + E G+EFG
Sbjct: 238 TSSNTVAGQAAAGSGVGPGKVGYVLGIVKAYTTRVGEGPFPTELTDDIGQKIGERGREFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT+RQRRCGW D   VR+S  ING+ G+ALTKLDVLDG DELK+C+GY+ +G   D LP
Sbjct: 298 TVTSRQRRCGWFDAVLVRQSCKINGINGVALTKLDVLDGFDELKVCIGYKFNGEMYDRLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +      EPVY   EGW  STAG R +ADLP QA  Y+R+IEE++E PVALLS  PER
Sbjct: 358 AGTGAQAGVEPVYETFEGWSGSTAGARSWADLPAQAVKYVRRIEELIETPVALLSTSPER 417

Query: 421 ENTLIMSNPFE 431
           ++T++M +PF+
Sbjct: 418 DDTILMQDPFK 428


>gi|85703174|ref|ZP_01034278.1| adenylosuccinate synthetase [Roseovarius sp. 217]
 gi|85672102|gb|EAQ26959.1| adenylosuccinate synthetase [Roseovarius sp. 217]
          Length = 431

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 245/432 (56%), Positives = 307/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EI S+   G+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLIKEIASIRELGVTITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LRR  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADEATLIARVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V  + ++ +L     +ILP+   +W +L    R G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 APVDREALIAQLKDIAPQILPYAAPVWRVLNENRRAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPGAIDYVLGIVKAYTTRVGEGPFPTELHDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++ + +GV GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TVTGRKRRCGWFDACLVRQTCVTSGVTGIALTKLDVLDGFETLKICVGYDLDGTRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  L GW QST G R +ADLP +A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEELPGWSQSTEGARSWADLPAEAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|254510886|ref|ZP_05122953.1| adenylosuccinate synthetase [Rhodobacteraceae bacterium KLH11]
 gi|221534597|gb|EEE37585.1| adenylosuccinate synthetase [Rhodobacteraceae bacterium KLH11]
          Length = 431

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 242/432 (56%), Positives = 309/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I+EI S+  QG+ +TP+ L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLINEIASIRGQGVEITPDTLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AA-SAGTKIGTTGRGIGPAYEDKVGRRSVRVADLADEATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++ +L     +ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDALIAQLKEIAPQILPFAAPVWKVLSEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QAS G GI PGS+ +VLG+VKAYTTRVG GPFPTEL++  G  L E G EFG
Sbjct: 240 TSSNVIAGQASTGVGIGPGSIDFVLGIVKAYTTRVGEGPFPTELQDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++ + +GV GI+LTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TTTGRKRRCGWFDACLVRQTCVTSGVNGISLTKLDVLDGFETLKICVGYELDGTRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE++E PVALLS  PER
Sbjct: 360 TAADQQARCIPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIECPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|197116950|ref|YP_002137377.1| adenylosuccinate synthetase [Geobacter bemidjiensis Bem]
 gi|226709080|sp|B5ECF3|PURA_GEOBB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|197086310|gb|ACH37581.1| adenylosuccinate synthetase [Geobacter bemidjiensis Bem]
          Length = 432

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 196/432 (45%), Positives = 275/432 (63%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVV+G QWGDEGKGK+VD  +E AD +VR+QGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MANVVVIGAQWGDEGKGKVVDIYTEFADNVVRYQGGNNAGHTLVVGDEKVILHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VV+DP  FI EI  L   G       L ++    +I+  H+ +D+ RE 
Sbjct: 61  HEGKRCVIGNGVVLDPEVFIMEITKLKANGYLKDDKMLLLSEALHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFG 179
                   IGTT RGIGPAYED++GRR IR+MDL D +  ++K++++L   N  L +  G
Sbjct: 120 -KKSGSKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDEKAFTRKVKEVLEEKNLILTQLLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           ++   ++ I EE M   E +  +      +L +E++ G  +LFEGAQG LLD DHGTYP+
Sbjct: 179 DQPFTFEEIYEEYMKYAETLRKYAADTSLILHQETKAGKSLLFEGAQGTLLDVDHGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T S  A  GSG+SP  +  V+G+ KAY TRVG GPFPTEL+++TG+ L++ G+EF
Sbjct: 239 VTSSSTCSGGACTGSGVSPREIHEVIGISKAYATRVGSGPFPTELEDETGEQLRQAGREF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G+ T R RR GW D    R +V +NG+ GIA+TKLDVL G + +K+C  Y   G+ +  +
Sbjct: 299 GSTTGRPRRTGWYDALVARYAVRVNGLSGIAITKLDVLSGQETVKVCTAYNYKGQVLTEV 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       +  P+Y  L GW     G +  A+LP  AR+Y+ +IE++   PV L+S+GP 
Sbjct: 359 PASLEIMEQCTPIYEELPGWNDDITGAKSMAELPKNARDYVARIEKLSGAPVVLVSVGPR 418

Query: 420 RENTLIMSNPFE 431
           R+ T+++ NPFE
Sbjct: 419 RDETIVLRNPFE 430


>gi|258625734|ref|ZP_05720613.1| adenylosuccinate synthetase [Vibrio mimicus VM603]
 gi|262166623|ref|ZP_06034360.1| adenylosuccinate synthetase [Vibrio mimicus VM223]
 gi|262170461|ref|ZP_06038139.1| adenylosuccinate synthetase [Vibrio mimicus MB-451]
 gi|258581972|gb|EEW06842.1| adenylosuccinate synthetase [Vibrio mimicus VM603]
 gi|261891537|gb|EEY37523.1| adenylosuccinate synthetase [Vibrio mimicus MB-451]
 gi|262026339|gb|EEY45007.1| adenylosuccinate synthetase [Vibrio mimicus VM223]
          Length = 432

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 201/431 (46%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALLKEMSGLEDRGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMATFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG +LD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTMLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGEHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P+Y  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIYETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|91762260|ref|ZP_01264225.1| adenylosuccinate synthetase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718062|gb|EAS84712.1| adenylosuccinate synthetase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 430

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 233/431 (54%), Positives = 311/431 (72%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS+ ADV++RFQGG+NAGHTL ++   YKL LLPSG+V
Sbjct: 1   MKNVVVVGSQWGDEGKGKIVDWLSDQADVVIRFQGGHNAGHTLVIDGTTYKLRLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R +K+SIIG+ VVVDP A + EIE +  +G+ V  +N  I+ +A+LIL  HR++D +RE 
Sbjct: 61  RKNKISIIGNGVVVDPWALLEEIEEIKSKGVEVNVDNFIISESANLILPFHREMDEIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRR+IRVMDL    ++  ++E +LLHHNA+R+  G+
Sbjct: 121 AAGKG--KIGTTRRGIGPAYEDKVGRRSIRVMDLRSETNLDHRLETVLLHHNAIRKGLGK 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           K      + EEL+    KIL F   +W  ++   ++   ILFEGAQG LLD DHGTYPFV
Sbjct: 179 KIFEKDKLKEELLKIAPKILKFSQPVWLRIDEFKKQKKRILFEGAQGILLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+++ A+ G+G  P S+ YVLG+ KAYTTRVG GPFPTEL +  G+ L   GKEFG
Sbjct: 239 TSSNTVASAAATGTGCGPNSIHYVLGITKAYTTRVGEGPFPTELTDDIGELLGSRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT+R+RRCGW D   VR+++ I+G+ GIALTKLDVLD LDE+K+CV Y +DG+++D+LP
Sbjct: 299 TVTSRKRRCGWFDGVLVRQTIKISGIDGIALTKLDVLDELDEIKMCVEYELDGKKMDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + +P+Y    GWK ST G++   +LP  A+NYI  +E+ +   V+ +S  PER
Sbjct: 359 AAVEDQLKIKPIYKTFPGWKSSTQGIKNIENLPENAKNYIYALEDFIGTKVSSISTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILLENPFE 429


>gi|77463938|ref|YP_353442.1| adenylosuccinate synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|110826521|sp|Q3J0Z3|PURA_RHOS4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|77388356|gb|ABA79541.1| Adenylosuccinate synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 430

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 317/432 (73%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP   + EI  L   G+ ++P +L IA NA LIL +H +LD  RE 
Sbjct: 61  RPGKLSVIGNGVVLDPWHLVQEIAKLRADGVEISPQSLMIAENAVLILPLHGELDRARES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRRAIRV DL D   ++ ++++L++HH+ALRR  G 
Sbjct: 121 --QNSVAKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLALRVDRLMVHHDALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V  + +L +L     ++LP+   +W ++    + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 EPVDREALLAQLREIAPQVLPYAKPVWKVMNEMRKAGKRILFEGAQGALLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++G+VLG+VKAYTTRVG GPFP EL++  G+ L E G+EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAIGFVLGIVKAYTTRVGEGPFPAELQDADGERLGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG  +D LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVSGIALTKLDVLDGFETLKICVGYELDGERLDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P++  LEGW +STAG R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 359 IAADQQARCTPIFEELEGWSESTAGARSWADLPGAAVKYVRRIEELIQCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 419 DDTILVTDPFED 430


>gi|126739994|ref|ZP_01755684.1| adenylosuccinate synthetase [Roseobacter sp. SK209-2-6]
 gi|126718813|gb|EBA15525.1| adenylosuccinate synthetase [Roseobacter sp. SK209-2-6]
          Length = 437

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 240/438 (54%), Positives = 306/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLLKEIETVRAQGVEITPETLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLIARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++E+L     KILP+   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAIDRDALIEQLKEIAPKILPYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI PGS+ YVLG+VKAYTTRVG GPFPTE        +  G  L E
Sbjct: 240 TSSNVIAGQAATGVGIGPGSIDYVLGIVKAYTTRVGEGPFPTELLNAEGNPDADGQRLGE 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D A VR++   +G+KGI LTKLDVLDG + LKIC GY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDAALVRQTCATSGIKGICLTKLDVLDGFETLKICTGYDLDGE 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R +P+Y  + GW +ST G R + +LP  A  Y++++EE++E PVALL
Sbjct: 360 HLDYLPTAADQQARCKPIYEEMPGWSESTEGARSWNELPANAIKYVKRVEELIECPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|254501116|ref|ZP_05113267.1| adenylosuccinate synthetase [Labrenzia alexandrii DFL-11]
 gi|222437187|gb|EEE43866.1| adenylosuccinate synthetase [Labrenzia alexandrii DFL-11]
          Length = 430

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 264/432 (61%), Positives = 333/432 (77%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVRFQGG+NAGHTL ++ + YKLSLLPSGV 
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSEQADVIVRFQGGHNAGHTLVIDGVSYKLSLLPSGVA 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DPHA   E++ L  QG+ VTP +LR+A NA+LILS+HR+LD LRE 
Sbjct: 61  RPGKLSVIGNGVVLDPHALAEEVKRLGEQGVVVTPESLRVAENATLILSLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIR+MDL ++  +  KI++LL HHNALRR  G+
Sbjct: 121 --SNTGTKIGTTKRGIGPAYEDKVGRRAIRLMDLKNLTTLPAKIDRLLTHHNALRRGLGQ 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    I EEL    +++LP+MD +W LL+ + R+G  ILFEGAQG LLD DHGTYPFV
Sbjct: 179 DEVSADAIFEELSSVADQVLPYMDKVWYLLDEQRRQGKRILFEGAQGALLDIDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ G G+ PGS+ YVLG+ KAYTTRVG GPFPTE +N+ G+FL   G EFG
Sbjct: 239 TSSNTVAGQAATGCGLGPGSVDYVLGITKAYTTRVGEGPFPTEQQNEVGEFLGTRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICVGY +DG  +D+LP
Sbjct: 299 TVTGRRRRCGWFDAVLVRQTVCTSGINGIALTKLDVLDGLEEIKICVGYELDGERLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  + GWK+ST G R +A+LP QA  Y+R +EE++  PVA+LS  PER
Sbjct: 359 ASQGAQERVKPIYESMPGWKESTEGARTWAELPAQAIKYVRHVEELIGAPVAILSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPF+D
Sbjct: 419 DDTILVQNPFQD 430


>gi|262401889|ref|ZP_06078454.1| adenylosuccinate synthetase [Vibrio sp. RC586]
 gi|262351861|gb|EEZ00992.1| adenylosuccinate synthetase [Vibrio sp. RC586]
          Length = 432

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALLKEMSGLEDRGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMASFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGEHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P+Y  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIYETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|118578957|ref|YP_900207.1| adenylosuccinate synthetase [Pelobacter propionicus DSM 2379]
 gi|166232481|sp|A1ALC9|PURA_PELPD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|118501667|gb|ABK98149.1| Adenylosuccinate synthetase [Pelobacter propionicus DSM 2379]
          Length = 430

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 268/431 (62%), Gaps = 3/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV +VG QWGDEGKGK+VD  +E AD IVRFQGGNNAGHTL V +    L L+PSG++
Sbjct: 1   MANVAIVGAQWGDEGKGKVVDIYTEYADDIVRFQGGNNAGHTLVVGNEKVVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  IIG+ VV+DP  FI EI  L   G     + L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HEGKRCIIGNGVVLDPEVFIKEIVKLKESGRLTDDSCLLLSESLHIIMPYHKRIDIAREA 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-G 179
                   IGTT RGIGP YED++GRR IR+MDL + +  ++++++ L+  N L     G
Sbjct: 121 R--SGDRKIGTTGRGIGPCYEDKIGRRGIRLMDLLNRDVFARRLKEFLVEKNFLLEKMLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           E    Y  ILEE     E +  +M     ++  + + G  ILFEGAQG LLD D GTYPF
Sbjct: 179 EAPCDYDQILEEYSGYAEVLRAYMADTALIINNDLQAGKKILFEGAQGTLLDVDFGTYPF 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T +     GSG+ P  +  ++G+ KAY TRVG GPFPTEL +  GD L++ G EF
Sbjct: 239 VTSSSTCAGGVCTGSGVGPRHIHEIIGISKAYVTRVGSGPFPTELFDADGDRLRDAGGEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G+ T R RRCGW D   +R +V  NG+ GIALTKLDVL G D +KIC GY +DG+ ++ L
Sbjct: 299 GSTTGRPRRCGWFDAMVIRYAVRTNGLTGIALTKLDVLSGFDSIKICTGYTLDGKALETL 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         +PVY  L GW    +G + F +LP  AR Y++++EE+   P+ L+S+G  
Sbjct: 359 PSAPEAFENCQPVYEELPGWNADISGAKSFEELPDSARAYVKRLEELAGCPIVLVSVGAR 418

Query: 420 RENTLIMSNPF 430
           R+ T+I+ NPF
Sbjct: 419 RDQTIILRNPF 429


>gi|71083310|ref|YP_266029.1| adenylosuccinate synthetase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|110826516|sp|Q4FN13|PURA_PELUB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|71062423|gb|AAZ21426.1| adenylosuccinate synthase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 430

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 232/431 (53%), Positives = 311/431 (72%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS+ ADV++RFQGG+NAGHTL ++   YKL LLPSG+V
Sbjct: 1   MKNVVVVGSQWGDEGKGKIVDWLSDQADVVIRFQGGHNAGHTLVIDGTTYKLRLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R +K+SIIG+ VVVDP A + EIE +  +G+ V  +N  I+ +A+LIL  HR++D +RE 
Sbjct: 61  RKNKISIIGNGVVVDPWALLEEIEEIKSKGVEVNVDNFIISESANLILPFHREMDEIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRR+IRVMDL    ++  ++E +LLHHNA+R+  G+
Sbjct: 121 AAGKG--KIGTTRRGIGPAYEDKVGRRSIRVMDLRSETNLDHRLETVLLHHNAIRKGLGK 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           K      + EEL+    +IL F   +W  ++   ++   ILFEGAQG LLD DHGTYPFV
Sbjct: 179 KIFEKDKLKEELLKIAPEILKFSQPVWLRIDEFKKQKKRILFEGAQGILLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+++ A+ G+G  P S+ YVLG+ KAYTTRVG GPFPTEL +  G+ L   GKEFG
Sbjct: 239 TSSNTVASAAATGTGCGPNSIHYVLGITKAYTTRVGEGPFPTELTDDIGELLGSRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT+R+RRCGW D   VR+++ I+G+ GIALTKLDVLD LDE+K+CV Y +DG+++D+LP
Sbjct: 299 TVTSRKRRCGWFDGVLVRQTIKISGIDGIALTKLDVLDELDEIKMCVEYELDGKKMDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + +P+Y    GWK ST G++   +LP  A+NYI  +E+ +   V+ +S  PER
Sbjct: 359 AAVEDQLKIKPIYKTFPGWKSSTQGIKNIENLPENAKNYIYALEDFIGTKVSSISTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILLENPFE 429


>gi|258620521|ref|ZP_05715559.1| adenylosuccinate synthetase [Vibrio mimicus VM573]
 gi|258587400|gb|EEW12111.1| adenylosuccinate synthetase [Vibrio mimicus VM573]
          Length = 432

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 201/431 (46%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALLKEMSGLEDRGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMAAFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG +LD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTMLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGEHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P+Y  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIYETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|118588314|ref|ZP_01545723.1| adenylosuccinate synthetase [Stappia aggregata IAM 12614]
 gi|118439020|gb|EAV45652.1| adenylosuccinate synthetase [Stappia aggregata IAM 12614]
          Length = 430

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 333/432 (77%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVRFQGG+NAGHTL ++ + YKLSLLPSGV 
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSEQADVIVRFQGGHNAGHTLVIDGVSYKLSLLPSGVA 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DPHA   E+E L  QG+ VTP +LR+A N +LILS+HR+LD LRE 
Sbjct: 61  REGKLSVIGNGVVLDPHALAEEVERLGKQGVVVTPESLRVAENVTLILSLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIR+MDL ++  +  KI++LL HHNALRR  G+
Sbjct: 121 --SNTGTRIGTTKRGIGPAYEDKVGRRAIRLMDLKNLATLPAKIDRLLTHHNALRRGLGQ 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+  + I +EL    +K+LP+MD +W LL+ + R+G  ILFEGAQG LLD DHGTYPFV
Sbjct: 179 DEISAQAIYDELASIADKVLPYMDKVWYLLDEQRRQGKRILFEGAQGALLDIDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ G G+ PGS+ YVLG+ KAYTTRVG GPFPTELK++ G+FL   G EFG
Sbjct: 239 TSSNTVAGQAATGCGLGPGSINYVLGITKAYTTRVGEGPFPTELKDEVGEFLGTRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGLDE+KIC+GY +DG  +D+LP
Sbjct: 299 TVTGRRRRCGWFDAVLVRQTVCTSGINGIALTKLDVLDGLDEIKICIGYELDGERIDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GWK+ST G R +ADLP QA  Y+R +EE++  PVALLS  PER
Sbjct: 359 ASQGAQERVKPIYESLPGWKESTEGARTWADLPAQAIKYVRHVEELIGAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPF+D
Sbjct: 419 DDTILVQNPFQD 430


>gi|189038314|sp|A8I1V7|PURA_AZOC5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
          Length = 430

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 255/431 (59%), Positives = 326/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVDGVTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP A + E+  L  QG+ V P+ LRIA N  LIL +HR+LD LRE 
Sbjct: 61  RPGKLSVIGNGVVLDPQALVDELARLESQGVHVGPDRLRIAENTPLILPLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT+RGIGPAYED+VGRRAIR++DL D + +  K+E+LL HHN +RR  G 
Sbjct: 121 A--SEGTRIGTTKRGIGPAYEDKVGRRAIRLVDLVDPKALPAKVERLLTHHNLIRRGLGV 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +EV  + +++EL+    K+LP+MD +W LL++  + G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 EEVNPQALVDELLALAPKVLPYMDRVWELLDKARKDGKKILFEGAQGALLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+++ A+ GSG+ PG+L YVLG+ KAYTTRVG GPFPTEL ++ G  L   G+EFG
Sbjct: 239 TSSNTVASSAAGGSGVGPGALDYVLGITKAYTTRVGEGPFPTELTDEVGKTLGTKGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R RRCGW D   VR++V   G+ GIALTKLDVLDG DE+K+CVGY++DG+E+D+ P
Sbjct: 299 VVTGRPRRCGWFDAVLVRQTVRTCGIHGIALTKLDVLDGFDEIKVCVGYKLDGKEIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            +     R EP+Y  +EGW  STAG R +ADLP +A  Y+R +EE++  PVA+LS  PER
Sbjct: 359 SEMGAQARVEPIYETIEGWTDSTAGARSWADLPAEAVKYVRWLEELIGCPVAVLSTSPER 418

Query: 421 ENTLIMSNPFE 431
            +T+++ NPF+
Sbjct: 419 NDTILVHNPFQ 429


>gi|172046250|sp|Q168S1|PURA_ROSDO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
          Length = 431

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 306/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EI+ +  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLIKEIDIIRGQGVDISPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADTATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L+     IL +   +W +L  + R G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPVDRDALVAQLVEIAPHILKYAAPVWKVLNEKRRAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFP EL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGAINYVLGIVKAYTTRVGEGPFPAELDDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAVLVRQTCATSGVNGIALTKLDVLDGFETLKICVGYELDGKRMDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             + +  R  P+Y  + GW  ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADHQARCRPIYEEMPGWSDSTEGARSWADLPANAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|126462772|ref|YP_001043886.1| adenylosuccinate synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|166232492|sp|A3PL98|PURA_RHOS1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|126104436|gb|ABN77114.1| Adenylosuccinate synthetase [Rhodobacter sphaeroides ATCC 17029]
          Length = 430

 Score =  504 bits (1299), Expect = e-141,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 317/432 (73%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP   + EI  L   G+ ++P +L IA NA LIL +H +LD  RE 
Sbjct: 61  RPGKLSVIGNGVVLDPWHLVQEIAKLRADGVEISPESLMIAENAVLILPLHGELDRARES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRRAIRV DL D   ++ ++++L++HH+ALRR  G 
Sbjct: 121 --QNSVAKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLALRVDRLMVHHDALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V  + +L +L     ++LP+   +W ++    + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 EPVDREALLTQLREIAPQVLPYAKPVWKVMNEMRKAGKRILFEGAQGALLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++G+VLG+VKAYTTRVG GPFP EL++  G+ L E G+EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAIGFVLGIVKAYTTRVGEGPFPAELQDADGERLGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG  +D LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVSGIALTKLDVLDGFETLKICVGYELDGERLDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P++  LEGW +STAG R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 359 IAADQQARCTPIFEELEGWSESTAGARSWADLPGAAVKYVRRIEELIQCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 419 DDTILVTDPFED 430


>gi|253699208|ref|YP_003020397.1| adenylosuccinate synthetase [Geobacter sp. M21]
 gi|259547039|sp|C6DZQ7|PURA_GEOSM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|251774058|gb|ACT16639.1| adenylosuccinate synthetase [Geobacter sp. M21]
          Length = 432

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 197/432 (45%), Positives = 274/432 (63%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVV+G QWGDEGKGK+VD  +E AD +VR+QGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MANVVVIGAQWGDEGKGKVVDIYTEFADDVVRYQGGNNAGHTLVVGDEKVILHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VV+DP  FI EI  L   G       L ++    +I+  H+ +D+ RE 
Sbjct: 61  HEGKRCVIGNGVVLDPEVFIMEITKLKANGYLKDDKMLLLSEALHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFG 179
                   IGTT RGIGPAYED++GRR IR+MDL D +  ++K++++L   N  L +  G
Sbjct: 120 -KKSGSKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDEKAFTRKVKEVLEEKNLILTQLLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           E+   ++ I EE M   E +  +      +L +E + G  +LFEGAQG LLD DHGTYP+
Sbjct: 179 EQPFTFEEIYEEYMKYAETLRKYAADTSLILHQEIKAGKSLLFEGAQGTLLDVDHGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T S  A  GSG+SP  +  V+G+ KAY TRVG GPFPTEL+++TG+ L++ G+EF
Sbjct: 239 VTSSSTCSGGACTGSGVSPREIHEVIGISKAYATRVGSGPFPTELEDETGEQLRQAGREF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G+ T R RR GW D    R +V ING+ GIA+TKLDVL G + +K+C  Y   G+ +  +
Sbjct: 299 GSTTGRPRRTGWYDALVARYAVRINGLSGIAITKLDVLSGQETVKVCTAYNYKGQVLTEV 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P          P+Y  L GW +   G +  A+LP  AR+Y+ ++EE+   PV L+S+GP 
Sbjct: 359 PASLEVMELCTPIYEELPGWNEDITGAKSMAELPKNARDYVARVEELSGAPVVLVSVGPR 418

Query: 420 RENTLIMSNPFE 431
           R+ T+++ NPF+
Sbjct: 419 RDETIVLRNPFQ 430


>gi|327482302|gb|AEA85612.1| adenylosuccinate synthetase [Pseudomonas stutzeri DSM 4166]
          Length = 431

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 285/431 (66%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTDQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VVV P A + EI  L  +G+ V    LRI+ + +LIL  H  LD  RE +
Sbjct: 63  DNVQCLIGNGVVVAPDALLREITKLEEKGVPVR-ERLRISPSCTLILPYHVALDQAREAS 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
            S     IGTT RGIGPAYED+V RR +R+ DL + E  + K+ +LL +HN + ++F + 
Sbjct: 122 RSEG--KIGTTGRGIGPAYEDKVARRGLRIGDLFNPERFTVKLRELLDYHNFVLQNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V ++  L+E +   E + P +  + + L    ++GA I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVDFQKTLDEALGYAEILKPLITDVTARLHELRKQGACIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSSTTAGGTATGSGFGPLYLDYILGITKAYTTRVGSGPFPTELFDDVGARLAERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
           + T R RRCGW D   +RR++ IN + GI LTKLDVLDGL+ ++ICVGY+  +G  +   
Sbjct: 300 STTGRARRCGWFDAVILRRAIEINSISGICLTKLDVLDGLETIRICVGYKDRNGEVLVDA 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+  +   +PVY  + GW +ST G +   +LP  AR YI+++EE++E PV ++S GP+
Sbjct: 360 PTDADSYDGLQPVYEDMPGWSESTVGAKSLDELPANARAYIKRLEELIEAPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+++ +P+
Sbjct: 420 RNETIVLRHPY 430


>gi|218528991|ref|YP_002419807.1| adenylosuccinate synthase [Methylobacterium chloromethanicum CM4]
 gi|254788711|sp|B7L289|PURA_METC4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|218521294|gb|ACK81879.1| Adenylosuccinate synthase [Methylobacterium chloromethanicum CM4]
          Length = 430

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 267/432 (61%), Positives = 330/432 (76%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGEAVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP+ + +IG+ VV+DP+A  SEI+ LA QG+ V+  NLR+A+NA+LILS+HR+LD LRE 
Sbjct: 61  RPNTLGVIGNGVVLDPYALASEIDRLAGQGVTVSRENLRVADNATLILSLHRELDALRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGPAYED+VGRRAIR+MDL + E +  KIE+LL HHNALRR FG 
Sbjct: 121 GAP--GTKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPETLPPKIERLLAHHNALRRGFGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL+EL    E++LP+ D +W LL+   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 179 EEISEQTILDELTGIAERVLPYQDTVWRLLDDARRGGKRILFEGAQGALLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G  + E G EFG
Sbjct: 239 TSSNTVAGQAATGSGLGPRAIGYVLGIAKAYTTRVGEGPFPTELHDEIGQRIGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDG DE+++C  Y +DG+  D LP
Sbjct: 299 TVTGRKRRCGWFDACLVRQTVKTSGIDGIALTKLDVLDGFDEIRVCTAYDIDGQRFDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  + GW  +TAG R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 ASQAAQQRAVPVYETIPGWSGTTAGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M NPFED
Sbjct: 419 DDTILMHNPFED 430


>gi|240137508|ref|YP_002961979.1| adenylosuccinate synthetase [Methylobacterium extorquens AM1]
 gi|240007476|gb|ACS38702.1| adenylosuccinate synthetase [Methylobacterium extorquens AM1]
          Length = 448

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 267/432 (61%), Positives = 330/432 (76%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 19  MANVVVVGAQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGEAVYKLSLLPSGVV 78

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP+ + +IG+ VV+DP+A  SEI+ LA QG+ V+  NLR+A+NA+LILS+HR+LD LRE 
Sbjct: 79  RPNTLGVIGNGVVLDPYALASEIDRLAGQGVTVSRENLRVADNATLILSLHRELDALRED 138

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGPAYED+VGRRAIR+MDL + E +  KIE+LL HHNALRR FG 
Sbjct: 139 GAP--GTKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPETLPPKIERLLAHHNALRRGFGL 196

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL+EL    E++LP+ D +W LL+   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 197 EEISEQTILDELTGIAERVLPYQDTVWRLLDDARRGGKRILFEGAQGALLDVDHGTYPFV 256

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G  + E G EFG
Sbjct: 257 TSSNTVAGQAATGSGLGPRAIGYVLGIAKAYTTRVGEGPFPTELHDEIGQRIGERGHEFG 316

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDG DE+++C  Y +DG+  D LP
Sbjct: 317 TVTGRKRRCGWFDACLVRQTVKTSGIDGIALTKLDVLDGFDEIRVCTAYDIDGQRFDHLP 376

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  + GW  +TAG R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 377 ASQAAQQRAVPVYETIPGWSGTTAGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 436

Query: 421 ENTLIMSNPFED 432
           ++T++M NPFED
Sbjct: 437 DDTILMHNPFED 448


>gi|255264584|ref|ZP_05343926.1| adenylosuccinate synthetase [Thalassiobium sp. R2A62]
 gi|255106919|gb|EET49593.1| adenylosuccinate synthetase [Thalassiobium sp. R2A62]
          Length = 431

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 309/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  V+KL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVFKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   ++EI S+  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVNEIASIRKQGVDISPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADAATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L    ++ILPF   +W +L    +KG  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDALVAQLQEIAQEILPFAAPVWKVLNERKKKGERILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PGS+ YVLG+VKAYTTRVG GPFPTEL +  G  L   G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGSIDYVLGIVKAYTTRVGEGPFPTELDDDDGLRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICVGYDLDGTRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW  ST G R +ADLP  A  Y+R+IEE++E PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEVPGWSDSTEGARSWADLPAAAIKYVRRIEELIECPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 420 DDTILVTDPFED 431


>gi|163737675|ref|ZP_02145092.1| Adenylosuccinate synthase [Phaeobacter gallaeciensis BS107]
 gi|161389201|gb|EDQ13553.1| Adenylosuccinate synthase [Phaeobacter gallaeciensis BS107]
          Length = 437

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 237/438 (54%), Positives = 305/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ ++P  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIETVRAQGVDISPQTLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLIARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L    ++ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDGLIAQLKEISKEILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI PGS+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQAATGVGIGPGSIDYVLGIVKAYTTRVGEGPFPTELLNADGTPDVDGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGITGISLTKLDVLDGFETLKICVGYELDGT 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R  P+Y  + GW +ST G R + DLP  A  Y++++EE+++ PVALL
Sbjct: 360 RLDYLPTAADQQARCTPIYEEMPGWSESTEGARSWNDLPANAIKYVKRVEELIDCPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|304393311|ref|ZP_07375239.1| adenylosuccinate synthetase [Ahrensia sp. R2A130]
 gi|303294318|gb|EFL88690.1| adenylosuccinate synthetase [Ahrensia sp. R2A130]
          Length = 431

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 274/432 (63%), Positives = 337/432 (78%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADLVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  KM +IG+ VV+DPHA ++EI  LA QG+ +TP+NLRIA+NA+LILS+HR+LD LRE 
Sbjct: 61  RKGKMGVIGNGVVIDPHALVAEIGRLAEQGVPITPDNLRIADNATLILSLHRELDGLRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT+RGIGPAYED+VGRRAIRVMDL + + +  KIE++L HHNALR+  GE
Sbjct: 121 AA-STGTKIGTTRRGIGPAYEDKVGRRAIRVMDLVNTDTLRGKIERVLTHHNALRKGLGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+   TI +ELM  R+ ILPF + +W LL+ + R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 AEISVDTIFDELMAVRDDILPFRETVWKLLDDKRRAGKRILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QAS GSG+ PGSL +VLG+ KAYTTRVG GPFPTE +N+ G FL E G EFG
Sbjct: 240 TSSNTVAGQASAGSGLGPGSLNFVLGITKAYTTRVGEGPFPTEQENEIGQFLGEKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV +NG+ GIALTKLDVLDG+DE+KIC GY +DG  +D LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQSVSVNGITGIALTKLDVLDGMDEIKICTGYTLDGEPMDHLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  LEGW + T G R +ADLP QA  Y+R++EE++  PVA+LS  PER
Sbjct: 360 AAQGAQARVVPVYETLEGWHEPTVGARSWADLPAQAIKYVRRVEELIGAPVAMLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 420 DDTILVADPFED 431


>gi|163850432|ref|YP_001638475.1| adenylosuccinate synthase [Methylobacterium extorquens PA1]
 gi|254559686|ref|YP_003066781.1| adenylosuccinate synthetase [Methylobacterium extorquens DM4]
 gi|163662037|gb|ABY29404.1| Adenylosuccinate synthase [Methylobacterium extorquens PA1]
 gi|254266964|emb|CAX22764.1| adenylosuccinate synthetase [Methylobacterium extorquens DM4]
          Length = 448

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 330/432 (76%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 19  MANVVVVGAQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGEAVYKLSLLPSGVV 78

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP+ + +IG+ VV+DP+A  SEI+ LA QG+ V+  NLR+A+NA+LILS+HR+LD LRE 
Sbjct: 79  RPNTLGVIGNGVVLDPYALASEIDRLAGQGVTVSRENLRVADNATLILSLHRELDALRED 138

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGPAYED+VGRRAIR+MDL + E +  KIE+LL HHNALRR FG 
Sbjct: 139 GAP--GTKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPETLPPKIERLLAHHNALRRGFGL 196

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL+EL    E++LP+ D +W LL+   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 197 EEISEQTILDELTGIAERVLPYQDTVWRLLDDARRGGKRILFEGAQGALLDVDHGTYPFV 256

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G  + E G EFG
Sbjct: 257 TSSNTVAGQAATGSGLGPRAIGYVLGIAKAYTTRVGEGPFPTELHDEIGQRIGERGHEFG 316

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDG +E+++C  Y +DG+  D LP
Sbjct: 317 TVTGRKRRCGWFDACLVRQTVKTSGIDGIALTKLDVLDGFEEIRVCTAYDIDGQRFDHLP 376

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  + GW  +TAG R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 377 ASQAAQQRAVPVYETIPGWSGTTAGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 436

Query: 421 ENTLIMSNPFED 432
           ++T++M NPFED
Sbjct: 437 DDTILMHNPFED 448


>gi|83592442|ref|YP_426194.1| adenylosuccinate synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|123526995|sp|Q2RVD8|PURA_RHORT RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|83575356|gb|ABC21907.1| Adenylosuccinate synthetase [Rhodospirillum rubrum ATCC 11170]
          Length = 429

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 257/432 (59%), Positives = 320/432 (74%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV VVG QWGDEGKGK+VDWL+E ADV+VRFQGG+NAGHTL V+ + YKLSLLPSG V
Sbjct: 1   MSNVAVVGSQWGDEGKGKVVDWLAERADVVVRFQGGHNAGHTLVVDGVTYKLSLLPSGAV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VVVDP A   EIE +A QG+ +TP  LRIA NA LIL +H +LD  RE 
Sbjct: 61  R-GKLSIIGNGVVVDPWALFEEIERVAAQGVVITPEGLRIAENAVLILPLHGNLDRAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     A IGTT RGIGPAYED+V RRAIR+ DL D + +  K+E+LL HHNAL R  GE
Sbjct: 120 AA--GNAKIGTTGRGIGPAYEDKVARRAIRLCDLADEDVLRFKVERLLTHHNALLRGLGE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+   +++  L+    +ILPF   +W +L+   R G  ILFEGAQG +LD DHGTYP+V
Sbjct: 178 PELDADSLISALLEIAPRILPFASPVWKVLDEARRAGKKILFEGAQGAMLDVDHGTYPYV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G+ P S+G+ LG+ KAYTTRVG GPFPTEL +  G  + E G+EFG
Sbjct: 238 TSSNTVAPNAATGAGVGPSSVGFTLGITKAYTTRVGAGPFPTELFDDIGRTIGERGREFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VR+SV++ G++GIALTKLDVLDGLDELKIC GYR+DG+ +D LP
Sbjct: 298 TVTGRPRRCGWFDAVLVRQSVLVGGLRGIALTKLDVLDGLDELKICTGYRLDGQVIDHLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 +R EP+Y  LEGWK ST G R +ADLP +A  YIR++EE++E PVALLS  PER
Sbjct: 358 ASMKAQSRVEPIYETLEGWKDSTFGARSWADLPAKAIKYIRRLEELIEAPVALLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PF D
Sbjct: 418 EDTILVRDPFLD 429


>gi|146305676|ref|YP_001186141.1| adenylosuccinate synthetase [Pseudomonas mendocina ymp]
 gi|166232487|sp|A4XPZ3|PURA_PSEMY RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|145573877|gb|ABP83409.1| Adenylosuccinate synthetase [Pseudomonas mendocina ymp]
          Length = 431

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+    LILS H  LD  RE A
Sbjct: 63  EGVECLIGNGVVVAPDALLREITKLEEKGVPVR-QRLRISPACPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    +F ++
Sbjct: 122 R--GDAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNFYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + ++L    R+G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYAELLKPMMADVTAVLHDLRREGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPLYLNYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ ++IC GY+  +G+ +   
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETIRICTGYKDANGQVLVDA 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+  +   +PVY  + GW +ST G +   DLP  AR YI+++EE++  P+ ++S GP+
Sbjct: 360 PTDADSYLGLQPVYEEMPGWSESTLGAKTLEDLPAAARAYIKRVEELVGAPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+++ +PF
Sbjct: 420 RNETIVLRHPF 430


>gi|269967702|ref|ZP_06181751.1| adenylosuccinate synthetase [Vibrio alginolyticus 40B]
 gi|269827680|gb|EEZ81965.1| adenylosuccinate synthetase [Vibrio alginolyticus 40B]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 201/438 (45%), Positives = 277/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN    +F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMATFAEKLKEVMEFHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEEVLEQAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L E
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGIAKAYCTRVGAGPFPTELYDGLDKQDPIGKHLGE 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLEELKICTGYKMEDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +    LP  A NYI++IEE+  VPV +
Sbjct: 360 SVLEVSPMAAEAFEKATPIYETMPGWSENTFGAKSLDALPQAALNYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|330501630|ref|YP_004378499.1| adenylosuccinate synthetase [Pseudomonas mendocina NK-01]
 gi|328915916|gb|AEB56747.1| adenylosuccinate synthetase [Pseudomonas mendocina NK-01]
          Length = 431

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+    LILS H  LD  RE A
Sbjct: 63  EGVECLIGNGVVVAPDALLREITKLEEKGVPVR-ERLRISPACPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    +F ++
Sbjct: 122 R--GDAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNFYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + ++L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYAELLKPMMADVTAVLHDLRRGGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPLYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ ++IC GY+  +G+ +   
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETIRICTGYKDANGQVLVDA 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+  +   +PVY  + GW +ST G +   DLP  AR YI+++EE++  P+ ++S GP+
Sbjct: 360 PTDADSYIGLQPVYEEMPGWSESTLGAKTLEDLPAAARAYIKRVEELVGAPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+++ +PF
Sbjct: 420 RNETIVLRHPF 430


>gi|148253374|ref|YP_001237959.1| adenylosuccinate synthetase [Bradyrhizobium sp. BTAi1]
 gi|166232426|sp|A5ED09|PURA_BRASB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|146405547|gb|ABQ34053.1| Adenylosuccinate synthetase [Bradyrhizobium sp. BTAi1]
          Length = 430

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 254/431 (58%), Positives = 326/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGATYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DP AF+ E+  L  QG+ ++P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RTGKLSVIGNGVVFDPQAFLDEVSKLQSQGVAISPDNLRVAENVTLILPLHRELDALRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIR+MDL D++ +  KI++LL HHNALRR  G 
Sbjct: 121 A--SAATAIGTTRRGIGPAYEDKVGRRAIRLMDLADLDTLPHKIDRLLAHHNALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +++  K IL EL     K+LP+ + +W LL+ + R+G  +LFEGAQG LLD DHGTYP+V
Sbjct: 179 EQIDGKDILRELTAFAPKLLPYAETVWRLLDIKRREGKRMLFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTE  N+TG  + E G+EFG
Sbjct: 239 TSSNTVAAQAATGAGLGPGAIGYVLGLCKAYTTRVGQGPFPTEQDNETGRKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR++V   G+ G+ALTKLD+LDG D + +C GYR+DG+E+D  P
Sbjct: 299 TNTGRPRRCGWFDAVLVRQAVRTCGINGLALTKLDILDGFDTIDVCTGYRLDGKEIDHFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWKQ TA  R +ADLP QA  Y+R+IEE++  P+ALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKQPTANARSWADLPAQAIKYVRRIEELVGCPIALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|312884708|ref|ZP_07744409.1| adenylosuccinate synthetase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367621|gb|EFP95172.1| adenylosuccinate synthetase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 199/438 (45%), Positives = 278/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNIKCVIGNGVVLSPEALMKEMKPLEERGIPVR-KRLFISEACPLILPYHIAMDQARELA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEFHNFQLEHFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y  +LE+     + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYDEVLEQAKGYADLLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPIGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG+EFG  T R RR GW D  ++RR++ IN + G  LTKLDVLDGL+ELK+C GY+M DG
Sbjct: 300 VGQEFGATTGRLRRTGWFDAVAMRRAIQINSISGFCLTKLDVLDGLEELKLCTGYKMQDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +   DLP  A NYI++IEE+  VPV +
Sbjct: 360 SVLEVSPMAAEAFEQATPIYETMPGWSETTFGAKSIDDLPQAALNYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|91227448|ref|ZP_01261812.1| adenylosuccinate synthetase [Vibrio alginolyticus 12G01]
 gi|91188598|gb|EAS74889.1| adenylosuccinate synthetase [Vibrio alginolyticus 12G01]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 200/438 (45%), Positives = 277/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN    +F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMATFAEKLKEVMEFHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEEVLEQAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L E
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGIAKAYCTRVGAGPFPTELYDGLDKQDPIGKHLGE 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLEELKICTGYKMEDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +    LP  A +YI++IEE+  VPV +
Sbjct: 360 SVLEVSPMAAEAFEKATPIYETMPGWSENTFGAKSLDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|329115000|ref|ZP_08243755.1| Adenylosuccinate synthetase [Acetobacter pomorum DM001]
 gi|326695443|gb|EGE47129.1| Adenylosuccinate synthetase [Acetobacter pomorum DM001]
          Length = 429

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 306/432 (70%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWL+  AD++VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 1   MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGNQVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ IIG+ VVVDP A ++EI  +  QG+ VTP+ L+IA NA LIL +H  LD  RE 
Sbjct: 61  N-NKLGIIGNGVVVDPQALLAEIGRIQEQGLEVTPDTLKIAENAPLILPVHGALDRAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+V RRAIR+ DL + E +  K+++LLLHHN L    G 
Sbjct: 120 AR--GDRKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDELLLHHNTLLAGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
                + +L  L     K+LP+M   W +L+   R G  ILFEGAQ  +LD DHGTYPFV
Sbjct: 178 PVFTKEELLTFLTDIAPKVLPYMAPTWDILDDARRAGRRILFEGAQAVMLDVDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A  GSG+ P + G+VLG+ KAY TRVG GPFPTEL ++TG  L E G EFG
Sbjct: 238 TSSNTVAANAGTGSGMGPTAAGFVLGIAKAYCTRVGEGPFPTELHDETGRRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR +V + G+ G+ALTKLDVLDGLDE+++CVGY +DG++V+  P
Sbjct: 298 TNTGRARRCGWFDSVLVRHAVRVGGINGLALTKLDVLDGLDEIRVCVGYELDGQKVERFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  LEGWK++T G R +ADLP QA  Y+R+IEE++  PV LLS  P+R
Sbjct: 358 SAPAAQQRVRPVYETLEGWKETTHGARRWADLPAQAIKYVRRIEELVGAPVTLLSTSPDR 417

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 418 DDTILMRDPFED 429


>gi|163740752|ref|ZP_02148145.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161385743|gb|EDQ10119.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 437

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 237/438 (54%), Positives = 305/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDSKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ ++P  L IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIETVRAQGVDISPQTLMIAENTPLILPLHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADEATLIARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L    ++ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDGLIAQLKEISKEILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI PGS+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQAATGVGIGPGSIDYVLGIVKAYTTRVGEGPFPTELLNADGTPDADGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGITGISLTKLDVLDGFETLKICVGYDLDGT 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R  P+Y  + GW +ST G R + DLP  A  Y++++EE+++ PVALL
Sbjct: 360 RLDYLPTAADQQARCTPIYEEMPGWSESTEGARSWNDLPANAIKYVKRVEELIDCPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|320155092|ref|YP_004187471.1| adenylosuccinate synthetase [Vibrio vulnificus MO6-24/O]
 gi|319930404|gb|ADV85268.1| adenylosuccinate synthetase [Vibrio vulnificus MO6-24/O]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 206/440 (46%), Positives = 278/440 (63%), Gaps = 12/440 (2%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M N VVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++ +   L L+PSG+
Sbjct: 1   MANNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGVKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   +IG+ VV+ P A I E++ L  +GI V    L I+    LIL  H  +D  RE
Sbjct: 61  LRDNVKCVIGNGVVLSPEALIKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++  HN    +F 
Sbjct: 120 IARGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEFHNFQLVNFY 177

Query: 180 EKE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + E V Y+ +LE+     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP
Sbjct: 178 KAEAVSYEEVLEQAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFL 292
           +VTSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFP       E ++  G  L
Sbjct: 238 YVTSSNTTAGGVAAGSGFGPRYLGYILGIAKAYCTRVGAGPFPTELYDGQEKQDPVGKHL 297

Query: 293 KEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM- 351
             VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL ELKIC GY+M 
Sbjct: 298 GTVGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLKELKICTGYQME 357

Query: 352 DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPV 411
           DG  ++  P  +    +  P+Y  + GW ++T G +   DLP  A NYI++IEE+  VPV
Sbjct: 358 DGSVLEVSPMAAEAFEKVTPIYETMPGWSENTFGAKSLEDLPQAAINYIKRIEELTGVPV 417

Query: 412 ALLSIGPERENTLIMSNPFE 431
            ++S GP+R  T+I  +PFE
Sbjct: 418 DIISTGPDRNETIIKVHPFE 437


>gi|89055670|ref|YP_511121.1| adenylosuccinate synthetase [Jannaschia sp. CCS1]
 gi|122497995|sp|Q28MG6|PURA_JANSC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|88865219|gb|ABD56096.1| Adenylosuccinate synthetase [Jannaschia sp. CCS1]
          Length = 431

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 233/432 (53%), Positives = 300/432 (69%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  V+KL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVFKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIATIRDQGVDISPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT RGIGPAYED+VGRR++RV DL D   +   +++ L HH+ LRR  G 
Sbjct: 121 AA-SSGTKIGTTGRGIGPAYEDKVGRRSVRVADLADRATLEAHVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    +++ L     +IL +   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 DPIDRNALIDALTEIAPQILQYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ P ++ Y LG+VKAYTTRVG GPFPTEL++  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPNAIDYTLGIVKAYTTRVGEGPFPTELEDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICVGYDLDGTRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW  ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCTPIYEEMPGWSDSTEGARSWADLPAAAIKYVRRVEELIQCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|37681250|ref|NP_935859.1| adenylosuccinate synthetase [Vibrio vulnificus YJ016]
 gi|46396772|sp|Q7MH07|PURA_VIBVY RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|37200001|dbj|BAC95830.1| adenylosuccinate synthase [Vibrio vulnificus YJ016]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 205/440 (46%), Positives = 278/440 (63%), Gaps = 12/440 (2%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M N VVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++ +   L L+PSG+
Sbjct: 1   MANNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGVKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   +IG+ VV+ P A I E++ L  +GI V    L I+    LIL  H  +D  RE
Sbjct: 61  LRDNVKCVIGNGVVLSPEALIKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++  HN    +F 
Sbjct: 120 IARGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEFHNFQLVNFY 177

Query: 180 EKE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + E V Y+ +LE+     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP
Sbjct: 178 KAEAVSYEEVLEQAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFL 292
           +VTSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFP       E ++  G  L
Sbjct: 238 YVTSSNTTAGGVAAGSGFGPRYLGYILGIAKAYCTRVGAGPFPTELYDGQEKQDPVGKHL 297

Query: 293 KEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM- 351
             VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL ELKIC GY+M 
Sbjct: 298 GTVGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLKELKICTGYQME 357

Query: 352 DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPV 411
           DG  ++  P  +    +  P+Y  + GW ++T G +   DLP  A NYI++IEE+  VPV
Sbjct: 358 DGSVLEVSPMAAEAFEKVTPIYETMPGWSENTFGAKSLEDLPQAAINYIKRIEELTGVPV 417

Query: 412 ALLSIGPERENTLIMSNPFE 431
            ++S GP+R  T++  +PFE
Sbjct: 418 DIISTGPDRNETIVKVHPFE 437


>gi|150397814|ref|YP_001328281.1| adenylosuccinate synthetase [Sinorhizobium medicae WSM419]
 gi|166232498|sp|A6UCR6|PURA_SINMW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|150029329|gb|ABR61446.1| Adenylosuccinate synthase [Sinorhizobium medicae WSM419]
          Length = 432

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 284/432 (65%), Positives = 351/432 (81%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+++IG+ VV+DPHA I+EI+ LA QG+ VTP NLRIA+NA+LILS+HR+LD +RE 
Sbjct: 61  RSGKLAVIGNGVVIDPHALIAEIDRLAAQGVTVTPQNLRIADNATLILSLHRELDGIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRVMDL D++ +  K+++LL HHNALRR  GE
Sbjct: 121 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADLDTLPAKVDRLLTHHNALRRGLGE 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+ ++ I++EL     ++LPFMD IW LL+RE RKGA ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEISHRAIMDELSSVAARVLPFMDTIWLLLDRERRKGARILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGSLGY+LG+ KAYTTRVG GPFPTEL ++ G FL E G EFG
Sbjct: 241 TSSNTVAGQAAAGSGMGPGSLGYILGITKAYTTRVGEGPFPTELDDEVGRFLGERGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR+SV  NG+ GIALTKLDVLDGLDELKICVGY +DG+++D LP
Sbjct: 301 TVTGRKRRCGWFDAALVRQSVAANGITGIALTKLDVLDGLDELKICVGYTLDGQQIDHLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    +PVY+ LEGWK+ST G R +A+LP QA  Y+R++EE++  PVALLS  PER
Sbjct: 361 ASQAQQALAKPVYITLEGWKESTVGARSWAELPAQAIKYVRQVEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 421 DDTILVTDPFED 432


>gi|254230079|ref|ZP_04923477.1| adenylosuccinate synthetase [Vibrio sp. Ex25]
 gi|262393038|ref|YP_003284892.1| adenylosuccinate synthetase [Vibrio sp. Ex25]
 gi|151937413|gb|EDN56273.1| adenylosuccinate synthetase [Vibrio sp. Ex25]
 gi|262336632|gb|ACY50427.1| adenylosuccinate synthetase [Vibrio sp. Ex25]
          Length = 438

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 204/438 (46%), Positives = 279/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++  HN    +F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMESFAEKLKEVMEFHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LEE     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEEAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L E
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGIAKAYCTRVGAGPFPTELYDGLDKQDPIGKHLGE 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLEELKICTGYKMEDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +   DLP  A NYI++IEE+  VPV +
Sbjct: 360 SVLEVSPMAAEAFEKATPIYETMPGWSENTFGAKALEDLPQAALNYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|224586206|ref|YP_002640005.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|254788720|sp|C0Q6D4|PURA_SALPC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|224470734|gb|ACN48564.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 432

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGAQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|27364699|ref|NP_760227.1| adenylosuccinate synthetase [Vibrio vulnificus CMCP6]
 gi|29611801|sp|Q8DCU4|PURA_VIBVU RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|27360844|gb|AAO09754.1| adenylosuccinate synthetase [Vibrio vulnificus CMCP6]
          Length = 438

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 205/440 (46%), Positives = 278/440 (63%), Gaps = 12/440 (2%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M N VVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++ +   L L+PSG+
Sbjct: 1   MANNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGVKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   +IG+ VV+ P A I E++ L  +GI V    L I+    LIL  H  +D  RE
Sbjct: 61  LRDNVKCVIGNGVVLSPEALIKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++  HN    +F 
Sbjct: 120 IARGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEFHNFQLVNFY 177

Query: 180 EKE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + E V Y+ +LE+     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP
Sbjct: 178 KAEAVSYEEVLEQARGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFL 292
           +VTSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFP       E ++  G  L
Sbjct: 238 YVTSSNTTAGGVAAGSGFGPRYLGYILGIAKAYCTRVGAGPFPTELYDGQEKQDPVGKHL 297

Query: 293 KEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM- 351
             VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL ELKIC GY+M 
Sbjct: 298 GTVGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLKELKICTGYQME 357

Query: 352 DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPV 411
           DG  ++  P  +    +  P+Y  + GW ++T G +   DLP  A NYI++IEE+  VPV
Sbjct: 358 DGSVLEVSPMAAEAFEKVTPIYETMPGWSENTFGAKSLEDLPQAAINYIKRIEELTGVPV 417

Query: 412 ALLSIGPERENTLIMSNPFE 431
            ++S GP+R  T++  +PFE
Sbjct: 418 DIISTGPDRNETIVKVHPFE 437


>gi|84516437|ref|ZP_01003796.1| adenylosuccinate synthetase [Loktanella vestfoldensis SKA53]
 gi|84509473|gb|EAQ05931.1| adenylosuccinate synthetase [Loktanella vestfoldensis SKA53]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 306/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EI  L  QG+ +TP+ L +A N  LIL  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLIKEIGILRDQGVTITPDTLMVAENTPLILPFHGELDRARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             +   A IGTT RGIGP YED+VGRR IRV DL D   +  ++++ L HH+ALRR  G 
Sbjct: 120 -ANVGMAKIGTTGRGIGPCYEDKVGRRVIRVADLADDATLELRLDRALAHHDALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    IL +L     ++L +   +W +L  + + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 DPIDRAAILADLRAIAPQVLAYAAPVWKVLNEQRKAGKRILFEGAQGALLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ +VLG+VKAYTTRVG GPFPTEL +  G+ L + G EFG
Sbjct: 239 TSSNVIAGQAATGVGMGPGAIDFVLGIVKAYTTRVGEGPFPTELHDADGERLGQRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   +R++   +G+ GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 299 TVTGRKRRCGWFDACLLRQTCATSGINGIALTKLDVLDGFEVLKICVGYDLDGVRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  +EGW QST G R +ADLP QA  Y+R+IEE+++ PVAL+S  PER
Sbjct: 359 TAADQQARCTPIYEEIEGWSQSTMGARSWADLPAQAIKYVRRIEELIDCPVALVSTSPER 418

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 419 EDTILVTDPFAD 430


>gi|192973068|gb|ACF06967.1| adenylosuccinate synthase [uncultured Roseobacter sp.]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 306/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL + + VYKL  LPSGVV
Sbjct: 1   MANVVVVGTQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIGEAVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   I EIE +  QG+ + P NL +A N  LI+  H +LD  REG
Sbjct: 61  RGGKLSVIGNGVVLDPWHLIKEIEGIRSQGVEINPKNLMVAENTPLIMPYHGELDRAREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGP YED+VGRR IRV DL D   +  ++++ LLHHN LR+  G 
Sbjct: 121 --QVSVAKIGTTGRGIGPCYEDKVGRRVIRVADLADTATLELRVDRALLHHNPLRKGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    +L +L    ++ILP+   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 EPVDRARLLAQLRDIADQILPYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++ YVLG+ KAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGAIDYVLGITKAYTTRVGEGPFPTELDDADGQQLGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++   +GV GI+LTKLDVLDG DELKICV Y +DG+ +D+LP
Sbjct: 299 TTTGRKRRCGWFDACLVRQTCATSGVNGISLTKLDVLDGFDELKICVAYDLDGQRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  +EGW  STAG R +A+LP QA  Y+R+IEE++E PVAL+S  PER
Sbjct: 359 TAADAQARVTPIYETIEGWSGSTAGARSWAELPAQAIKYVRRIEELIECPVALVSTSPER 418

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 419 EDTILVTDPFAD 430


>gi|170723838|ref|YP_001751526.1| adenylosuccinate synthetase [Pseudomonas putida W619]
 gi|229576745|sp|B1JAI0|PURA_PSEPW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|169761841|gb|ACA75157.1| Adenylosuccinate synthase [Pseudomonas putida W619]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 210/430 (48%), Positives = 280/430 (65%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+  A LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALMREITKLEEKGVPVR-ERLRISPAAPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    ++ ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E++ P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQQTLDECMAYAEQLKPMMLDVTAELHNLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   S GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++TG  L + G EFG
Sbjct: 240 TSSNTTAGGISTGSGVGPMYLDYILGITKAYTTRVGSGPFPTELFDETGATLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           + T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + ICVGY+ +   V   P
Sbjct: 300 STTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICVGYKNENGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G +   +LP  AR YI++IEE+   P+ ++S GP+R
Sbjct: 360 SDADSYIGLEPVYEEMPGWSESTLGAKTLEELPAAARAYIKRIEELTGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|26991567|ref|NP_746992.1| adenylosuccinate synthetase [Pseudomonas putida KT2440]
 gi|148549967|ref|YP_001270069.1| adenylosuccinate synthetase [Pseudomonas putida F1]
 gi|167035930|ref|YP_001671161.1| adenylosuccinate synthetase [Pseudomonas putida GB-1]
 gi|37999612|sp|Q88DD8|PURA_PSEPK RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|166232488|sp|A5W9S5|PURA_PSEP1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|189038349|sp|B0KKZ0|PURA_PSEPG RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|24986654|gb|AAN70456.1|AE016687_3 adenylosuccinate synthetase [Pseudomonas putida KT2440]
 gi|148514025|gb|ABQ80885.1| Adenylosuccinate synthetase [Pseudomonas putida F1]
 gi|166862418|gb|ABZ00826.1| Adenylosuccinate synthase [Pseudomonas putida GB-1]
 gi|313500868|gb|ADR62234.1| PurA [Pseudomonas putida BIRD-1]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 210/430 (48%), Positives = 283/430 (65%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+  A LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALMREITKLEEKGVPVR-ERLRISPAAPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    ++ ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E++ P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQQTLDECMAYAEQLKPMMLDVTAELHNLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   S GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++TG  L + G EFG
Sbjct: 240 TSSNTTAGGISTGSGVGPMYLDYILGITKAYTTRVGSGPFPTELFDETGATLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           + T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + ICVGY+ +   V   P
Sbjct: 300 STTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICVGYKNENGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G++   +LP  AR+YI++IEE++  P+ ++S GP+R
Sbjct: 360 SDADSYIGLEPVYEEMPGWSESTLGVKTLEELPQAARDYIKRIEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|99081809|ref|YP_613963.1| adenylosuccinate synthetase [Ruegeria sp. TM1040]
 gi|123252269|sp|Q1GF65|PURA_SILST RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|99038089|gb|ABF64701.1| Adenylosuccinate synthetase [Ruegeria sp. TM1040]
          Length = 437

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 236/438 (53%), Positives = 305/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDKKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LI+  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIETVRAQGVEITPETLMIAENTPLIMPFHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADDATLEARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    ++ +L     +ILPF   +W ++  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPIDRDALVAQLKEIASEILPFAAPVWKVMNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI P S+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQAATGVGIGPNSIDYVLGIVKAYTTRVGEGPFPTELLGADGKPDADGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGINGISLTKLDVLDGFETLKICVGYELDGE 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R +P+Y  +EGW +ST G R +A+LP  A  Y+R++EE+++ PVALL
Sbjct: 360 RLDYLPTAADQQARCKPIYEEMEGWSESTEGARSWAELPANAIKYVRRVEELIQCPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|118444000|ref|YP_877010.1| adenylosuccinate synthetase [Clostridium novyi NT]
 gi|166232444|sp|A0PXA8|PURA_CLONN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|118134456|gb|ABK61500.1| adenylosuccinate synthetase [Clostridium novyi NT]
          Length = 427

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 279/426 (65%), Gaps = 2/426 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E ADV+VRFQGGNNAGHT+ V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAETADVVVRFQGGNNAGHTVVVGDKEYKLHLVPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK++++G+ VV+DP A   EI  L   G+ VT   L++++ A LI+  HR LD L+E 
Sbjct: 61  YEDKINVLGNGVVIDPKALFEEINYLEDLGVKVTKEKLKVSDRAQLIMPYHRILDGLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IRV DL   +   +K+ Q +   N L R +G 
Sbjct: 121 ARGKND--IGTTGKGIGPAYTDKAERSGIRVCDLMHKDVFEEKLRQNINDKNELIRLYGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  I EE     +++ P++  I  ++  E +K  ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELDFDKIFEEYNAYADRMRPYVTDISVIIYDEMKKNKNVLFEGAQGSLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T++     G+G+ P ++   +G+ KAYTTRVG GPFPTEL ++ G+ L+E G E+G
Sbjct: 239 TSSSTVAGGVCTGAGVGPTAITGAVGIAKAYTTRVGKGPFPTELLDEMGEKLREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  I+G+    +TK+D L G D++K+C GY  DG+ +D+ P
Sbjct: 299 VTTGRARRCGWLDLVILKSTARISGLTSFVVTKIDTLAGFDKIKVCTGYEFDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + +PVY   +GW  S A  R + +LP  A+ Y++KIEE  +  ++++S+GP+R
Sbjct: 359 ASLEDLAKCKPVYEEFDGWDDSIADARSYEELPENAKIYLKKIEEFTDTKISIVSVGPKR 418

Query: 421 ENTLIM 426
           + T+++
Sbjct: 419 DQTIVV 424


>gi|157147853|ref|YP_001455172.1| adenylosuccinate synthetase [Citrobacter koseri ATCC BAA-895]
 gi|166232440|sp|A8AMM3|PURA_CITK8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|157085058|gb|ABV14736.1| hypothetical protein CKO_03657 [Citrobacter koseri ATCC BAA-895]
          Length = 432

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAVKLKEVMEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTSMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL + TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDDTGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL+E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDSVAVRRAVQINSLSGFCLTKLDVLDGLEEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWEGIEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|284924359|emb|CBG37475.1| adenylosuccinate synthetase [Escherichia coli 042]
          Length = 432

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL + TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDDTGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|194444239|ref|YP_002043621.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194451596|ref|YP_002048409.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471267|ref|ZP_03077251.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|238910524|ref|ZP_04654361.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|229576750|sp|B4T2S2|PURA_SALNS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576751|sp|B4TFB1|PURA_SALHS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|194402902|gb|ACF63124.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409900|gb|ACF70119.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457631|gb|EDX46470.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
          Length = 432

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|307140871|ref|ZP_07500227.1| adenylosuccinate synthetase [Escherichia coli H736]
 gi|331644924|ref|ZP_08346041.1| adenylosuccinate synthase [Escherichia coli H736]
 gi|331035899|gb|EGI08137.1| adenylosuccinate synthase [Escherichia coli H736]
 gi|332346254|gb|AEE59588.1| adenylosuccinate synthetase PurA [Escherichia coli UMNK88]
          Length = 432

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN  L   +  
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYNA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|119383355|ref|YP_914411.1| adenylosuccinate synthetase [Paracoccus denitrificans PD1222]
 gi|166232480|sp|A1AZM1|PURA_PARDP RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|119373122|gb|ABL68715.1| Adenylosuccinate synthetase [Paracoccus denitrificans PD1222]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 241/432 (55%), Positives = 312/432 (72%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL + + V+KLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIGNQVFKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  KM++IG+ VV+DP +  +EI+ L+ QG+ ++P NL IA N  LIL +H+DLD LRE 
Sbjct: 61  RKGKMAVIGNGVVLDPWSLFAEIDKLSAQGVEISPANLMIAENTPLILPLHQDLDKLREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     + IGTT RGIGPAYED+VGRR IRV DL D E +  ++++LL HH+ALR+  G 
Sbjct: 121 AA--GASKIGTTGRGIGPAYEDKVGRRTIRVADLGDEETLDSRLDRLLAHHDALRQGLGA 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    +  +L+    K+L +   +W ++    + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 APIDRAELRAKLLEIAPKLLQYAQPVWKVMNDYRKAGKRILFEGAQGSLLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS TMS  A+ G+G+ P ++G+VLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 239 TSSTTMSGMAASGTGLGPSAIGFVLGIVKAYTTRVGEGPFPTELDDADGQRLGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++  I+GV GIALTKLDVLDG   LKIC GY +DG+  D LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCAISGVDGIALTKLDVLDGFQTLKICTGYEVDGQHYDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    + +PVY  +EGW++ST G R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 359 TAASLQAKAKPVYEEMEGWQESTQGARSWADLPANAIKYVRRIEELIQCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 419 DDTILVTDPFAD 430


>gi|168464750|ref|ZP_02698653.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197248166|ref|YP_002149280.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|226709086|sp|B5F392|PURA_SALA4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|195632661|gb|EDX51115.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197211869|gb|ACH49266.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|269961406|ref|ZP_06175770.1| adenylosuccinate synthetase [Vibrio harveyi 1DA3]
 gi|269833783|gb|EEZ87878.1| adenylosuccinate synthetase [Vibrio harveyi 1DA3]
          Length = 438

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 201/438 (45%), Positives = 280/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A I E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALIKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++ +HN    +F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEYHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEEVLEQAKGYADLLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L E
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGIAKAYCTRVGAGPFPTELYDGLDKQDPVGKHLGE 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLEELKICTGYKMEDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +   +LP  A +YI++IEE+  VPV +
Sbjct: 360 STLEVSPMAAEAFEKATPIYETMPGWSENTFGAKSIEELPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|157831578|pdb|1JUY|A Chain A, Refined Crystal Structure Of Adenylosuccinate Synthetase
           From Escherichia Coli Complexed With Hydantocidin 5'-
           Phosphate Gdp, Hpo4(2-), Mg2+, And Hadacidin
 gi|157878231|pdb|1HON|A Chain A, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From Escherichia Coli At Ph
           6.5 And 25 Degree Celsius
 gi|157878232|pdb|1HON|B Chain B, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From Escherichia Coli At Ph
           6.5 And 25 Degree Celsius
 gi|157878235|pdb|1HOP|A Chain A, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From Escherichia Coli At Ph
           6.5 And 25 Degrees Celsius
 gi|157878236|pdb|1HOP|B Chain B, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From Escherichia Coli At Ph
           6.5 And 25 Degrees Celsius
          Length = 431

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|5542172|pdb|1CG0|A Chain A, Structure Of Adenylosuccinate Synthetase From E. Coli
           Complexed With Hadacidin, Gdp, 6-Phosphoryl-Imp, And
           Mg2+
 gi|6730168|pdb|1CH8|A Chain A, Structure Of Adenylosuccinate Synthetase From E. Coli
           Complexed With A Stringent Effector, Ppg2':3'p
 gi|6730453|pdb|1QF4|A Chain A, Design, Synthesis, And X-Ray Crystal Structure Of An
           Enzyme Bound Bisubstrate Hybrid Inhibitor Of
           Adenylosuccinate Synthetase
 gi|6730454|pdb|1QF5|A Chain A, Design, Synthesis, And X-Ray Crystal Structure Of An
           Enzyme Bound Bisubstrate Hybrid Inhibitor Of
           Adenylosuccinate Synthetase
 gi|7546190|pdb|1CIB|A Chain A, Structure Of Adenylosuccinate Synthetase From E. Coli
           Complexed With Gdp, Imp, Hadacidin, And No3
 gi|146386796|pdb|2GCQ|A Chain A, Fully Ligated E.Coli Adenylosuccinate Synthetase With Gtp,
           2'-Deoxy- Imp And Hadacidin
 gi|157833840|pdb|1SON|A Chain A, Adenylosuccinate Synthetase In Complex With The Natural
           Feedback Inhibitor Amp
 gi|157833841|pdb|1SOO|A Chain A, Adenylosuccinate Synthetase Inhibited By Hydantocidin 5'-
           Monophosphate
 gi|253722047|pdb|1ADE|A Chain A, Structure Of Adenylosuccinate Synthetase Ph 7 At 25
           Degrees Celsius
 gi|253722048|pdb|1ADE|B Chain B, Structure Of Adenylosuccinate Synthetase Ph 7 At 25
           Degrees Celsius
 gi|253722049|pdb|1ADI|A Chain A, Structure Of Adenylosuccinate Synthetase At Ph 6.5 And 25
           Degrees Celsius
 gi|253722050|pdb|1ADI|B Chain B, Structure Of Adenylosuccinate Synthetase At Ph 6.5 And 25
           Degrees Celsius
 gi|306992156|pdb|1HOO|A Chain A, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From E. Coli At Ph 6.5 And
           25 Degrees Celsius
 gi|306992157|pdb|1HOO|B Chain B, Structure Of Guanine Nucleotide (Gppcp) Complex Of
           Adenylosuccinate Synthetase From E. Coli At Ph 6.5 And
           25 Degrees Celsius
 gi|310690002|pdb|1GIM|A Chain A, Crystal Structure Of Adenylosuccinate Synthetase From
           Escherichia Coli Complexed With Gdp, Imp, Hadacidin,
           No3-, And Mg2+. Data Collected At 100k (Ph 6.5)
 gi|310690003|pdb|1GIN|A Chain A, Crystal Structure Of Adenylosuccinate Synthetase From
           Escherichia Coli Complexed With Gdp, Imp, Hadacidin,
           No3-, And Mg2+. Data Collected At 298k (Ph 6.5).
 gi|310690004|pdb|1KSZ|A Chain A, Entrapment Of 6-Thiophosphoryl-Imp In The Active Site Of
           Crystalline Adenylosuccinate Synthetase From Escherichia
           Coli, Data Collected At 298k
 gi|310690005|pdb|1NHT|A Chain A, Entrapment Of 6-Thiophosphoryl-Imp In The Active Site Of
           Crystalline Adenylosuccinate Synthetase From Escherichia
           Coli Data Collected At 100k
          Length = 431

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|15834407|ref|NP_313180.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|16131999|ref|NP_418598.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|26251069|ref|NP_757109.1| adenylosuccinate synthetase [Escherichia coli CFT073]
 gi|82546582|ref|YP_410529.1| adenylosuccinate synthetase [Shigella boydii Sb227]
 gi|82779441|ref|YP_405790.1| adenylosuccinate synthetase [Shigella dysenteriae Sd197]
 gi|89110897|ref|AP_004677.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           W3110]
 gi|91213726|ref|YP_543712.1| adenylosuccinate synthetase [Escherichia coli UTI89]
 gi|110644534|ref|YP_672264.1| adenylosuccinate synthetase [Escherichia coli 536]
 gi|117626523|ref|YP_859846.1| adenylosuccinate synthetase [Escherichia coli APEC O1]
 gi|157159156|ref|YP_001465676.1| adenylosuccinate synthetase [Escherichia coli E24377A]
 gi|157163641|ref|YP_001460959.1| adenylosuccinate synthetase [Escherichia coli HS]
 gi|168751472|ref|ZP_02776494.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|168754747|ref|ZP_02779754.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|168760418|ref|ZP_02785425.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|168766455|ref|ZP_02791462.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|168774111|ref|ZP_02799118.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|168780608|ref|ZP_02805615.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|168784813|ref|ZP_02809820.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC869]
 gi|168801831|ref|ZP_02826838.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC508]
 gi|170021813|ref|YP_001726767.1| adenylosuccinate synthetase [Escherichia coli ATCC 8739]
 gi|170083623|ref|YP_001732943.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170679879|ref|YP_001746572.1| adenylosuccinate synthetase [Escherichia coli SMS-3-5]
 gi|187732758|ref|YP_001882868.1| adenylosuccinate synthetase [Shigella boydii CDC 3083-94]
 gi|188493594|ref|ZP_03000864.1| adenylosuccinate synthetase [Escherichia coli 53638]
 gi|191165603|ref|ZP_03027443.1| adenylosuccinate synthetase [Escherichia coli B7A]
 gi|191170704|ref|ZP_03032256.1| adenylosuccinate synthetase [Escherichia coli F11]
 gi|191174516|ref|ZP_03036014.1| adenylosuccinate synthetase [Escherichia coli F11]
 gi|193066038|ref|ZP_03047096.1| adenylosuccinate synthetase [Escherichia coli E22]
 gi|193070888|ref|ZP_03051820.1| adenylosuccinate synthetase [Escherichia coli E110019]
 gi|194426556|ref|ZP_03059110.1| adenylosuccinate synthetase [Escherichia coli B171]
 gi|194434589|ref|ZP_03066846.1| adenylosuccinate synthetase [Shigella dysenteriae 1012]
 gi|194439518|ref|ZP_03071592.1| adenylosuccinate synthetase [Escherichia coli 101-1]
 gi|195935967|ref|ZP_03081349.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208809439|ref|ZP_03251776.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208813357|ref|ZP_03254686.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208819801|ref|ZP_03260121.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209399548|ref|YP_002273719.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209921665|ref|YP_002295749.1| adenylosuccinate synthetase [Escherichia coli SE11]
 gi|215489521|ref|YP_002331952.1| adenylosuccinate synthetase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324475|ref|ZP_03440559.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218551447|ref|YP_002385239.1| adenylosuccinate synthetase [Escherichia fergusonii ATCC 35469]
 gi|218556729|ref|YP_002389643.1| adenylosuccinate synthetase [Escherichia coli IAI1]
 gi|218561336|ref|YP_002394249.1| adenylosuccinate synthetase [Escherichia coli S88]
 gi|218692511|ref|YP_002400723.1| adenylosuccinate synthetase [Escherichia coli ED1a]
 gi|218697926|ref|YP_002405593.1| adenylosuccinate synthetase [Escherichia coli 55989]
 gi|218702874|ref|YP_002410503.1| adenylosuccinate synthetase [Escherichia coli IAI39]
 gi|218707788|ref|YP_002415307.1| adenylosuccinate synthetase [Escherichia coli UMN026]
 gi|227886780|ref|ZP_04004585.1| adenylosuccinate synthetase [Escherichia coli 83972]
 gi|237703844|ref|ZP_04534325.1| adenylosuccinate synthetase [Escherichia sp. 3_2_53FAA]
 gi|238903284|ref|YP_002929080.1| adenylosuccinate synthetase [Escherichia coli BW2952]
 gi|253775198|ref|YP_003038029.1| adenylosuccinate synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254037191|ref|ZP_04871268.1| adenylosuccinate synthetase [Escherichia sp. 1_1_43]
 gi|254164106|ref|YP_003047214.1| adenylosuccinate synthetase [Escherichia coli B str. REL606]
 gi|254796196|ref|YP_003081033.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|256019822|ref|ZP_05433687.1| adenylosuccinate synthetase [Shigella sp. D9]
 gi|256025112|ref|ZP_05438977.1| adenylosuccinate synthetase [Escherichia sp. 4_1_40B]
 gi|260847007|ref|YP_003224785.1| adenylosuccinate synthetase PurA [Escherichia coli O103:H2 str.
           12009]
 gi|260858330|ref|YP_003232221.1| adenylosuccinate synthetase PurA [Escherichia coli O26:H11 str.
           11368]
 gi|260870915|ref|YP_003237317.1| adenylosuccinate synthetase PurA [Escherichia coli O111:H- str.
           11128]
 gi|261225297|ref|ZP_05939578.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255451|ref|ZP_05947984.1| adenylosuccinate synthetase PurA [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285589|ref|YP_003502407.1| adenylosuccinate synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|293402804|ref|ZP_06646901.1| adenylosuccinate synthetase [Escherichia coli FVEC1412]
 gi|293407904|ref|ZP_06651744.1| adenylosuccinate synthetase [Escherichia coli B354]
 gi|293476488|ref|ZP_06664896.1| adenylosuccinate synthetase [Escherichia coli B088]
 gi|297517579|ref|ZP_06935965.1| adenylosuccinate synthetase [Escherichia coli OP50]
 gi|298378334|ref|ZP_06988218.1| adenylosuccinate synthetase [Escherichia coli FVEC1302]
 gi|300816523|ref|ZP_07096744.1| adenylosuccinate synthetase [Escherichia coli MS 107-1]
 gi|300821268|ref|ZP_07101416.1| adenylosuccinate synthetase [Escherichia coli MS 119-7]
 gi|300899715|ref|ZP_07117941.1| adenylosuccinate synthetase [Escherichia coli MS 198-1]
 gi|300906006|ref|ZP_07123730.1| adenylosuccinate synthetase [Escherichia coli MS 84-1]
 gi|300920799|ref|ZP_07137200.1| adenylosuccinate synthetase [Escherichia coli MS 115-1]
 gi|300922417|ref|ZP_07138537.1| adenylosuccinate synthetase [Escherichia coli MS 182-1]
 gi|300929284|ref|ZP_07144760.1| adenylosuccinate synthetase [Escherichia coli MS 187-1]
 gi|300940664|ref|ZP_07155225.1| adenylosuccinate synthetase [Escherichia coli MS 21-1]
 gi|300949136|ref|ZP_07163178.1| adenylosuccinate synthetase [Escherichia coli MS 116-1]
 gi|300957836|ref|ZP_07170014.1| adenylosuccinate synthetase [Escherichia coli MS 175-1]
 gi|300987258|ref|ZP_07178087.1| adenylosuccinate synthetase [Escherichia coli MS 45-1]
 gi|300988646|ref|ZP_07178786.1| adenylosuccinate synthetase [Escherichia coli MS 200-1]
 gi|301023425|ref|ZP_07187208.1| adenylosuccinate synthetase [Escherichia coli MS 69-1]
 gi|301027999|ref|ZP_07191283.1| adenylosuccinate synthetase [Escherichia coli MS 196-1]
 gi|301045951|ref|ZP_07193135.1| adenylosuccinate synthetase [Escherichia coli MS 185-1]
 gi|301302593|ref|ZP_07208723.1| adenylosuccinate synthetase [Escherichia coli MS 124-1]
 gi|301325940|ref|ZP_07219361.1| adenylosuccinate synthetase [Escherichia coli MS 78-1]
 gi|301646622|ref|ZP_07246488.1| adenylosuccinate synthetase [Escherichia coli MS 146-1]
 gi|306815608|ref|ZP_07449757.1| adenylosuccinate synthetase [Escherichia coli NC101]
 gi|307314875|ref|ZP_07594467.1| adenylosuccinate synthetase [Escherichia coli W]
 gi|309787681|ref|ZP_07682292.1| adenylosuccinate synthetase [Shigella dysenteriae 1617]
 gi|309796988|ref|ZP_07691388.1| adenylosuccinate synthetase [Escherichia coli MS 145-7]
 gi|312974015|ref|ZP_07788186.1| adenylosuccinate synthetase [Escherichia coli 1827-70]
 gi|331650302|ref|ZP_08351374.1| adenylosuccinate synthase [Escherichia coli M605]
 gi|331656005|ref|ZP_08356993.1| adenylosuccinate synthase [Escherichia coli M718]
 gi|331660752|ref|ZP_08361684.1| adenylosuccinate synthase [Escherichia coli TA206]
 gi|331665841|ref|ZP_08366735.1| adenylosuccinate synthase [Escherichia coli TA143]
 gi|331671082|ref|ZP_08371915.1| adenylosuccinate synthase [Escherichia coli TA271]
 gi|331671326|ref|ZP_08372124.1| adenylosuccinate synthase [Escherichia coli TA280]
 gi|331680307|ref|ZP_08380966.1| adenylosuccinate synthase [Escherichia coli H591]
 gi|331681196|ref|ZP_08381833.1| adenylosuccinate synthase [Escherichia coli H299]
 gi|332280961|ref|ZP_08393374.1| adenylosuccinate synthetase [Shigella sp. D9]
 gi|67471590|sp|P0A7D4|PURA_ECOLI RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|67471591|sp|P0A7D5|PURA_ECOL6 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|67471592|sp|P0A7D6|PURA_ECO57 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|90101722|sp|Q31TA7|PURA_SHIBS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|90101723|sp|Q328F6|PURA_SHIDS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122421468|sp|Q1R383|PURA_ECOUT RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|123048575|sp|Q0T9L6|PURA_ECOL5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|166232449|sp|A1AJ82|PURA_ECOK1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|167011938|sp|A7ZV47|PURA_ECO24 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|167011939|sp|A8A7S2|PURA_ECOHS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|189038302|sp|B1IT29|PURA_ECOLC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226709078|sp|B5Z2I3|PURA_ECO5E RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226709079|sp|B6I281|PURA_ECOSE RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724586|sp|B7MKY1|PURA_ECO45 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724587|sp|B7NTN3|PURA_ECO7I RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724588|sp|B7M8T7|PURA_ECO8A RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724589|sp|B7NGB1|PURA_ECOLU RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724590|sp|B1LQJ7|PURA_ECOSM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226724591|sp|B7LLV9|PURA_ESCF3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576706|sp|B1XDS8|PURA_ECODH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576746|sp|B2TY52|PURA_SHIB3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254788704|sp|B7UQI6|PURA_ECO27 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254788705|sp|B7LC36|PURA_ECO55 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254788706|sp|B7MSJ5|PURA_ECO81 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|259547032|sp|C4ZR54|PURA_ECOBW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|20150868|pdb|1KJX|A Chain A, Imp Complex Of E. Coli Adenylosuccinate Synthetase
 gi|20150884|pdb|1KKB|A Chain A, Complex Of Escherichia Coli Adenylosuccinate Synthetase
           With Imp And Hadacidin
 gi|20150885|pdb|1KKF|A Chain A, Complex Of E. Coli Adenylosuccinate Synthetase With Imp,
           Hadacidin, Pyrophosphate, And Mg
 gi|26111501|gb|AAN83683.1|AE016771_194 Adenylosuccinate synthetase [Escherichia coli CFT073]
 gi|537018|gb|AAA97073.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1790620|gb|AAC77134.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13364630|dbj|BAB38576.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|81243589|gb|ABB64299.1| adenylosuccinate synthetase [Shigella dysenteriae Sd197]
 gi|81247993|gb|ABB68701.1| adenylosuccinate synthetase [Shigella boydii Sb227]
 gi|85676928|dbj|BAE78178.1| adenylosuccinate synthetase [Escherichia coli str. K12 substr.
           W3110]
 gi|91075300|gb|ABE10181.1| PurA, subunit of adenylosuccinate synthase [Escherichia coli UTI89]
 gi|110346126|gb|ABG72363.1| adenylosuccinate synthetase [Escherichia coli 536]
 gi|115515647|gb|ABJ03722.1| adenylosuccinate synthetase [Escherichia coli APEC O1]
 gi|157069321|gb|ABV08576.1| adenylosuccinate synthetase [Escherichia coli HS]
 gi|157081186|gb|ABV20894.1| adenylosuccinate synthetase [Escherichia coli E24377A]
 gi|169756741|gb|ACA79440.1| Adenylosuccinate synthase [Escherichia coli ATCC 8739]
 gi|169891458|gb|ACB05165.1| adenylosuccinate synthetase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170517597|gb|ACB15775.1| adenylosuccinate synthetase [Escherichia coli SMS-3-5]
 gi|187429750|gb|ACD09024.1| adenylosuccinate synthetase [Shigella boydii CDC 3083-94]
 gi|187770332|gb|EDU34176.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|188014493|gb|EDU52615.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|188488793|gb|EDU63896.1| adenylosuccinate synthetase [Escherichia coli 53638]
 gi|189001718|gb|EDU70704.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|189357871|gb|EDU76290.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|189364050|gb|EDU82469.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|189368933|gb|EDU87349.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|189374841|gb|EDU93257.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC869]
 gi|189376057|gb|EDU94473.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC508]
 gi|190904298|gb|EDV64007.1| adenylosuccinate synthetase [Escherichia coli B7A]
 gi|190905196|gb|EDV64837.1| adenylosuccinate synthetase [Escherichia coli F11]
 gi|190908928|gb|EDV68515.1| adenylosuccinate synthetase [Escherichia coli F11]
 gi|192926361|gb|EDV80997.1| adenylosuccinate synthetase [Escherichia coli E22]
 gi|192955834|gb|EDV86305.1| adenylosuccinate synthetase [Escherichia coli E110019]
 gi|194415295|gb|EDX31563.1| adenylosuccinate synthetase [Escherichia coli B171]
 gi|194417174|gb|EDX33286.1| adenylosuccinate synthetase [Shigella dysenteriae 1012]
 gi|194421517|gb|EDX37530.1| adenylosuccinate synthetase [Escherichia coli 101-1]
 gi|208729240|gb|EDZ78841.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208734634|gb|EDZ83321.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208739924|gb|EDZ87606.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209160948|gb|ACI38381.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209750228|gb|ACI73421.1| adenylosuccinate synthetase [Escherichia coli]
 gi|209750230|gb|ACI73422.1| adenylosuccinate synthetase [Escherichia coli]
 gi|209750232|gb|ACI73423.1| adenylosuccinate synthetase [Escherichia coli]
 gi|209750234|gb|ACI73424.1| adenylosuccinate synthetase [Escherichia coli]
 gi|209750236|gb|ACI73425.1| adenylosuccinate synthetase [Escherichia coli]
 gi|209914924|dbj|BAG79998.1| adenylosuccinate synthase [Escherichia coli SE11]
 gi|215267593|emb|CAS12048.1| adenylosuccinate synthetase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320696|gb|EEC29120.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218354658|emb|CAV01653.1| adenylosuccinate synthetase [Escherichia coli 55989]
 gi|218358989|emb|CAQ91649.1| adenylosuccinate synthetase [Escherichia fergusonii ATCC 35469]
 gi|218363498|emb|CAR01152.1| adenylosuccinate synthetase [Escherichia coli IAI1]
 gi|218368105|emb|CAR05912.1| adenylosuccinate synthetase [Escherichia coli S88]
 gi|218372860|emb|CAR20740.1| adenylosuccinate synthetase [Escherichia coli IAI39]
 gi|218430075|emb|CAR10920.1| adenylosuccinate synthetase [Escherichia coli ED1a]
 gi|218434885|emb|CAR15823.1| adenylosuccinate synthetase [Escherichia coli UMN026]
 gi|222035947|emb|CAP78692.1| adenylosuccinate synthetase [Escherichia coli LF82]
 gi|226840297|gb|EEH72299.1| adenylosuccinate synthetase [Escherichia sp. 1_1_43]
 gi|226901756|gb|EEH88015.1| adenylosuccinate synthetase [Escherichia sp. 3_2_53FAA]
 gi|227836353|gb|EEJ46819.1| adenylosuccinate synthetase [Escherichia coli 83972]
 gi|238859936|gb|ACR61934.1| adenylosuccinate synthetase [Escherichia coli BW2952]
 gi|242379699|emb|CAQ34523.1| adenylosuccinate synthetase [Escherichia coli BL21(DE3)]
 gi|253326242|gb|ACT30844.1| adenylosuccinate synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253976007|gb|ACT41678.1| adenylosuccinate synthetase [Escherichia coli B str. REL606]
 gi|253980163|gb|ACT45833.1| adenylosuccinate synthetase [Escherichia coli BL21(DE3)]
 gi|254595596|gb|ACT74957.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|257756979|dbj|BAI28481.1| adenylosuccinate synthetase PurA [Escherichia coli O26:H11 str.
           11368]
 gi|257762154|dbj|BAI33651.1| adenylosuccinate synthetase PurA [Escherichia coli O103:H2 str.
           12009]
 gi|257767271|dbj|BAI38766.1| adenylosuccinate synthetase PurA [Escherichia coli O111:H- str.
           11128]
 gi|260450996|gb|ACX41418.1| Adenylosuccinate synthase [Escherichia coli DH1]
 gi|290765462|gb|ADD59423.1| Adenylosuccinate synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|291320941|gb|EFE60383.1| adenylosuccinate synthetase [Escherichia coli B088]
 gi|291429719|gb|EFF02733.1| adenylosuccinate synthetase [Escherichia coli FVEC1412]
 gi|291472155|gb|EFF14637.1| adenylosuccinate synthetase [Escherichia coli B354]
 gi|294490476|gb|ADE89232.1| adenylosuccinate synthetase [Escherichia coli IHE3034]
 gi|298280668|gb|EFI22169.1| adenylosuccinate synthetase [Escherichia coli FVEC1302]
 gi|299878909|gb|EFI87120.1| adenylosuccinate synthetase [Escherichia coli MS 196-1]
 gi|300302034|gb|EFJ58419.1| adenylosuccinate synthetase [Escherichia coli MS 185-1]
 gi|300305879|gb|EFJ60399.1| adenylosuccinate synthetase [Escherichia coli MS 200-1]
 gi|300315467|gb|EFJ65251.1| adenylosuccinate synthetase [Escherichia coli MS 175-1]
 gi|300356726|gb|EFJ72596.1| adenylosuccinate synthetase [Escherichia coli MS 198-1]
 gi|300397012|gb|EFJ80550.1| adenylosuccinate synthetase [Escherichia coli MS 69-1]
 gi|300402173|gb|EFJ85711.1| adenylosuccinate synthetase [Escherichia coli MS 84-1]
 gi|300407735|gb|EFJ91273.1| adenylosuccinate synthetase [Escherichia coli MS 45-1]
 gi|300412222|gb|EFJ95532.1| adenylosuccinate synthetase [Escherichia coli MS 115-1]
 gi|300421236|gb|EFK04547.1| adenylosuccinate synthetase [Escherichia coli MS 182-1]
 gi|300451384|gb|EFK15004.1| adenylosuccinate synthetase [Escherichia coli MS 116-1]
 gi|300454552|gb|EFK18045.1| adenylosuccinate synthetase [Escherichia coli MS 21-1]
 gi|300462777|gb|EFK26270.1| adenylosuccinate synthetase [Escherichia coli MS 187-1]
 gi|300526157|gb|EFK47226.1| adenylosuccinate synthetase [Escherichia coli MS 119-7]
 gi|300530753|gb|EFK51815.1| adenylosuccinate synthetase [Escherichia coli MS 107-1]
 gi|300842118|gb|EFK69878.1| adenylosuccinate synthetase [Escherichia coli MS 124-1]
 gi|300847293|gb|EFK75053.1| adenylosuccinate synthetase [Escherichia coli MS 78-1]
 gi|301075169|gb|EFK89975.1| adenylosuccinate synthetase [Escherichia coli MS 146-1]
 gi|305851270|gb|EFM51725.1| adenylosuccinate synthetase [Escherichia coli NC101]
 gi|306905678|gb|EFN36207.1| adenylosuccinate synthetase [Escherichia coli W]
 gi|307556344|gb|ADN49119.1| PurA, subunit of adenylosuccinate synthase [Escherichia coli ABU
           83972]
 gi|308119401|gb|EFO56663.1| adenylosuccinate synthetase [Escherichia coli MS 145-7]
 gi|308924431|gb|EFP69927.1| adenylosuccinate synthetase [Shigella dysenteriae 1617]
 gi|309704682|emb|CBJ04032.1| adenylosuccinate synthetase [Escherichia coli ETEC H10407]
 gi|310331549|gb|EFP98805.1| adenylosuccinate synthetase [Escherichia coli 1827-70]
 gi|312948826|gb|ADR29653.1| adenylosuccinate synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315063491|gb|ADT77818.1| adenylosuccinate synthetase [Escherichia coli W]
 gi|315138731|dbj|BAJ45890.1| adenylosuccinate synthetase [Escherichia coli DH1]
 gi|315255521|gb|EFU35489.1| adenylosuccinate synthetase [Escherichia coli MS 85-1]
 gi|315288458|gb|EFU47856.1| adenylosuccinate synthetase [Escherichia coli MS 110-3]
 gi|315293541|gb|EFU52893.1| adenylosuccinate synthetase [Escherichia coli MS 153-1]
 gi|315299058|gb|EFU58312.1| adenylosuccinate synthetase [Escherichia coli MS 16-3]
 gi|320173669|gb|EFW48859.1| Adenylosuccinate synthetase [Shigella dysenteriae CDC 74-1112]
 gi|320180690|gb|EFW55617.1| Adenylosuccinate synthetase [Shigella boydii ATCC 9905]
 gi|320187055|gb|EFW61766.1| Adenylosuccinate synthetase [Shigella flexneri CDC 796-83]
 gi|320190691|gb|EFW65341.1| Adenylosuccinate synthetase [Escherichia coli O157:H7 str. EC1212]
 gi|320193557|gb|EFW68194.1| Adenylosuccinate synthetase [Escherichia coli WV_060327]
 gi|320200693|gb|EFW75279.1| Adenylosuccinate synthetase [Escherichia coli EC4100B]
 gi|320638935|gb|EFX08581.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320644304|gb|EFX13369.1| adenylosuccinate synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320649622|gb|EFX18146.1| adenylosuccinate synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320655018|gb|EFX22979.1| adenylosuccinate synthetase [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320660525|gb|EFX27986.1| adenylosuccinate synthetase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665794|gb|EFX32831.1| adenylosuccinate synthetase [Escherichia coli O157:H7 str. LSU-61]
 gi|323156006|gb|EFZ42168.1| adenylosuccinate synthetase [Escherichia coli EPECa14]
 gi|323161966|gb|EFZ47838.1| adenylosuccinate synthetase [Escherichia coli E128010]
 gi|323182283|gb|EFZ67693.1| adenylosuccinate synthetase [Escherichia coli 1357]
 gi|323189944|gb|EFZ75222.1| adenylosuccinate synthetase [Escherichia coli RN587/1]
 gi|323380430|gb|ADX52698.1| adenylosuccinate synthetase [Escherichia coli KO11]
 gi|323946025|gb|EGB42062.1| adenylosuccinate synthetase [Escherichia coli H120]
 gi|323950754|gb|EGB46632.1| adenylosuccinate synthetase [Escherichia coli H252]
 gi|323955464|gb|EGB51228.1| adenylosuccinate synthetase [Escherichia coli H263]
 gi|323960326|gb|EGB55966.1| adenylosuccinate synthetase [Escherichia coli H489]
 gi|323965563|gb|EGB61017.1| adenylosuccinate synthetase [Escherichia coli M863]
 gi|323970568|gb|EGB65827.1| adenylosuccinate synthetase [Escherichia coli TA007]
 gi|324005240|gb|EGB74459.1| adenylosuccinate synthetase [Escherichia coli MS 57-2]
 gi|324013819|gb|EGB83038.1| adenylosuccinate synthetase [Escherichia coli MS 60-1]
 gi|324019355|gb|EGB88574.1| adenylosuccinate synthetase [Escherichia coli MS 117-3]
 gi|324112226|gb|EGC06204.1| adenylosuccinate synthetase [Escherichia fergusonii B253]
 gi|324118742|gb|EGC12634.1| adenylosuccinate synthetase [Escherichia coli E1167]
 gi|325499712|gb|EGC97571.1| adenylosuccinate synthetase [Escherichia fergusonii ECD227]
 gi|326345491|gb|EGD69234.1| Adenylosuccinate synthetase [Escherichia coli O157:H7 str. 1125]
 gi|326346652|gb|EGD70386.1| Adenylosuccinate synthetase [Escherichia coli O157:H7 str. 1044]
 gi|327250117|gb|EGE61836.1| adenylosuccinate synthetase [Escherichia coli STEC_7v]
 gi|330908519|gb|EGH37038.1| adenylosuccinate synthetase [Escherichia coli AA86]
 gi|331040696|gb|EGI12854.1| adenylosuccinate synthase [Escherichia coli M605]
 gi|331046359|gb|EGI18449.1| adenylosuccinate synthase [Escherichia coli M718]
 gi|331051794|gb|EGI23833.1| adenylosuccinate synthase [Escherichia coli TA206]
 gi|331056892|gb|EGI28886.1| adenylosuccinate synthase [Escherichia coli TA143]
 gi|331061671|gb|EGI33597.1| adenylosuccinate synthase [Escherichia coli TA271]
 gi|331071171|gb|EGI42528.1| adenylosuccinate synthase [Escherichia coli TA280]
 gi|331071770|gb|EGI43106.1| adenylosuccinate synthase [Escherichia coli H591]
 gi|331081417|gb|EGI52578.1| adenylosuccinate synthase [Escherichia coli H299]
 gi|332083174|gb|EGI88405.1| adenylosuccinate synthetase [Shigella boydii 5216-82]
 gi|332083657|gb|EGI88875.1| adenylosuccinate synthetase [Shigella dysenteriae 155-74]
 gi|332087152|gb|EGI92286.1| adenylosuccinate synthetase [Shigella boydii 3594-74]
 gi|332103313|gb|EGJ06659.1| adenylosuccinate synthetase [Shigella sp. D9]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|85710752|ref|ZP_01041813.1| Adenylosuccinate synthase [Idiomarina baltica OS145]
 gi|85695156|gb|EAQ33093.1| Adenylosuccinate synthase [Idiomarina baltica OS145]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/433 (47%), Positives = 280/433 (64%), Gaps = 6/433 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVV++G QWGDEGKGKIVD L++ A ++VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSQNVVILGTQWGDEGKGKIVDLLTDKASLVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   +IG+ VV+ P A + E+E L  + + V    LRI+    LIL  H  LD  RE
Sbjct: 61  LRTNVQCVIGNGVVLSPEALMEEMEMLEARNVPV-KERLRISEACPLILPFHIALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSF 178
            AL      IGTT RGIGPAYED+V RR +RV DL +   +  K+++L   HN AL + +
Sbjct: 120 RALGK--EAIGTTGRGIGPAYEDKVARRGLRVGDLFNAARLEDKLKELTDFHNFALTKLY 177

Query: 179 GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
            E  + +  +L++     E + P +  + +LL++  + G  I+FEGAQG LLD DHGTYP
Sbjct: 178 DEPAIDFDAVLKQCREFAELLKPMVADVPALLDKARKSGEEIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + G+G  P  + YVLG+VKAYTTRVG GPFPTEL    G  L   G E
Sbjct: 238 YVTSSNTTAGGVATGAGFGPRYIDYVLGIVKAYTTRVGSGPFPTELDCDVGQHLGVKGHE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGLDELKIC  Y++ DG   +
Sbjct: 298 FGATTGRKRRTGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLDELKICTSYKLPDGTISE 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
           + P  +  +   EPVY  L GW++ST G+     LP QA  YI +IE +  VPV ++S G
Sbjct: 358 YPPMAAEDYEAVEPVYETLPGWQESTVGVTEHNQLPPQALAYISRIEALTGVPVDIISTG 417

Query: 418 PERENTLIMSNPF 430
           P+R+ T+I+ +PF
Sbjct: 418 PDRKETIILRHPF 430


>gi|261211158|ref|ZP_05925447.1| adenylosuccinate synthetase [Vibrio sp. RC341]
 gi|260839659|gb|EEX66270.1| adenylosuccinate synthetase [Vibrio sp. RC341]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALLKEMSGLEDRGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMASFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ GD L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P++  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIFETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|163733292|ref|ZP_02140735.1| adenylosuccinate synthetase [Roseobacter litoralis Och 149]
 gi|161393080|gb|EDQ17406.1| adenylosuccinate synthetase [Roseobacter litoralis Och 149]
          Length = 431

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 238/432 (55%), Positives = 306/432 (70%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP     EI+ +  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLTKEIDIIRGQGVDISPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADTATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L+     IL +   +W +L  + R G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPVDRDALVAQLIEIAPHILKYAAPVWKVLNEKRRAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PG++ YVLG+VKAYTTRVG GPFP EL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPGAIDYVLGIVKAYTTRVGEGPFPAELDDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAVLVRQTCATSGVNGIALTKLDVLDGFETLKICVGYELDGKRMDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             + +  R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADHQARCRPIYEEVPGWSESTEGARSWADLPANAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|119474816|ref|ZP_01615169.1| adenylosuccinate synthetase [marine gamma proteobacterium HTCC2143]
 gi|119451019|gb|EAW32252.1| adenylosuccinate synthetase [marine gamma proteobacterium HTCC2143]
          Length = 430

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 279/433 (64%), Gaps = 5/433 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVV++G QWGDEGKGKIVD L++ AD++ RFQGG+NAGHTL ++     L L+PSGV
Sbjct: 1   MSKNVVILGTQWGDEGKGKIVDLLTDQADLVARFQGGHNAGHTLVIDGEKTVLHLIPSGV 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R   + +IG+ VV+ P A + EI  L  +G+ V    LR++    LIL  H  LD  RE
Sbjct: 61  LREKVICLIGNGVVLSPEALLKEIAELEEKGVPVR-ERLRLSPACPLILPYHVALDHARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            AL      IGTT RGIGPAYED+V RR +RV DL   E  +KK+++++ +HN     + 
Sbjct: 120 LALGK--EKIGTTGRGIGPAYEDKVARRGVRVGDLLHPERFAKKLKEVMEYHNFQLTQYY 177

Query: 180 EKE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           +K+ + Y+T+L+E +   E+I P +  +  +L     +G +ILFEGAQG LLD DHGTYP
Sbjct: 178 KKDAIDYQTVLDETLEMAEQINPMIADVTCMLHDAREQGKNILFEGAQGSLLDVDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG+ P  L YVLG+ KAYTTRVG GPFPTEL ++ G  L E G E
Sbjct: 238 YVTSSNTTAGGTATGSGVGPLYLDYVLGITKAYTTRVGSGPFPTELFDEVGRHLAEKGHE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDF 358
           FG  T R RRCGW D  ++R++V IN + GI LTKLDVLDGL  +K+C  Y+        
Sbjct: 298 FGATTGRPRRCGWFDAVALRQAVRINSISGICLTKLDVLDGLASIKVCTSYQKPDGSPAP 357

Query: 359 LPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGP 418
           +P D+  +    PVY  + GW +ST G +    LP  A  YI ++EE++  P+ ++S GP
Sbjct: 358 MPSDADDYNHIVPVYEEISGWTESTLGAQSLDQLPAAALAYIARLEELVGAPIDIVSTGP 417

Query: 419 ERENTLIMSNPFE 431
           +R  T+++ + F+
Sbjct: 418 DRVETIVVRHAFD 430


>gi|156932408|ref|YP_001436324.1| adenylosuccinate synthetase [Cronobacter sakazakii ATCC BAA-894]
 gi|166232450|sp|A7MM94|PURA_ENTS8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|156530662|gb|ABU75488.1| hypothetical protein ESA_00187 [Cronobacter sakazakii ATCC BAA-894]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 213/432 (49%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  DNVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K++++L +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVLEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADVLTSMVVDVSDLLDQARKRGDFIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG++KAY+TRVG GPFPTEL +  G+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIIKAYSTRVGAGPFPTELFDDIGEFLCKKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL+E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLEEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEEV  VP+ ++S GP+
Sbjct: 360 PMAADDWEGIEPIYETMPGWSESTFGVKERSGLPQAALNYIKRIEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|24115532|ref|NP_710042.1| adenylosuccinate synthetase [Shigella flexneri 2a str. 301]
 gi|30065549|ref|NP_839720.1| adenylosuccinate synthetase [Shigella flexneri 2a str. 2457T]
 gi|110808095|ref|YP_691615.1| adenylosuccinate synthetase [Shigella flexneri 5 str. 8401]
 gi|46396855|sp|Q83P33|PURA_SHIFL RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|123047663|sp|Q0SXA5|PURA_SHIF8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|24054860|gb|AAN45749.1| adenylosuccinate synthetase [Shigella flexneri 2a str. 301]
 gi|30043813|gb|AAP19532.1| adenylosuccinate synthetase [Shigella flexneri 2a str. 2457T]
 gi|110617643|gb|ABF06310.1| adenylosuccinate synthetase [Shigella flexneri 5 str. 8401]
 gi|281603639|gb|ADA76623.1| Adenylosuccinate synthetase [Shigella flexneri 2002017]
 gi|313646348|gb|EFS10810.1| adenylosuccinate synthetase [Shigella flexneri 2a str. 2457T]
 gi|332749053|gb|EGJ79476.1| adenylosuccinate synthetase [Shigella flexneri K-671]
 gi|332749322|gb|EGJ79743.1| adenylosuccinate synthetase [Shigella flexneri 4343-70]
 gi|332761873|gb|EGJ92147.1| adenylosuccinate synthetase [Shigella flexneri 2747-71]
 gi|332763225|gb|EGJ93468.1| adenylosuccinate synthetase [Shigella flexneri 2930-71]
 gi|333009424|gb|EGK28880.1| adenylosuccinate synthetase [Shigella flexneri K-218]
 gi|333011971|gb|EGK31356.1| adenylosuccinate synthetase [Shigella flexneri K-304]
 gi|333012646|gb|EGK32026.1| adenylosuccinate synthetase [Shigella flexneri K-227]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFP EL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPAELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|332304513|ref|YP_004432364.1| adenylosuccinate synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171842|gb|AEE21096.1| adenylosuccinate synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 195/432 (45%), Positives = 276/432 (63%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDKATYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E   L  +G+ V    LRI+    LIL  H +LD+ RE A
Sbjct: 63  ENVTCVIGNGVVLSPEALLKESAMLEERGVPV-KERLRISEACPLILPFHVELDLAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K++++L +HN +  ++   
Sbjct: 122 R--GDKPIGTTGRGIGPAYEDKVSRRGLRVGDLFNPEDFAVKLKEVLEYHNFMLTNYYNV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +   +  +  +L+R  ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEKTLADALAVADTLKAMVVDVTDVLDRARKRGDEIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P  L YVLG+VKAYTTRVG GPFPTEL    G  L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLHLDYVLGIVKAYTTRVGSGPFPTELGCDVGQHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GW D  +++R+V IN + G  LTKLDVLDGL+ L IC GY+  DG   D  
Sbjct: 300 ATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLETLSICTGYKHADGTVKDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +++ G+  + +LP  A+NYI+++EE+  VP+ ++S GP+
Sbjct: 360 PMAADDYELITPVYEEMPGWSENSFGVTEYDNLPQAAKNYIKRLEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PFE
Sbjct: 420 RNETIVLRHPFE 431


>gi|86748455|ref|YP_484951.1| adenylosuccinate synthetase [Rhodopseudomonas palustris HaA2]
 gi|123004495|sp|Q2J0H0|PURA_RHOP2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|86571483|gb|ABD06040.1| Adenylosuccinate synthetase [Rhodopseudomonas palustris HaA2]
          Length = 430

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 258/431 (59%), Positives = 328/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++ RFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVARFQGGHNAGHTLVINGETYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV DP AF+ E+E L  QG+ ++P NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RPSKLAVIGNGVVFDPQAFLDEVERLTKQGVAISPENLRVAENVTLILPLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D++ +  KIE+LL HHNALRR  G 
Sbjct: 121 A--SKATAIGTTQRGIGPAYEDKVGRRAIRLMDLADIDTLPHKIERLLTHHNALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E     IL+EL     K+LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 AEFEAGAILKELTALAPKLLPYAETVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PGS+GYVLG+ KAYTTRVG GPFPTEL N+ G  + E G+EFG
Sbjct: 239 TSSNTVAAQAATGTGMGPGSVGYVLGICKAYTTRVGQGPFPTELDNEIGRKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR++V   G+ G+ALTKLD+LDG +++++CVGYR+DG+E+D LP
Sbjct: 299 TNTGRPRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFEQIEVCVGYRLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TA  R +A+LP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTANARSWAELPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|323975482|gb|EGB70583.1| adenylosuccinate synthetase [Escherichia coli TW10509]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|170766799|ref|ZP_02901252.1| adenylosuccinate synthetase [Escherichia albertii TW07627]
 gi|170124237|gb|EDS93168.1| adenylosuccinate synthetase [Escherichia albertii TW07627]
 gi|315617590|gb|EFU98196.1| adenylosuccinate synthetase [Escherichia coli 3431]
          Length = 432

 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|213428667|ref|ZP_03361417.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 433

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 4   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 63

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 64  ENVTSIIGNGVVLSPSALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 122

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 123 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 180

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 181 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 241 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 301 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 360

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 361 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 420

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 421 RTETMILRDPFD 432


>gi|16763185|ref|NP_458802.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767612|ref|NP_463227.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144664|ref|NP_808006.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161617636|ref|YP_001591601.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|197265523|ref|ZP_03165597.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|200387029|ref|ZP_03213641.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|213052277|ref|ZP_03345155.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213648974|ref|ZP_03379027.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852963|ref|ZP_03382495.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|54038932|sp|P65883|PURA_SALTI RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|54041747|sp|P65882|PURA_SALTY RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|189038347|sp|A9N4Z1|PURA_SALPB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|25293757|pir||AF1049 adenylosuccinate synthase (EC 6.3.4.4) - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422927|gb|AAL23186.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16505493|emb|CAD06843.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29140303|gb|AAO71866.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161367000|gb|ABX70768.1| hypothetical protein SPAB_05499 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197243778|gb|EDY26398.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|199604127|gb|EDZ02672.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|267996698|gb|ACY91583.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160854|emb|CBW20385.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312915464|dbj|BAJ39438.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088793|emb|CBY98551.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321222668|gb|EFX47740.1| Adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323132704|gb|ADX20134.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332991177|gb|AEF10160.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 432

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPSALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|237669617|ref|ZP_04529595.1| adenylosuccinate synthase [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|237654851|gb|EEP52413.1| adenylosuccinate synthase [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 428

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 189/429 (44%), Positives = 282/429 (65%), Gaps = 3/429 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  +V+G QWGDEGKGK+ D+L+E A+V+VRFQGGNNAGHT+ V D  YKL L+PSG++
Sbjct: 1   MSAFIVLGAQWGDEGKGKMTDYLAEEANVVVRFQGGNNAGHTVVVGDKEYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+++IG+ VVVDP A   EI+ L   G+ VTP  L I++ A LI+  H+ LD L+E 
Sbjct: 61  YEDKLNVIGNGVVVDPKALFEEIDYLEGVGVKVTPEKLIISDRAQLIMPYHKVLDKLKEQ 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSFG 179
           A       IGTT +GIGP Y D+  R  IRV DL   +  ++K+++ +   NA + +  G
Sbjct: 121 ARGKND--IGTTGKGIGPCYTDKFERCGIRVCDLMHEDVFTEKLKENIEMKNAYITKVLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + V +  IL+E +   +K+ PF+      +  + +    +LFEGAQG LLD D+GTYP+
Sbjct: 179 GEPVSFDEILKEYLEFAKKLRPFVQDTSVRVYNDIKADKTVLFEGAQGMLLDIDYGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT +   + G GI P  +   +G+ KAYTTRVG GPFPTEL ++TGD+++E G E+
Sbjct: 239 VTSSNTTAGGVANGVGIGPNMITNAVGITKAYTTRVGKGPFPTELLDETGDWIREKGHEY 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGWLDL  V+ +  ++G+  +A+TK+D L GLD+L++CVGY+ +G  +D+ 
Sbjct: 299 GVTTGRSRRCGWLDLVIVKTACRVSGLTSLAVTKIDTLAGLDKLRVCVGYKFNGEVIDYF 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EP+Y   EGW +  A  R + +LP  A+ Y+++IEE  +  ++++S+GP+
Sbjct: 359 PASLEDLAKCEPIYEEFEGWGEEVANARSYDELPENAKKYLKRIEEFTDTKISIVSVGPK 418

Query: 420 RENTLIMSN 428
           R+ T+ + +
Sbjct: 419 RDQTMRVKS 427


>gi|56416157|ref|YP_153232.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|168263282|ref|ZP_02685255.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|194736769|ref|YP_002117307.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197365082|ref|YP_002144719.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242444|ref|YP_002218250.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204926840|ref|ZP_03218042.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205355123|ref|YP_002228924.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859511|ref|YP_002246162.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|81821552|sp|Q5PL58|PURA_SALPA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226709087|sp|B5FRN3|PURA_SALDC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226709088|sp|B5R0P3|PURA_SALEP RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226709089|sp|B5R9C3|PURA_SALG2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576748|sp|B4TSF7|PURA_SALSV RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576749|sp|B5BKI5|PURA_SALPK RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|56130414|gb|AAV79920.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194712271|gb|ACF91492.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197096559|emb|CAR62169.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197936960|gb|ACH74293.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204323505|gb|EDZ08700.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205274904|emb|CAR39971.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205347873|gb|EDZ34504.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206711314|emb|CAR35692.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|322615528|gb|EFY12448.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618588|gb|EFY15477.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322621999|gb|EFY18849.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627723|gb|EFY24514.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631030|gb|EFY27794.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637751|gb|EFY34452.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642415|gb|EFY39019.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644016|gb|EFY40564.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650484|gb|EFY46892.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322659737|gb|EFY55980.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662052|gb|EFY58268.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666199|gb|EFY62377.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672619|gb|EFY68730.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676049|gb|EFY72120.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680533|gb|EFY76571.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684573|gb|EFY80577.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192888|gb|EFZ78114.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197236|gb|EFZ82376.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201647|gb|EFZ86711.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206161|gb|EFZ91123.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323215543|gb|EGA00287.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219528|gb|EGA04013.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227831|gb|EGA11985.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229001|gb|EGA13130.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236387|gb|EGA20463.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238708|gb|EGA22760.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241841|gb|EGA25870.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248010|gb|EGA31947.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254659|gb|EGA38470.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258282|gb|EGA41959.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263572|gb|EGA47093.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265832|gb|EGA49328.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270276|gb|EGA53724.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326626055|gb|EGE32400.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630281|gb|EGE36624.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 432

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPSALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|28899586|ref|NP_799191.1| adenylosuccinate synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839625|ref|ZP_01992292.1| adenylosuccinate synthetase [Vibrio parahaemolyticus AQ3810]
 gi|260361401|ref|ZP_05774463.1| adenylosuccinate synthase [Vibrio parahaemolyticus K5030]
 gi|260876673|ref|ZP_05889028.1| adenylosuccinate synthase [Vibrio parahaemolyticus AN-5034]
 gi|260896634|ref|ZP_05905130.1| adenylosuccinate synthase [Vibrio parahaemolyticus Peru-466]
 gi|260900894|ref|ZP_05909289.1| adenylosuccinate synthase [Vibrio parahaemolyticus AQ4037]
 gi|730428|sp|P40607|PURA_VIBPA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|507736|gb|AAA62188.1| PurA [Vibrio parahaemolyticus]
 gi|28807822|dbj|BAC61075.1| adenylosuccinate synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746846|gb|EDM57834.1| adenylosuccinate synthetase [Vibrio parahaemolyticus AQ3810]
 gi|308086295|gb|EFO35990.1| adenylosuccinate synthase [Vibrio parahaemolyticus Peru-466]
 gi|308094007|gb|EFO43702.1| adenylosuccinate synthase [Vibrio parahaemolyticus AN-5034]
 gi|308106506|gb|EFO44046.1| adenylosuccinate synthase [Vibrio parahaemolyticus AQ4037]
 gi|308112896|gb|EFO50436.1| adenylosuccinate synthase [Vibrio parahaemolyticus K5030]
 gi|328472288|gb|EGF43158.1| adenylosuccinate synthetase [Vibrio parahaemolyticus 10329]
          Length = 438

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 203/438 (46%), Positives = 278/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFISEACPLILPYHVAMDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+E  ++K+++++ +HN    +F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLKEVMEYHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LEE     E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEEAKGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      E ++  G  L  
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGIAKAYCTRVGAGPFPTELYDGLEKQDPVGKHLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLDVLDGLEELKICTGYKMEDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +    +  P+Y  + GW ++T G +    LP  A NYI++IEE+  VPV +
Sbjct: 360 SVLEVSPMAAEAFEKATPIYETMPGWSENTFGAKSLDALPQAALNYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|317484663|ref|ZP_07943564.1| adenylosuccinate synthetase [Bilophila wadsworthia 3_1_6]
 gi|316924019|gb|EFV45204.1| adenylosuccinate synthetase [Bilophila wadsworthia 3_1_6]
          Length = 426

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 278/427 (65%), Gaps = 2/427 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NVV+VG+QWGDEGKGK VD L++  D +VRFQGGNNAGHT+ V+     L L+PSG++
Sbjct: 1   MSNVVIVGVQWGDEGKGKFVDLLAQEIDYVVRFQGGNNAGHTVIVDGKKAALHLVPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K+ +IG+ VV+DP  F+ E+++L  QG+ V+PN L+I++   LI+  H+ LD  RE 
Sbjct: 61  HEGKICLIGNGVVLDPVVFVEELDTLIGQGVDVSPNRLKISSKTHLIMPYHKVLDKAREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
            L   G  IGTT RGIGP YED+VGR  +R  DL D + +  KI   L   N L  + +G
Sbjct: 121 KLEK-GQKIGTTGRGIGPCYEDKVGRVGVRASDLADPDLLKAKIAAALKEKNVLFTALYG 179

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    + +E+M    +I+P +  + S LE+   +G  +LFEGAQG  LD DHGTYPF
Sbjct: 180 IDALAVDAVFDEVMAVAPRIIPHLTDVSSELEQAWNEGKSVLFEGAQGIHLDIDHGTYPF 239

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT+S  A+ GSG+ P  L  ++G++KAYTTRVG GPFPTEL + TG+ L+  G EF
Sbjct: 240 VTSSNTVSGNAAAGSGVGPNKLDRIIGILKAYTTRVGEGPFPTELNDATGELLRTSGGEF 299

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D+  +R S  +NG+  +ALTKLDVL G D ++ICV Y   G+ +D+ 
Sbjct: 300 GVTTGRPRRCGWQDIPVLRESARLNGLTDVALTKLDVLSGFDTIQICVAYEYKGKRMDYP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +        PVY  + GWK+     + + +LP  AR Y++++E++  VPV+++S+GP+
Sbjct: 360 PQEQGALDLVSPVYESMPGWKEDITACKTWDELPEAARAYVQRLEQLSGVPVSMVSVGPD 419

Query: 420 RENTLIM 426
           R  T+  
Sbjct: 420 RNQTIFR 426


>gi|192293135|ref|YP_001993740.1| adenylosuccinate synthetase [Rhodopseudomonas palustris TIE-1]
 gi|229576752|sp|B3Q6W6|PURA_RHOPT RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|192286884|gb|ACF03265.1| Adenylosuccinate synthase [Rhodopseudomonas palustris TIE-1]
          Length = 430

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 254/431 (58%), Positives = 328/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGQTYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV DP AF+ E++ L  QG+ ++P NLRIA N +LIL +HR+LD  RE 
Sbjct: 61  RPSKLAVIGNGVVFDPQAFLDEVKKLQGQGVAISPENLRIAENVTLILPLHRELDATREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D++ +  KIE+LL HHNALRR  G+
Sbjct: 121 AAKAGA--IGTTQRGIGPAYEDKVGRRAIRLMDLADLDTLPTKIERLLAHHNALRRGLGQ 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    IL +L      +LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEIDAGQILADLSAMAPHLLPYAESVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTEL N+ G+ +   GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPGAVGYVLGICKAYTTRVGAGPFPTELTNEIGEEIGRRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++CVGY++DG+E+D+LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFDSVEVCVGYKLDGKEIDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TA  R +A+LP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTANARSWAELPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|75677146|ref|YP_319567.1| adenylosuccinate synthetase [Nitrobacter winogradskyi Nb-255]
 gi|90101720|sp|Q3SNC6|PURA_NITWN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|74422016|gb|ABA06215.1| Adenylosuccinate synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 430

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 259/431 (60%), Positives = 329/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKL+LLPSGVV
Sbjct: 1   MTNVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVIDGNTYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DP AF++E+E L  QG+ V P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RSSKLSVIGNGVVFDPQAFVNEVEKLKEQGVKVGPDNLRVAENVTLILPLHRELDSLREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  KIE+LL HHNALRR  G 
Sbjct: 121 A--SAATAIGTTQRGIGPAYEDKVGRRAIRLMDLADPQTLPHKIERLLAHHNALRRGHGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L +L     ++LP+ D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 AEVDSGALLRDLAAIAPRVLPYADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P +LGYVLG+ KAYTTRVG GPFPTEL ++ G+ + + GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPSALGYVLGICKAYTTRVGQGPFPTELNDEIGELIGQRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V  +G+ G+ALTKLD+LDG D +++C GYR+DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAMLVRQTVRTSGIHGLALTKLDILDGFDTIQVCTGYRLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  +EGWK+ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARIEPVYETVEGWKEPTANARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|147673842|ref|YP_001218096.1| adenylosuccinate synthetase [Vibrio cholerae O395]
 gi|153214885|ref|ZP_01949683.1| adenylosuccinate synthetase [Vibrio cholerae 1587]
 gi|153803578|ref|ZP_01958164.1| adenylosuccinate synthetase [Vibrio cholerae MZO-3]
 gi|153825123|ref|ZP_01977790.1| adenylosuccinate synthetase [Vibrio cholerae MZO-2]
 gi|153831022|ref|ZP_01983689.1| adenylosuccinate synthetase [Vibrio cholerae 623-39]
 gi|229513526|ref|ZP_04402990.1| adenylosuccinate synthetase [Vibrio cholerae TMA 21]
 gi|229521668|ref|ZP_04411086.1| adenylosuccinate synthetase [Vibrio cholerae TM 11079-80]
 gi|229524582|ref|ZP_04413987.1| adenylosuccinate synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229527468|ref|ZP_04416860.1| adenylosuccinate synthetase [Vibrio cholerae 12129(1)]
 gi|254292171|ref|ZP_04962941.1| adenylosuccinate synthetase [Vibrio cholerae AM-19226]
 gi|262170147|ref|ZP_06037836.1| adenylosuccinate synthetase [Vibrio cholerae RC27]
 gi|297581443|ref|ZP_06943366.1| adenylosuccinate synthetase [Vibrio cholerae RC385]
 gi|172047545|sp|A5F534|PURA_VIBC3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|124115044|gb|EAY33864.1| adenylosuccinate synthetase [Vibrio cholerae 1587]
 gi|124120889|gb|EAY39632.1| adenylosuccinate synthetase [Vibrio cholerae MZO-3]
 gi|146315725|gb|ABQ20264.1| adenylosuccinate synthetase [Vibrio cholerae O395]
 gi|148873500|gb|EDL71635.1| adenylosuccinate synthetase [Vibrio cholerae 623-39]
 gi|149741269|gb|EDM55311.1| adenylosuccinate synthetase [Vibrio cholerae MZO-2]
 gi|150421900|gb|EDN13877.1| adenylosuccinate synthetase [Vibrio cholerae AM-19226]
 gi|227014491|gb|ACP10701.1| adenylosuccinate synthetase [Vibrio cholerae O395]
 gi|229335100|gb|EEO00585.1| adenylosuccinate synthetase [Vibrio cholerae 12129(1)]
 gi|229338163|gb|EEO03180.1| adenylosuccinate synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229341262|gb|EEO06266.1| adenylosuccinate synthetase [Vibrio cholerae TM 11079-80]
 gi|229349403|gb|EEO14359.1| adenylosuccinate synthetase [Vibrio cholerae TMA 21]
 gi|262021555|gb|EEY40267.1| adenylosuccinate synthetase [Vibrio cholerae RC27]
 gi|297534281|gb|EFH73119.1| adenylosuccinate synthetase [Vibrio cholerae RC385]
 gi|327485084|gb|AEA79491.1| Adenylosuccinate synthetase [Vibrio cholerae LMA3894-4]
          Length = 432

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A I E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALIKEMSGLEERGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMASFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ GD L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P++  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIFETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|322421282|ref|YP_004200505.1| adenylosuccinate synthetase [Geobacter sp. M18]
 gi|320127669|gb|ADW15229.1| adenylosuccinate synthetase [Geobacter sp. M18]
          Length = 432

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 196/432 (45%), Positives = 273/432 (63%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVV+G QWGDEGKGK+VD  +E AD +VR+QGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MANVVVIGAQWGDEGKGKVVDIYTEFADDVVRYQGGNNAGHTLVVGDEKVILHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VV+DP  FI EI  L   G     N L ++    +I+  H+ +D+ RE 
Sbjct: 61  HAGKRCVIGNGVVLDPEVFIMEITKLKAAGYLKDDNMLLLSEALHIIMPYHKRIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-G 179
                   IGTT RGIGPAYED++GRR IR+MDL D +  ++K++++L   N + +   G
Sbjct: 120 -RKSGSKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDEKAFTRKVKEVLEEKNLILKELLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           ++   ++ I  E M   E +  +      LL +E + G  +LFEGAQG LLD DHGTYP+
Sbjct: 179 DEPFTFEEIYNEYMGYAETLRKYTADTALLLHKEIKAGKSLLFEGAQGTLLDVDHGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T S  A  GSG+SP  +  V+G+ KAY TRVG GPFPTEL ++TG+ L++ G+EF
Sbjct: 239 VTSSSTCSGGACTGSGVSPREIHEVIGISKAYATRVGSGPFPTELMDETGEMLRQAGREF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G+ T R RRCGW D    R +V +NG+ GIA+TKLDVL GL+ +K+C GY+     +D +
Sbjct: 299 GSTTGRPRRCGWFDALVARYAVRVNGLSGIAITKLDVLSGLETVKVCTGYKYQDGVLDEI 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       +  P+Y  L GW +     +   +LP  AR Y+ ++E +   PV L+S+GP 
Sbjct: 359 PASLEVMEQCTPIYEELPGWSEDITAAKSLDELPANARAYVARVEALSGAPVVLVSVGPR 418

Query: 420 RENTLIMSNPFE 431
           R+ T+++ NPFE
Sbjct: 419 RDETIVLRNPFE 430


>gi|62182812|ref|YP_219229.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|81309507|sp|Q57GL4|PURA_SALCH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|62130445|gb|AAX68148.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322717314|gb|EFZ08885.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 432

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD   E A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNACEKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|304321932|ref|YP_003855575.1| adenylosuccinate synthetase [Parvularcula bermudensis HTCC2503]
 gi|303300834|gb|ADM10433.1| adenylosuccinate synthetase [Parvularcula bermudensis HTCC2503]
          Length = 430

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 251/430 (58%), Positives = 319/430 (74%), Gaps = 2/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M N  V+G QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL ++  V+KLSLLPSG+V
Sbjct: 1   MANCAVIGAQWGDEGKGKIVDWLSARADVVVRFQGGHNAGHTLVIDGEVFKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R +K+S+IG+ VV+DP AF +E++ L  QG+ +TP  L IA+NA LIL  HR LD LRE 
Sbjct: 61  RGEKLSVIGNGVVIDPEAFSAEVDRLRAQGVTITPQQLAIADNACLILPFHRALDGLREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     A IGTT RGIGPAYED+VGRRAIRV DL+  + I  K+++LL HHNALR  FG 
Sbjct: 121 AA--GEAKIGTTGRGIGPAYEDKVGRRAIRVGDLSHRDAIEMKVDRLLAHHNALRAGFGV 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    +++E+  A + +LPF   +W LL+   R    ILFEGAQG LLD DHGTYP+V
Sbjct: 179 EPLDRDALIDEIAAAADILLPFARPVWRLLDEVRRTEKRILFEGAQGVLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ Q + GSG+ P  +GYVLG+VKAYTTRVG GPFP EL +  G  L E G+EFG
Sbjct: 239 TSSNTVTGQVASGSGVGPNQVGYVLGIVKAYTTRVGSGPFPCELHDAVGQRLGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT RQRRCGW D A VR+S+ I+GV GIALTKLDVLDGL+ELK+C GYR+DG+E+D++P
Sbjct: 299 TVTGRQRRCGWFDAALVRQSLRISGVDGIALTKLDVLDGLEELKVCTGYRIDGQEIDYMP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 +R EP+Y  L GW  ST G R +ADLP  A  Y+R+IEE+++ PV+L+S  PER
Sbjct: 359 AGVTDQSRLEPIYETLSGWSDSTVGARRWADLPDAAIAYVRRIEEMIDCPVSLVSTSPER 418

Query: 421 ENTLIMSNPF 430
           E+ +++ +PF
Sbjct: 419 EDVILVKDPF 428


>gi|261249456|emb|CBG27321.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 432

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPSALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ +   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTLAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|23015584|ref|ZP_00055356.1| COG0104: Adenylosuccinate synthase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 429

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 255/430 (59%), Positives = 308/430 (71%), Gaps = 3/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGK+VDWLSE ADV+VRFQGG+NAGHTL +N + YKLSLLPSGVV
Sbjct: 1   MANVAVVGAQWGDEGKGKVVDWLSERADVVVRFQGGHNAGHTLVINGVTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV+DP A ++EIE +  QGI VTPN L+IA NA LIL +H  LD  RE 
Sbjct: 61  R-GKLSIIGNGVVIDPWALLAEIERIRAQGIDVTPNVLKIAENACLILPLHAHLDKAREE 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     A IGTT RGIGPAYEDRVGRRAIRV DL D + +  KI  LL HHNAL R  G 
Sbjct: 120 A--SGSAKIGTTGRGIGPAYEDRVGRRAIRVCDLADTKVLEAKIATLLRHHNALLRGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L +L+    KILPF DV+W  L+        +LFEGAQG +LD DHGTYP+V
Sbjct: 178 AEVDGAELLAKLLDVAPKILPFADVVWQHLDEVRHTRKRVLFEGAQGAMLDVDHGTYPYV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+S  A  GSG+ PG +GYVLG+ KAYTTRVG GPFPTEL ++ G  + E G EFG
Sbjct: 238 TSSNTVSGNAGTGSGVGPGQVGYVLGICKAYTTRVGEGPFPTELFDEIGKSIGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VR++V + G+ GIALTKLDVLDG  ELKIC GY++DG+ +   P
Sbjct: 298 TVTGRPRRCGWFDAVMVRQAVKVGGITGIALTKLDVLDGFTELKICTGYKLDGKVIQHFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EP+Y ++ GW +ST G+R + DLP  A  YIR+IEE++E PVALLS  PER
Sbjct: 358 ASMTGQAEVEPIYEVIPGWSESTRGVRSWKDLPATAIKYIRRIEELIEAPVALLSTSPER 417

Query: 421 ENTLIMSNPF 430
           E+++++ +PF
Sbjct: 418 EDSILVHDPF 427


>gi|260599474|ref|YP_003212045.1| adenylosuccinate synthetase [Cronobacter turicensis z3032]
 gi|260218651|emb|CBA33973.1| Adenylosuccinate synthetase [Cronobacter turicensis z3032]
          Length = 432

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 214/432 (49%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  DNVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K++++L +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVLEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADVLTSMVVDVSDLLDQARKRGDFIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG++KAY+TRVG GPFPTEL +  G+FL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIIKAYSTRVGAGPFPTELFDDIGEFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++    LP  A NYI++IEEV  VP+ ++S GP+
Sbjct: 360 PMAADDWEGIEPIYETMPGWSESTFGVKERDGLPQAALNYIKRIEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|126735306|ref|ZP_01751052.1| Adenylosuccinate synthase [Roseobacter sp. CCS2]
 gi|126715861|gb|EBA12726.1| Adenylosuccinate synthase [Roseobacter sp. CCS2]
          Length = 431

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 242/432 (56%), Positives = 311/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  V+KL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVFKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV+DP   I+EI S+  QG+ + P+ L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSIIGNGVVLDPWHLINEIASIRKQGVVIDPSTLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADEATLEARVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L     +ILP+   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPVDRDALVAQLKEIAAEILPYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ P ++ YVLG+VKAYTTRVG GPFPTEL ++ G  L   G EFG
Sbjct: 240 TSSNVIAGQAATGVGVGPNAIDYVLGIVKAYTTRVGEGPFPTELNDEDGHRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQTCATSGVTGISLTKLDVLDGFETLKICVGYDLDGETLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R +PVY  +EGW QST G R +ADLP QA  Y+R+IEE+++ PVAL+S  PER
Sbjct: 360 TAADQQARCKPVYEEIEGWAQSTEGARSWADLPAQAIKYVRRIEELIQCPVALVSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 420 DDTILVTDPFAD 431


>gi|114704942|ref|ZP_01437850.1| adenylosuccinate synthetase [Fulvimarina pelagi HTCC2506]
 gi|114539727|gb|EAU42847.1| adenylosuccinate synthetase [Fulvimarina pelagi HTCC2506]
          Length = 431

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 267/432 (61%), Positives = 333/432 (77%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIDGVSYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DPHAF++E   L  QG+ +TP+ LRIA+NA+LILS+HR+LD  RE 
Sbjct: 61  REGKLSVIGNGVVFDPHAFVAEKRRLEEQGVTITPDKLRIADNAALILSLHRELDAAREQ 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +     IGTT RGIGPAYED+VGRRAIRVMDL ++E +  +IE+LL HHNALRR  GE
Sbjct: 121 AAAKGM-KIGTTGRGIGPAYEDKVGRRAIRVMDLANIETLPGRIERLLAHHNALRRGLGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+ ++TILEEL     +I PF+D +W LL+   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 PEIDHQTILEELTCVAAEITPFIDRVWRLLDDRRRAGERILFEGAQGSLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG  PG +GYVLG+ KAYTTRVG GPFP+E KN+ G FL E G+EFG
Sbjct: 240 TSSNTVAGQAAAGSGTGPGQVGYVLGITKAYTTRVGEGPFPSEQKNEIGKFLGERGREFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT RQRRCGW D   VR++V ING+ G+ALTKLDVLDGL+E+K+  GYR++G  +D+LP
Sbjct: 300 TVTGRQRRCGWFDAVLVRQAVAINGLSGLALTKLDVLDGLEEIKVVTGYRLNGEVIDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EP+Y  L GW ++TAG R ++DLP QA  Y+R IEE++  PVALLS  PER
Sbjct: 360 ASLADQEALEPIYETLPGWSETTAGARRWSDLPAQAVKYVRHIEELVSAPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++ +PF+D
Sbjct: 420 DDTILVRDPFQD 431


>gi|154252591|ref|YP_001413415.1| adenylosuccinate synthase [Parvibaculum lavamentivorans DS-1]
 gi|171769606|sp|A7HV25|PURA_PARL1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|154156541|gb|ABS63758.1| Adenylosuccinate synthase [Parvibaculum lavamentivorans DS-1]
          Length = 430

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 255/432 (59%), Positives = 323/432 (74%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVAVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVIDGVTYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SI+G+ VV+DP AF  E++ +A +G+ VTP+NL+IA NA LIL +HR+LD +REG
Sbjct: 61  RKGKLSILGNGVVLDPWAFAKEVDEIASKGVAVTPDNLKIAENAVLILPVHRELDEMREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT+RGIGPAYED+ GRRAIRV+DL D   ++ K+E LL HHNALRR    
Sbjct: 121 A--NSGVKIGTTKRGIGPAYEDKAGRRAIRVIDLADPSTLTIKVEGLLAHHNALRRGNRL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+    I+E L     ++LPF+  +W++L+   RKG  ILFEGAQG +LD DHGTYPFV
Sbjct: 179 EELEAGPIVEALKEIAPRVLPFVAPVWNVLDEAKRKGQRILFEGAQGTMLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PG++G+VLG+ KAYTTRVG GPFPTEL ++ G  L E G EFG
Sbjct: 239 TSSNTVAGQAAGGSGVGPGAIGFVLGITKAYTTRVGEGPFPTELTDEVGQRLGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+++   G+ GIALTKLDVLDG DE+K+C  Y +DG+ VD LP
Sbjct: 299 TVTGRKRRCGWFDAVMVRQAIKTGGITGIALTKLDVLDGFDEIKVCTSYEIDGKLVDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  +  P+Y  LEGWK ST G R +A LP  A  Y+R +EE++E PVALLS  PER
Sbjct: 359 AGMDAQAKVTPIYETLEGWKDSTQGARSWAQLPAAAVKYVRYVEELIEAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 419 DDTILMKDPFED 430


>gi|15642597|ref|NP_232230.1| adenylosuccinate synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121728998|ref|ZP_01682001.1| adenylosuccinate synthetase [Vibrio cholerae V52]
 gi|153820226|ref|ZP_01972893.1| adenylosuccinate synthetase [Vibrio cholerae NCTC 8457]
 gi|227082719|ref|YP_002811270.1| adenylosuccinate synthetase [Vibrio cholerae M66-2]
 gi|229507346|ref|ZP_04396851.1| adenylosuccinate synthetase [Vibrio cholerae BX 330286]
 gi|229509731|ref|ZP_04399212.1| adenylosuccinate synthetase [Vibrio cholerae B33]
 gi|229516855|ref|ZP_04406301.1| adenylosuccinate synthetase [Vibrio cholerae RC9]
 gi|229606852|ref|YP_002877500.1| adenylosuccinate synthetase [Vibrio cholerae MJ-1236]
 gi|254851142|ref|ZP_05240492.1| adenylosuccinate synthetase [Vibrio cholerae MO10]
 gi|255744430|ref|ZP_05418382.1| adenylosuccinate synthetase [Vibrio cholera CIRS 101]
 gi|262158458|ref|ZP_06029573.1| adenylosuccinate synthetase [Vibrio cholerae INDRE 91/1]
 gi|298500574|ref|ZP_07010378.1| adenylosuccinate synthetase [Vibrio cholerae MAK 757]
 gi|14548208|sp|Q9KNX8|PURA_VIBCH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254788726|sp|C3LRR4|PURA_VIBCM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|9657190|gb|AAF95743.1| adenylosuccinate synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121628721|gb|EAX61189.1| adenylosuccinate synthetase [Vibrio cholerae V52]
 gi|126509227|gb|EAZ71821.1| adenylosuccinate synthetase [Vibrio cholerae NCTC 8457]
 gi|227010607|gb|ACP06819.1| adenylosuccinate synthetase [Vibrio cholerae M66-2]
 gi|229345918|gb|EEO10890.1| adenylosuccinate synthetase [Vibrio cholerae RC9]
 gi|229353205|gb|EEO18144.1| adenylosuccinate synthetase [Vibrio cholerae B33]
 gi|229354851|gb|EEO19772.1| adenylosuccinate synthetase [Vibrio cholerae BX 330286]
 gi|229369507|gb|ACQ59930.1| adenylosuccinate synthetase [Vibrio cholerae MJ-1236]
 gi|254846847|gb|EET25261.1| adenylosuccinate synthetase [Vibrio cholerae MO10]
 gi|255737955|gb|EET93348.1| adenylosuccinate synthetase [Vibrio cholera CIRS 101]
 gi|262029619|gb|EEY48268.1| adenylosuccinate synthetase [Vibrio cholerae INDRE 91/1]
 gi|297540743|gb|EFH76800.1| adenylosuccinate synthetase [Vibrio cholerae MAK 757]
          Length = 432

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A I E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPEALIKEMSGLEDRGVPVR-ERLFISEACPLILPYHVALDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D+   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDMASFAEKLQEVMAFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+     E +   +  + + L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ GD L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL E+KIC GY+M DG   +  
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P++  + GW ++T G +  A+LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PMAADAFENVTPIFETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|283786856|ref|YP_003366721.1| adenylosuccinate synthetase [Citrobacter rodentium ICC168]
 gi|282950310|emb|CBG89957.1| adenylosuccinate synthetase [Citrobacter rodentium ICC168]
          Length = 432

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTAMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDSVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWQGIEPIYETMPGWSESTFGVKERSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|188580208|ref|YP_001923653.1| adenylosuccinate synthase [Methylobacterium populi BJ001]
 gi|229576726|sp|B1Z962|PURA_METPB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|179343706|gb|ACB79118.1| Adenylosuccinate synthase [Methylobacterium populi BJ001]
          Length = 430

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 265/432 (61%), Positives = 327/432 (75%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL V + VYKLSLLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVVGEAVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP+ + +IG+ VV+DP+A  SEI+ LA QG+ VT  NLR+A+NA+LILS+HR+LD LRE 
Sbjct: 61  RPNTLGVIGNGVVLDPYALASEIDRLAGQGVTVTRENLRVADNATLILSLHRELDALRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGPAYED+VGRRAIR+MDL + E +  KIE+LL HHNALRR FG 
Sbjct: 121 GAP--GTKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPETLPPKIERLLAHHNALRRGFGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+    IL+EL    +++LP+ D +W LL+   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 179 EEISETAILDELTAIADRVLPYQDTVWHLLDEARRGGKRILFEGAQGALLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL +  G  + E G EFG
Sbjct: 239 TSSNTVAGQAATGSGLGPRAIGYVLGIAKAYTTRVGEGPFPTELHDAIGQRIGERGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDG DE+++C  Y +DG+  D LP
Sbjct: 299 TVTGRKRRCGWFDACLVRQTVQTSGIDGIALTKLDVLDGFDEIRVCTAYDIDGQRFDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  + GW  +TAG R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 ASQAAQQRAVPVYETIPGWSGTTAGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T++M NPFED
Sbjct: 419 DDTILMHNPFED 430


>gi|74314662|ref|YP_313081.1| adenylosuccinate synthetase [Shigella sonnei Ss046]
 gi|110826522|sp|Q3YUG6|PURA_SHISS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|73858139|gb|AAZ90846.1| adenylosuccinate synthetase [Shigella sonnei Ss046]
          Length = 432

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVATT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|222086843|ref|YP_002545377.1| adenylosuccinate synthetase [Agrobacterium radiobacter K84]
 gi|254784027|sp|B9J8Q9|PURA_AGRRK RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|221724291|gb|ACM27447.1| adenylosuccinate synthetase [Agrobacterium radiobacter K84]
          Length = 431

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 275/431 (63%), Positives = 339/431 (78%), Gaps = 1/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVV+G QWGDEGKGKIVDWLSE ADVIVRFQGG+NAGHTL V+ + YKL+LLPSG+V
Sbjct: 1   MTNVVVIGSQWGDEGKGKIVDWLSERADVIVRFQGGHNAGHTLVVDGVSYKLALLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LRIA NA LILS+HRDLD LRE 
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRAQGIAVTPDVLRIAENAPLILSLHRDLDALRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIRV+DL++ E +  KI++LL HHNALRR  G 
Sbjct: 120 AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVIDLSEPETLPAKIDRLLTHHNALRRGMGL 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+ +  + EEL    E ILP+MD +W LL+ + + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 180 SEISFNALHEELTSVAEHILPYMDQVWRLLDEQRKAGARILFEGAQGALLDNDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P +LGYVLG+ KAYTTRVG GPFP EL ++ G  L  VG+E G
Sbjct: 240 TSSNTVAGQAAAGSGLGPTALGYVLGITKAYTTRVGEGPFPCELHDEIGKHLSTVGREVG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   VR++V  +G+ GIALTKLDVLDGLDELKIC+GYR+DG+E+D+LP
Sbjct: 300 VNTGRPRRCGWFDAVLVRQTVKTSGITGIALTKLDVLDGLDELKICIGYRLDGKEIDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y+ LEGWK+ST G R +ADLP QA  Y+R++EE++  PVA+LS  PER
Sbjct: 360 SSQAAQARVEPIYITLEGWKESTVGARKWADLPAQAIKYVRQVEELIGAPVAMLSTSPER 419

Query: 421 ENTLIMSNPFE 431
           E+T+++++PFE
Sbjct: 420 EDTILVTDPFE 430


>gi|114767184|ref|ZP_01446061.1| adenylosuccinate synthetase [Pelagibaca bermudensis HTCC2601]
 gi|114540654|gb|EAU43724.1| adenylosuccinate synthetase [Roseovarius sp. HTCC2601]
          Length = 431

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 237/432 (54%), Positives = 312/432 (72%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS  ADVI RFQGG+NAGHTL ++  V+KL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSSRADVIARFQGGHNAGHTLVIDGTVFKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  KMS+IG+ VV+DP   + EI ++  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKMSVIGNGVVLDPWHLVKEIATIREQGVEITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +  GA IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ALR+  G 
Sbjct: 121 AAAK-GAKIGTTGRGIGPAYEDKVGRRSVRVADLADRATLESRVDRALTHHDALRKGLGM 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V  + ++E+L+    ++L +   +W +L  + R G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPVDREALIEQLLEIAPEVLQYAGPVWKVLNEKRRSGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++ +VLG+VKAYTTRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNVIAGQAATGTGIGPGAIDFVLGIVKAYTTRVGEGPFPTELDDEDGNRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GI+LTKLDVLDG +++KIC GY +DG  +D LP
Sbjct: 300 TVTGRKRRCGWFDAVLVRQTCATSGVNGISLTKLDVLDGFEKIKICTGYELDGEVLDHLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  ++GW +ST G R + DLP QA  Y+R+IEE++  PVA+LS  PER
Sbjct: 360 IAADQQARCTPIYEEMDGWSESTEGARSWNDLPGQAIKYVRRIEELIGCPVAMLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PFED
Sbjct: 420 EDTILVTDPFED 431


>gi|56459448|ref|YP_154729.1| adenylosuccinate synthase [Idiomarina loihiensis L2TR]
 gi|81821677|sp|Q5QW95|PURA_IDILO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|56178458|gb|AAV81180.1| Adenylosuccinate synthase [Idiomarina loihiensis L2TR]
          Length = 432

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 285/433 (65%), Gaps = 6/433 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVV++G QWGDEGKGKIVD L++ A ++VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSQNVVILGTQWGDEGKGKIVDLLTDKATMVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   +IG+ VV+ P A + E+  L  + + V  + LRI+    LIL  H  LD  RE
Sbjct: 61  LRKNVQCVIGNGVVLSPEALMEEMAMLEARHVPVA-DRLRISKACPLILPFHVALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSF 178
            A       IGTT RGIGPAYED+V RR +RV DL D++   +K+++L+ +HN  L   +
Sbjct: 120 RARGK--EAIGTTGRGIGPAYEDKVARRGLRVGDLFDMKRFGEKLKELVDYHNFSLVEYY 177

Query: 179 GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
               + + T+L++     E + P +  + +LL++  + G  I+FEGAQG LLD DHGTYP
Sbjct: 178 KADAIDFDTVLKQCEEFAEVLKPMVIDVPALLDKARKNGESIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + G+G  P  + YVLG+VKAYTTRVG GPFPTEL  + G  L E G E
Sbjct: 238 YVTSSNTTAGGVATGAGFGPRYIDYVLGIVKAYTTRVGSGPFPTELDCEVGQHLGEKGHE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R+RR GW+D  ++RR+V IN + G  LTKLDVLDGL+ELKIC+GY++ DG   +
Sbjct: 298 FGATTGRKRRTGWIDAVAMRRAVQINSISGFCLTKLDVLDGLEELKICIGYQLSDGSVTE 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P  +  +   EP+Y  + GW+QST G+    +LP +A  YI +IE +  VPV ++S G
Sbjct: 358 HPPLSAEDYEVVEPIYETMPGWQQSTVGITEHKELPPEALAYIARIEALTGVPVDIISTG 417

Query: 418 PERENTLIMSNPF 430
           P+R+ T+++ +PF
Sbjct: 418 PDRKETIVLRHPF 430


>gi|281181273|dbj|BAI57603.1| adenylosuccinate synthetase [Escherichia coli SE15]
          Length = 432

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGLEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|225628252|ref|ZP_03786286.1| adenylosuccinate synthetase [Brucella ceti str. Cudo]
 gi|237816061|ref|ZP_04595057.1| adenylosuccinate synthetase [Brucella abortus str. 2308 A]
 gi|225616098|gb|EEH13146.1| adenylosuccinate synthetase [Brucella ceti str. Cudo]
 gi|237788724|gb|EEP62936.1| adenylosuccinate synthetase [Brucella abortus str. 2308 A]
          Length = 533

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 337/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 105 MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 164

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 165 R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 223

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 224 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 281

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 282 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 341

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 342 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 401

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y +DG+ +D+LP
Sbjct: 402 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLP 461

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 462 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 521

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 522 EDTILVTDPFHD 533


>gi|17986634|ref|NP_539268.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|189024776|ref|YP_001935544.1| adenylosuccinate synthetase [Brucella abortus S19]
 gi|297248955|ref|ZP_06932663.1| adenylosuccinate synthetase [Brucella abortus bv. 5 str. B3196]
 gi|17982249|gb|AAL51532.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|189020348|gb|ACD73070.1| adenylosuccinate synthetase [Brucella abortus S19]
 gi|297174088|gb|EFH33445.1| adenylosuccinate synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 520

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 337/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 92  MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 151

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 152 R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 210

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 211 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 268

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 269 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 328

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 329 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 388

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y +DG+ +D+LP
Sbjct: 389 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLP 448

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 449 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 508

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 509 EDTILVTDPFHD 520


>gi|148559434|ref|YP_001259537.1| adenylosuccinate synthetase [Brucella ovis ATCC 25840]
 gi|148370691|gb|ABQ60670.1| adenylosuccinate synthetase [Brucella ovis ATCC 25840]
          Length = 533

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 338/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 105 MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 164

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 165 R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 223

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 224 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 281

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 282 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 341

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 342 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 401

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y++DG+ +D+LP
Sbjct: 402 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYKLDGKRIDYLP 461

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 462 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 521

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 522 EDTILVTDPFHD 533


>gi|109896546|ref|YP_659801.1| adenylosuccinate synthetase [Pseudoalteromonas atlantica T6c]
 gi|123065142|sp|Q15ZE1|PURA_PSEA6 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|109698827|gb|ABG38747.1| Adenylosuccinate synthetase [Pseudoalteromonas atlantica T6c]
          Length = 432

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 194/432 (44%), Positives = 276/432 (63%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDKATYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E   L  +G+ V    LRI+    LIL  H +LD+ RE A
Sbjct: 63  ENVTCVIGNGVVLSPEALLKESAMLEERGVPV-KERLRISEACPLILPFHVELDLAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL +    + K++++L +HN +  ++ + 
Sbjct: 122 R--GDKPIGTTGRGIGPAYEDKVSRRGLRVGDLFNPTDFAVKLKEVLEYHNFMLTNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +   +  +  +L+R  ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEKTLADALAVADILKAMVVDVTDVLDRARKRGDEIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P  L YVLG+VKAYTTRVG GPFPTEL    G  L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLHLDYVLGIVKAYTTRVGSGPFPTELGCDVGQHLGIKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GW D  +++R+V IN + G  LTKLDVLDGL+ L IC GY+  DG   D  
Sbjct: 300 ATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLETLSICTGYKHADGTVKDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +++ G+  + +LP  A+NYI+++EE+  VP+ ++S GP+
Sbjct: 360 PMAADDYELITPVYEEMPGWSENSFGVTEYDNLPQAAKNYIKRLEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PFE
Sbjct: 420 RNETIVLRHPFE 431


>gi|254472911|ref|ZP_05086309.1| adenylosuccinate synthetase [Pseudovibrio sp. JE062]
 gi|211957632|gb|EEA92834.1| adenylosuccinate synthetase [Pseudovibrio sp. JE062]
          Length = 430

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 264/432 (61%), Positives = 334/432 (77%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VDWLSE ADV+VRFQGG+NAGHTL ++   YKL+LLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKLVDWLSEQADVVVRFQGGHNAGHTLVIDGTSYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DPHA ++EIE L  QG+ ++P  LR+A+NA+LILS+HR+LD LRE 
Sbjct: 61  R-GKLSVIGNGVVIDPHALVAEIERLEAQGVKISPEILRVADNATLILSLHRELDALRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A SP G  IGTT+RGIGPAYED+VGRRAIRVMDL ++  +  KI++LL HHNA+ R  G 
Sbjct: 120 A-SPAGTKIGTTKRGIGPAYEDKVGRRAIRVMDLANMSTLPAKIDRLLTHHNAILRGLGR 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+  +TI +EL    +KILP+MD  W +L++  R+G  +LFEGAQG LLDNDHGTYPFV
Sbjct: 179 DEISPETIYQELESVADKILPYMDKAWYMLDKARREGKRLLFEGAQGALLDNDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P S+ YVLG+ KAYTTRVG GPFPTE +N+ G+FL   G EFG
Sbjct: 239 TSSNTVAGQAAAGSGLGPNSIDYVLGITKAYTTRVGEGPFPTEQQNEVGEFLGTRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++V  +G+ GIALTKLDVLDGLDE+KICVGY +DG  +D+LP
Sbjct: 299 TNTGRRRRCGWFDAVIVRQTVCTSGINGIALTKLDVLDGLDEIKICVGYELDGERIDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  L GWK+ST G R +A+LP QA  Y+R +EE++  PVALLS  PER
Sbjct: 359 ASQGAQARVVPIYETLPGWKESTKGARTWAELPAQAVKYVRHVEELIGAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPF+D
Sbjct: 419 DDTILVQNPFQD 430


>gi|237729110|ref|ZP_04559591.1| adenylosuccinate synthetase [Citrobacter sp. 30_2]
 gi|283834795|ref|ZP_06354536.1| adenylosuccinate synthase [Citrobacter youngae ATCC 29220]
 gi|226908839|gb|EEH94757.1| adenylosuccinate synthetase [Citrobacter sp. 30_2]
 gi|291069041|gb|EFE07150.1| adenylosuccinate synthase [Citrobacter youngae ATCC 29220]
          Length = 432

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLSPSALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 122 R--GEKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTSMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL +  G+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDDVGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDSVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGIEPIYETMPGWSESTFGVKERSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|323495498|ref|ZP_08100572.1| adenylosuccinate synthetase [Vibrio sinaloensis DSM 21326]
 gi|323319379|gb|EGA72316.1| adenylosuccinate synthetase [Vibrio sinaloensis DSM 21326]
          Length = 438

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 200/438 (45%), Positives = 273/438 (62%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A I E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNIKCVIGNGVVLSPEALIKEMKPLEARGIPVR-ERLFVSEACPLILPYHIAIDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEVFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y+ +LE+ M   E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYEEVLEQCMGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFP       + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGQDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR+V IN + G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAVQINSISGFCLTKLDVLDGLEELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G      LP  A +YI++IEE+  VPV +
Sbjct: 360 SILEVSPMAAEAFEEATPIYETMPGWSETTFGATSIDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|126729233|ref|ZP_01745047.1| adenylosuccinate synthetase [Sagittula stellata E-37]
 gi|126710223|gb|EBA09275.1| adenylosuccinate synthetase [Sagittula stellata E-37]
          Length = 431

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 310/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVICRFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI ++  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIATIREQGVEITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADETTLVTRVDRALQHHDPLRKGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V  + ++  L     +ILP+   +W +L  + R G+ ILFEGAQG LLD D GTYPFV
Sbjct: 180 APVDREALIAALKEIAAQILPYAAPVWKVLNEKRRSGSRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGTGIGPGAIDYVLGIVKAYTTRVGEGPFPTELDDDDGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQTCATSGVNGISLTKLDVLDGFETLKICVGYDLDGKRLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             S    R  PVY  +EGW +ST G R +ADLP  A  Y+R++EE++  PVALLS  PER
Sbjct: 360 FASEEQARCVPVYEEMEGWSESTEGARSWADLPGAAVKYVRRVEELIGCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 420 DDTILVTDPFAD 431


>gi|254486130|ref|ZP_05099335.1| adenylosuccinate synthetase [Roseobacter sp. GAI101]
 gi|214042999|gb|EEB83637.1| adenylosuccinate synthetase [Roseobacter sp. GAI101]
          Length = 430

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 237/432 (54%), Positives = 303/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  V+KLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGTVFKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI  L  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIAQLRSQGVTITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L+HH+ALRR  G 
Sbjct: 121 QA--SVAKIGTTGRGIGPAYEDKVGRRSVRVADLADDATLELRVDRALVHHDALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    +L  L      +L +   +W +L  + + G  ILFEGAQG LLD D GTYP+V
Sbjct: 179 EPVDRDALLAALREIAPSVLEYAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G+GI PGS+ +VLG+VKAYTTRVG GPFP EL +  G+ L   G EFG
Sbjct: 239 TSSNVIAGQAATGTGIGPGSIDFVLGIVKAYTTRVGEGPFPAELNDADGERLGVRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIA TKLDVLDG + LKICVGY +DG+ +++LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVNGIAFTKLDVLDGFETLKICVGYELDGQPLEYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  PVY  + GW +ST G R +ADLP  A  Y+R++EE++  PVALLS  PER
Sbjct: 359 TAADQQARCTPVYEEMLGWSESTEGARSWADLPANAIKYVRRVEELIGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 419 EDTILVTDPFAD 430


>gi|289209100|ref|YP_003461166.1| adenylosuccinate synthetase [Thioalkalivibrio sp. K90mix]
 gi|288944731|gb|ADC72430.1| adenylosuccinate synthetase [Thioalkalivibrio sp. K90mix]
          Length = 431

 Score =  501 bits (1290), Expect = e-140,   Method: Composition-based stats.
 Identities = 196/429 (45%), Positives = 284/429 (66%), Gaps = 4/429 (0%)

Query: 4   VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPD 63
           VVV+G QWGDEGKGKIVD L+E+A  +VRFQGG+NAGHTL ++     L L+PSG++R  
Sbjct: 5   VVVLGSQWGDEGKGKIVDRLTEDAAAVVRFQGGHNAGHTLVIDGEKTVLHLIPSGILREG 64

Query: 64  KMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALS 123
              +IG+ VV+ P A I+E+E L  +G+ V  + LR+++   LIL  H  LD  RE A  
Sbjct: 65  VECMIGNGVVLSPEALITEMEELEAKGVPVA-DRLRLSDACQLILPYHVALDHAREKARG 123

Query: 124 PCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEV 183
              A IGTT RGIGPAYED+V RR +R+ DL   E ++ K+ +++ +HN   + + +   
Sbjct: 124 K--AAIGTTGRGIGPAYEDKVARRGLRLDDLFHRERLAAKLGEVMDYHNFALKHYFKAPT 181

Query: 184 LYK-TILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTS 242
           + +  +LE+ +   E++ P +  +   L     +G  ++FEGAQG LLD DHGTYPFVTS
Sbjct: 182 IDQQEVLEQCLAHAERLQPMVADVAGRLHELRAQGRDVMFEGAQGTLLDIDHGTYPFVTS 241

Query: 243 SNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTV 302
           SNT +  AS GSG+ P  + YVLG+ KAYTTRVG GPFPTEL +  G+ L   G EFG+ 
Sbjct: 242 SNTTAGGASTGSGVGPRDIDYVLGITKAYTTRVGAGPFPTELFDNMGEHLATRGNEFGST 301

Query: 303 TNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDD 362
           T R RRCGW D  +++R+V IN + G+ +TKLDVLDGL+ ++ICVGY   G+  +  P  
Sbjct: 302 TGRARRCGWFDAVALKRAVAINSISGLCMTKLDVLDGLESVQICVGYDCGGKRHEVPPSG 361

Query: 363 SIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPEREN 422
           +  +   +P+Y  + GW++ST G+R +  LP  AR Y+ ++ +V+ VP+ ++S GP+R+ 
Sbjct: 362 AEAYAACKPIYEEMPGWQESTVGIREYDKLPAAARAYLERLSDVVGVPIDMISTGPDRDE 421

Query: 423 TLIMSNPFE 431
           TL++ +PF+
Sbjct: 422 TLVLRDPFD 430


>gi|168187314|ref|ZP_02621949.1| adenylosuccinate synthetase [Clostridium botulinum C str. Eklund]
 gi|169294756|gb|EDS76889.1| adenylosuccinate synthetase [Clostridium botulinum C str. Eklund]
          Length = 427

 Score =  501 bits (1290), Expect = e-140,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 279/426 (65%), Gaps = 2/426 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E ADV+VRFQGGNNAGHT+ V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAETADVVVRFQGGNNAGHTVVVGDKEYKLHLVPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK++++G+ VV+DP A   EI  L   G+ VTP  L++++ A LI+  HR LD L+E 
Sbjct: 61  YEDKINVLGNGVVIDPRALFEEINYLEDLGVKVTPEKLKVSDRAQLIMPYHRILDGLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IRV DL   +    K+ Q +   N L R +G 
Sbjct: 121 ARGKND--IGTTGKGIGPAYTDKAERSGIRVCDLMHKDVFEVKLRQNINDKNELIRLYGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  + EE     +++ P++  I  ++  E +K  ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELDFNKVFEEYNAYADRMRPYVADISVIIYDEMKKNKNVLFEGAQGSLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T++     G+G+ P ++   +G+ KAYTTRVG GPFPTEL ++ G+ L+E G E+G
Sbjct: 239 TSSSTVAGGVCTGAGVGPTAITGAVGIAKAYTTRVGKGPFPTELLDEMGEKLREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  I+G+    +TK+D L G D++K+C GY  DG+ +D+ P
Sbjct: 299 VTTGRARRCGWLDLVILKSTARISGLTSFVVTKIDTLAGFDKIKVCTGYEFDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + +PVY   +GW  S A  R + +LP  A+ Y++KIEE  +  V+++S+GP+R
Sbjct: 359 ASLEDLAKCKPVYEEFDGWDDSIADARSYDELPENAKIYLKKIEEFTDTKVSIVSVGPKR 418

Query: 421 ENTLIM 426
           + T+++
Sbjct: 419 DQTIVV 424


>gi|5542174|pdb|1CG3|A Chain A, Structure Of The Mutant (R143l) Of Adenylosuccinate
           Synthetase From E. Coli Complexed With Hadacidin, Gdp,
           6- Phosphoryl-Imp, And Mg2+
          Length = 431

 Score =  501 bits (1290), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V  R +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVALRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|104783867|ref|YP_610365.1| adenylosuccinate synthetase [Pseudomonas entomophila L48]
 gi|122401632|sp|Q1I454|PURA_PSEE4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|95112854|emb|CAK17582.1| adenylosuccinate synthetase [Pseudomonas entomophila L48]
          Length = 430

 Score =  501 bits (1290), Expect = e-140,   Method: Composition-based stats.
 Identities = 210/430 (48%), Positives = 282/430 (65%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+  A LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALMREITKLEEKGVPVR-ERLRISPAAPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    ++ ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E++ P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQQTLDECMAYAEQLKPMMLDVTAELHNLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   S GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++TG  L + G EFG
Sbjct: 240 TSSNTTAGGISTGSGVGPMYLDYILGITKAYTTRVGSGPFPTELFDETGATLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           + T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + ICVGY+ +   V   P
Sbjct: 300 STTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICVGYKNENGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G++   +LP  AR YI++IEE++  P+ ++S GP+R
Sbjct: 360 SDADSYIGLEPVYEQMPGWSESTLGVKTLEELPEAARAYIKRIEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|306826202|ref|ZP_07459536.1| adenylosuccinate synthase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304431478|gb|EFM34460.1| adenylosuccinate synthase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 444

 Score =  501 bits (1290), Expect = e-140,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 17  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 76

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 77  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 134

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E   +++E+ L   N L     +
Sbjct: 135 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFRERLERNLAEKNRLFEKLYD 192

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 193 SEPISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 252

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 253 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 312

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 313 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 373 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPD 432

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 433 REQTNILESVW 443


>gi|254447287|ref|ZP_05060754.1| adenylosuccinate synthetase [gamma proteobacterium HTCC5015]
 gi|198263426|gb|EDY87704.1| adenylosuccinate synthetase [gamma proteobacterium HTCC5015]
          Length = 431

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 201/431 (46%), Positives = 282/431 (65%), Gaps = 4/431 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L++ A  +VRFQGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTDRAAAVVRFQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+   A   E++ L   G+  +   L ++    LIL  H  +D  RE A
Sbjct: 63  ENVQCLIGNGVVLSMEALFKELDELEQGGVPAS-QRLGVSEACPLILPFHIGIDQARELA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL   E  + K+ ++L +HN + +++ + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLLHREAFAAKLGEVLDYHNFVLKNYFKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +   ++ +L++ +   E++ P +  + + L+   + G HI+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETFDFQKVLDDALEQGERLTPMIVDVTARLDEIHKSGEHIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +  AS G+G+ P +L YVLG+ KAYTTRVG GPFPTEL +  G  L + G EFG
Sbjct: 240 TSSNTTAGGASTGTGVGPCNLDYVLGITKAYTTRVGSGPFPTELFDDVGKHLADKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D  ++RRSV IN V G+ +TKLDVLDGLD + +C GYR+DG  V   P
Sbjct: 300 ATTGRARRCGWFDAVALRRSVQINSVSGLCVTKLDVLDGLDTIHVCTGYRIDGEVVAVPP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R EP+Y  + GWK+ST G++    LP  AR+Y+  IE+V+E PV ++S GP+R
Sbjct: 360 IGADAFERCEPIYEEMPGWKESTVGVKSLDQLPQAARDYLTCIEDVVETPVDIISTGPDR 419

Query: 421 ENTLIMSNPFE 431
           E T+++ +P++
Sbjct: 420 EETIVLRHPYD 430


>gi|85715272|ref|ZP_01046255.1| adenylosuccinate synthetase [Nitrobacter sp. Nb-311A]
 gi|85697918|gb|EAQ35792.1| adenylosuccinate synthetase [Nitrobacter sp. Nb-311A]
          Length = 430

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 261/431 (60%), Positives = 331/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKL+LLPSGVV
Sbjct: 1   MTNVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVIDGHTYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DP AF++E+E L  QG+ + P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RSSKLSIIGNGVVFDPQAFVNEVEKLKGQGVKIGPDNLRVAENVTLILPLHRELDSLREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  KIE+LL HHNALRR  G 
Sbjct: 121 A--SAATAIGTTQRGIGPAYEDKVGRRAIRLMDLADPQTLPHKIERLLTHHNALRRGHGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L+EL     ++LP+ D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 AEVDSGALLKELAAIAPRVLPYADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P +LGYVLG+ KAYTTRVG GPFPTEL+++ G+ + + GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPSALGYVLGICKAYTTRVGQGPFPTELEDEIGELIGQRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V  +G+ G+ALTKLD+LDG D +++C GYR+DGRE+D LP
Sbjct: 299 VNTGRKRRCGWFDAMLVRQTVRTSGIHGLALTKLDILDGFDTIQVCTGYRLDGREIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  +EGWK+ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARIEPVYETIEGWKEPTASARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|149914501|ref|ZP_01903031.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
 gi|149811294|gb|EDM71129.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
          Length = 431

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 308/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS+ ADVIVRFQGG+NAGHTL ++  VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSQRADVIVRFQGGHNAGHTLVIDGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EI S+  QG+ ++P  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEIASIRDQGVEISPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G  IGTT RGIGPAYED+VGRR++RV DL+D   +  ++++ L HH+ LRR  G 
Sbjct: 121 AAYK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLSDEATLVARVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V    ++ +L     ++LPF   +W +L    + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 APVDRDALIAQLKEIAPQVLPFAAPVWKVLGERRKAGQRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ PGS+ YVLG+VKAYTTRVG GPFPTEL+++ G  L   G EFG
Sbjct: 240 TSSNVIAGQAATGVGLGPGSIDYVLGIVKAYTTRVGEGPFPTELEDEDGTRLGTRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D A VR++   +GV GI+LTKLDVLDG + LKICV Y +DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAALVRQTCATSGVNGISLTKLDVLDGFETLKICVAYELDGQRMDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW +ST G R +ADLP  A  Y+R++EE+++ PVALLS  PER
Sbjct: 360 TAADQQARCRPIYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIDCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 420 EDTILVTDPFAD 431


>gi|161505131|ref|YP_001572243.1| adenylosuccinate synthetase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189038348|sp|A9MFN5|PURA_SALAR RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|160866478|gb|ABX23101.1| hypothetical protein SARI_03265 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 432

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLSPSALMKEMQELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN + G  LTKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDSVAIRRAVQINSLSGFCLTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWQGIEPIYETMPGWSESTFGVKDRSGLPAAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|254455292|ref|ZP_05068721.1| adenylosuccinate synthetase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082294|gb|EDZ59720.1| adenylosuccinate synthetase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 430

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 227/431 (52%), Positives = 311/431 (72%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M N+VVVG QWGDEGKGKIVDWLSE ADV++RFQGG+NAGHTL ++ + YKL LLPSG+V
Sbjct: 1   MKNIVVVGSQWGDEGKGKIVDWLSEQADVVIRFQGGHNAGHTLVIDGVTYKLRLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R DK+SIIG+ VVVDP A + EI+ +  +GI V+ +N  I+  A+LIL  HR++D +RE 
Sbjct: 61  RKDKVSIIGNGVVVDPWALLEEIDEIKSKGINVSTDNFIISEAANLILPFHREMDEIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRR+IRVMDL    ++ +++E +L+HHNA+R+  G+
Sbjct: 121 AAGKG--KIGTTRRGIGPAYEDKVGRRSIRVMDLRSENNLDQRLESVLIHHNAIRKGLGK 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           K      +  +L+    +IL +   +W  ++   ++   ILFEGAQG LLD DHGTYP+V
Sbjct: 179 KIFEKAQLKSDLLKIAPEILQYSQPVWLKIDEFKKQKKKILFEGAQGILLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+++ A+ G+G  P S+ YVLG+ KAYTTRVG GPFPTEL +  G+ L   GKEFG
Sbjct: 239 TSSNTVASSAATGTGCGPNSINYVLGIAKAYTTRVGEGPFPTELTDDIGELLGTRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT+R+RRCGW D   VR+++ I+G+ GIALTKLDVLD LDE+K+CV Y +DG+++D+LP
Sbjct: 299 TVTSRKRRCGWFDGVLVRQTIKISGIDGIALTKLDVLDELDEIKMCVEYELDGKKIDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + +PVY    GWK ST G++    LP  A+NYI  +E+ +   V+ +S  PER
Sbjct: 359 AAVEDQLKIKPVYRTFPGWKTSTNGIKNMDALPENAKNYIYAVEDFIGAKVSSVSTSPER 418

Query: 421 ENTLIMSNPFE 431
           ++T+++ NPF+
Sbjct: 419 DDTILVENPFD 429


>gi|293417680|ref|ZP_06660302.1| adenylosuccinate synthetase [Escherichia coli B185]
 gi|291430398|gb|EFF03396.1| adenylosuccinate synthetase [Escherichia coli B185]
          Length = 432

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IE++  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEQLTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|39937355|ref|NP_949631.1| adenylosuccinate synthetase [Rhodopseudomonas palustris CGA009]
 gi|81829459|sp|Q6N1V9|PURA_RHOPA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|39651213|emb|CAE29736.1| adenylosuccinate synthetase [Rhodopseudomonas palustris CGA009]
          Length = 430

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 253/431 (58%), Positives = 327/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGQTYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV DP AF+ E++ L  QG+ ++P NLRIA N +LIL +HR+LD  RE 
Sbjct: 61  RPSKLAVIGNGVVFDPQAFLDEVKKLQGQGVAISPENLRIAENVTLILPLHRELDATREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D++ +  KIE+LL HHNALRR   +
Sbjct: 121 AAKAGA--IGTTQRGIGPAYEDKVGRRAIRLMDLADLDTLPTKIERLLAHHNALRRGLDQ 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    IL +L      +LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEIDAGQILADLSAMAPHLLPYAESVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTEL N+ G+ +   GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPGAVGYVLGICKAYTTRVGAGPFPTELTNEIGEEIGRRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++CVGY++DG+E+D+LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFDSVEVCVGYKLDGKEIDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TA  R +A+LP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTANARSWAELPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|260575459|ref|ZP_05843458.1| adenylosuccinate synthetase [Rhodobacter sp. SW2]
 gi|259022379|gb|EEW25676.1| adenylosuccinate synthetase [Rhodobacter sp. SW2]
          Length = 430

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 244/432 (56%), Positives = 309/432 (71%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++ +VYKLSLLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGVVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP A +SEIE L  QG+ V P+NL IA N  LIL +H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWALLSEIEKLRGQGVDVNPDNLIIAENTPLILPVHGELDRARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR +RV DL D   +  ++++LL HH+ALRR  G 
Sbjct: 120 -AQVGVAKIGTTGRGIGPAYEDKVGRRTVRVADLADEATLDLRLDRLLAHHDALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    +   L+    K+LP+   +W +L    R G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 EPVDRAALKTALLEVAPKVLPYAKPVWKILNEARRAGKRILFEGAQGSLLDVDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G+ P ++ +VLG+VKAYTTRVG GPFP EL +  GD L   G EFG
Sbjct: 239 TSSNTLAGMAATGTGLGPTAIDFVLGIVKAYTTRVGEGPFPAELFDADGDRLGARGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++   +GV GIALTKLDVLDG + LKICVGY +DG  +D+LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCATSGVTGIALTKLDVLDGFETLKICVGYMLDGVRLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  + GW ++TAG R +ADLP  A  Y+R+IEE+++ PVA+LS  PER
Sbjct: 359 TAADQQARVTPIYEEMPGWSETTAGARSWADLPGAAIKYVRRIEELIQCPVAMLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 419 EDTILVTDPFVD 430


>gi|296100944|ref|YP_003611090.1| adenylosuccinate synthetase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055403|gb|ADF60141.1| adenylosuccinate synthetase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 446

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 17  NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 76

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 77  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 135

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 136 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKA 193

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 194 DAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 253

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 254 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 313

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 314 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 373

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A +YI++IEE+ EVP+ ++S GP+
Sbjct: 374 PLAADDWEGIEPIYETMPGWSETTFGVKERSGLPQAALDYIKRIEELTEVPIDIISTGPD 433

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 434 RTETMILRDPFD 445


>gi|298292948|ref|YP_003694887.1| adenylosuccinate synthetase [Starkeya novella DSM 506]
 gi|296929459|gb|ADH90268.1| adenylosuccinate synthetase [Starkeya novella DSM 506]
          Length = 431

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 263/431 (61%), Positives = 327/431 (75%), Gaps = 1/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V +  YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGNTTYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  ++S+IG+ VV+DP A + EI  +  QG+ VTP  LR+A N +LIL +HR+LD +RE 
Sbjct: 61  RGARLSVIGNGVVLDPWALVDEIGRIGAQGVEVTPERLRVAENVALILPLHRELDAIREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +  G  IGTT+RGIGPAYED+VGRRAIR+MDL   + +  K+E+LL HHN LRR  G 
Sbjct: 121 AAAS-GTKIGTTKRGIGPAYEDKVGRRAIRLMDLAYPDTLDAKLERLLAHHNPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    + +EL+    K+LPFMD +W+LL+ E R G+ ILFEGAQG LLD DHGTYPFV
Sbjct: 180 AEVDAARLRDELLEVAPKVLPFMDRVWALLDDERRHGSKILFEGAQGALLDVDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ GSG+ PG++GYVLG+ KAYTTRVG GPFPTEL +  G  + E G EFG
Sbjct: 240 TSSNTVAAQAATGSGLGPGAIGYVLGITKAYTTRVGEGPFPTELDDAIGRKIGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D A VR++V  +G+ GIALTKLDVLDG +ELK+C  YR+DG E+D+LP
Sbjct: 300 TVTGRARRCGWFDAALVRQTVRTSGINGIALTKLDVLDGFEELKVCTRYRLDGEEIDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EPVY  +EGW+ STAG R +ADLP +A  Y+R+IEE++  PVALLS  PER
Sbjct: 360 AGQDAQAHVEPVYETIEGWRTSTAGARSWADLPAEAVKYVRRIEELIGCPVALLSTSPER 419

Query: 421 ENTLIMSNPFE 431
           ++T+++ NPFE
Sbjct: 420 DDTILVQNPFE 430


>gi|83312289|ref|YP_422553.1| adenylosuccinate synthetase [Magnetospirillum magneticum AMB-1]
 gi|123541261|sp|Q2W2D1|PURA_MAGSA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|82947130|dbj|BAE51994.1| Adenylosuccinate synthase [Magnetospirillum magneticum AMB-1]
          Length = 429

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 254/430 (59%), Positives = 308/430 (71%), Gaps = 3/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGK+VDWLSE ADV+VRFQGG+NAGHTL +N + YKLSLLPSGVV
Sbjct: 1   MANVAVVGAQWGDEGKGKVVDWLSERADVVVRFQGGHNAGHTLVINGVTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV+DP A ++EIE +  QG+ +TP  L+IA NA LIL +H  LD  RE 
Sbjct: 61  R-GKLSIIGNGVVIDPWALLAEIERIRAQGVEITPEVLKIAENACLILPLHAHLDKAREE 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A     A IGTT RGIGPAYEDRVGRRAIRV DL D   +  KI  LL HHNAL R  G 
Sbjct: 120 A--SGTAKIGTTGRGIGPAYEDRVGRRAIRVCDLADEAVLKAKIATLLRHHNALLRGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L +L+    KILPF DV+W  L+        +LFEGAQG +LD DHGTYP+V
Sbjct: 178 AEVDGAELLAKLLDVAPKILPFADVVWQHLDEVRHTRKRVLFEGAQGAMLDVDHGTYPYV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+S  A  GSG+ PG +GYVLG+ KAYTTRVG GPFPTEL ++ G  + E G EFG
Sbjct: 238 TSSNTVSGNAGTGSGVGPGQVGYVLGICKAYTTRVGEGPFPTELFDEIGKSIGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VR++V + G+ GIALTKLDVLDG  ELKIC GY++DG+ ++  P
Sbjct: 298 TVTGRPRRCGWFDAVMVRQAVKVGGITGIALTKLDVLDGFKELKICTGYKLDGKVINHFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EP+Y ++EGW QST G+R + DLP  A  YIR+IEE++E PVALLS  PER
Sbjct: 358 ASMTGQANVEPIYEVIEGWSQSTRGVRSWKDLPATAIKYIRRIEELIEAPVALLSTSPER 417

Query: 421 ENTLIMSNPF 430
           E+++++ +PF
Sbjct: 418 EDSILVHDPF 427


>gi|146342761|ref|YP_001207809.1| adenylosuccinate synthetase [Bradyrhizobium sp. ORS278]
 gi|166232427|sp|A4Z0B8|PURA_BRASO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|146195567|emb|CAL79594.1| Adenylosuccinate synthetase (IMP--aspartate ligase) (AdSS)
           (AMPSase) [Bradyrhizobium sp. ORS278]
          Length = 430

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 254/431 (58%), Positives = 326/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGATYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DP AF+ E+  L  QG+ ++P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RSGKLSVIGNGVVFDPQAFLDEVGKLQAQGLIISPDNLRVAENVTLILPLHRELDALRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIR+MDL D++ +  KI++LL HHNALRR  G 
Sbjct: 121 --SNTGTAIGTTRRGIGPAYEDKVGRRAIRLMDLADLDTLPHKIDRLLAHHNALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    IL EL     K+LP+ + +W LL+ + R+G  +LFEGAQG LLD DHGTYP+V
Sbjct: 179 ELIDGAEILRELTAVAPKLLPYAETVWRLLDIKRREGKRLLFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTE  N+TG  + E G+EFG
Sbjct: 239 TSSNTVAAQAATGAGLGPGAIGYVLGLCKAYTTRVGQGPFPTEQDNETGRKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++C GYR+DG+E+D  P
Sbjct: 299 TNTGRPRRCGWFDAVLVRQAVRTCGINGLALTKLDILDGFDTIEVCTGYRLDGKEIDHFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWKQ TA  R +ADLP QA  Y+R+IEE++  P+ALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKQPTANARSWADLPAQAIKYVRRIEELVGCPIALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|312862471|ref|ZP_07722714.1| adenylosuccinate synthase [Streptococcus vestibularis F0396]
 gi|322515861|ref|ZP_08068803.1| adenylosuccinate synthase [Streptococcus vestibularis ATCC 49124]
 gi|311102114|gb|EFQ60314.1| adenylosuccinate synthase [Streptococcus vestibularis F0396]
 gi|322125648|gb|EFX96975.1| adenylosuccinate synthase [Streptococcus vestibularis ATCC 49124]
          Length = 430

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 277/433 (63%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+E L  +G+  +  +LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELEYLHAEGV--STESLRISDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  + +++  L   N L     E
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFASRLKTNLAEKNRLFSKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E+ +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEELSFDEIFEEYYAYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL G D +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGFDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGCRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|325271230|ref|ZP_08137775.1| adenylosuccinate synthetase [Pseudomonas sp. TJI-51]
 gi|324103633|gb|EGC00935.1| adenylosuccinate synthetase [Pseudomonas sp. TJI-51]
          Length = 430

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 211/430 (49%), Positives = 283/430 (65%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+  A LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALMREITKLEEKGVPVR-ERLRISPAAPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RR +RV DL   E  + K+ +LL +HN    ++ ++
Sbjct: 122 R--GEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E++ P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQQTLDECMAYAEQLKPMMLDVTAELHNLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   S GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++TG  L + G EFG
Sbjct: 240 TSSNTTAGGISTGSGVGPMYLDYILGITKAYTTRVGSGPFPTELFDETGATLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           + T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + ICVGY+ +   V   P
Sbjct: 300 STTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICVGYKNENGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G++   +LP  ARNYI++IEE++  P+ ++S GP+R
Sbjct: 360 SDADSYIGLEPVYEAMPGWSESTLGVKTLEELPQAARNYIKRIEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|78043728|ref|YP_361459.1| adenylosuccinate synthetase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|90101582|sp|Q3A8S5|PURA_CARHZ RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|77995843|gb|ABB14742.1| adenylosuccinate synthetase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 427

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT VV++G QWGDEGKGKI D+L+E AD++VR+QGGNNAGHT+ V +  +KL L+PSG++
Sbjct: 1   MTTVVLIGTQWGDEGKGKITDFLAEKADLVVRYQGGNNAGHTVVVGENSFKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+ +IG+ VV+DP     E+E L  +G+  T  NL+I+  A LI+  H+ LD L E 
Sbjct: 61  YPEKICVIGNGVVIDPKVLKEELEYLRQRGV--TTANLKISLRAHLIMPYHKKLDELEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIE-QLLLHHNALRRSFG 179
                   IGTT+RGIGPAY D+  R  IRV DL D E  ++K+   L   +N L + +G
Sbjct: 119 --DKGENKIGTTKRGIGPAYRDKAARTGIRVCDLLDKELFAEKLALNLKEKNNLLEKIYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +   Y  +  E +   E I P+      L+      G  +LFEGAQG LLD DHGTYP+
Sbjct: 177 VEGFSYDELYHEYLEYAEIIRPYATDTSRLINDAIESGQKVLFEGAQGTLLDLDHGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+ ++  A IG+GI P  +  V+GVVKAYTTRVG GPFPTEL ++TG+FL++ G EF
Sbjct: 237 VTSSHPVAGAACIGAGIGPTKIHEVIGVVKAYTTRVGSGPFPTELLDETGEFLRKQGYEF 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGW D    R +  +NG+ G+A+TKLDVL GL  +KI VGYR +G+ ++  
Sbjct: 297 GTTTGRPRRCGWFDGVIARYAARVNGLSGLAVTKLDVLTGLKTIKIAVGYRFNGKVINEF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P      ++ EPVY  L GW +   G R   DLP  ARNY+RKIEE+  VP+ ++S+G  
Sbjct: 357 PASLKELSQCEPVYEELPGWSEDITGARKLTDLPENARNYLRKIEEITGVPIKIISVGTR 416

Query: 420 RENTLIMSNPF 430
           R+ T+I+   F
Sbjct: 417 RDQTIILDQVF 427


>gi|228478023|ref|ZP_04062634.1| adenylosuccinate synthetase [Streptococcus salivarius SK126]
 gi|228250203|gb|EEK09456.1| adenylosuccinate synthetase [Streptococcus salivarius SK126]
          Length = 430

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+E L  +G+  +  +LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELEYLHAEGV--STESLRISDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  + +++  L   N L     E
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFANRLKTNLAEKNRLFSKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E+ +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEELSFDEIFEEYYAYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGLDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGCRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|253681345|ref|ZP_04862143.1| adenylosuccinate synthase [Clostridium botulinum D str. 1873]
 gi|253562583|gb|EES92034.1| adenylosuccinate synthase [Clostridium botulinum D str. 1873]
          Length = 427

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 282/426 (66%), Gaps = 2/426 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E ADV+VRFQGGNNAGHT+ V +  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAETADVVVRFQGGNNAGHTVVVGEEEYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK++I+G+ VV+DP A   E++ L   G+ VTP  L+I++ A LI+  HR LD L+E 
Sbjct: 61  YEDKINILGNGVVIDPKALFEEMDYLEDLGVKVTPEKLKISDRAQLIMPYHRILDGLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IRV DL   +   +K+ Q +   N L   +G 
Sbjct: 121 ARGKND--IGTTGKGIGPAYTDKAERSGIRVCDLMHKDVFEEKLRQNINDKNELIGLYGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +++ +  + EE     E+I P++  I  ++  E ++  ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EKLDFNKVFEEYNTFAERIRPYVADISVIIYDEMKENKNVLFEGAQGSLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T++     G+G+ P ++   +G+ KAYTTRVG GPFPTEL ++ G+ L+E G E+G
Sbjct: 239 TSSSTVAGGVCTGAGVGPTAITGAVGIAKAYTTRVGKGPFPTELLDEMGEALREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  I+G+    +TK+D L GLD++K+C GY+ +G+ +D+ P
Sbjct: 299 VTTGRARRCGWLDLVILKSTARISGLTSFVVTKIDTLAGLDKIKVCTGYKFNGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + EPVY   +GW  S A  R + DLP  A+ Y++KIEE  +  V+++S+GP+R
Sbjct: 359 ASLEDLAKCEPVYEEFDGWDDSIAEARSYDDLPENAKIYLKKIEEFTDTKVSIVSVGPKR 418

Query: 421 ENTLIM 426
           + T+++
Sbjct: 419 DQTIVV 424


>gi|261342838|ref|ZP_05970696.1| adenylosuccinate synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288314880|gb|EFC53818.1| adenylosuccinate synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 432

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A +YI++IEE+ EVP+ ++S GP+
Sbjct: 360 PLAADDWEGIEPIYETMPGWSETTFGVKERSGLPQAALDYIKRIEELTEVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|242237992|ref|YP_002986173.1| adenylosuccinate synthetase [Dickeya dadantii Ech703]
 gi|242130049|gb|ACS84351.1| adenylosuccinate synthetase [Dickeya dadantii Ech703]
          Length = 432

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P AF+ E+ +L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDAFMKEMTALEARGVPVR-ERLLISEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K++ +L +HN     + + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAAKLKDILDYHNFQLVHYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKTLDDVLAVADILTSMVIDVSDLLYKAHERGDRVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVGGGPFPTEL +  G++L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGGGPFPTELFDDVGEYLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YR  DG+ +D  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRTADGKTIDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  L GW +ST G++ +  LP  ARNYI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGLEPVYESLPGWSESTFGVKDYNQLPQAARNYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|197287182|ref|YP_002153054.1| adenylosuccinate synthetase [Proteus mirabilis HI4320]
 gi|229576744|sp|B4F271|PURA_PROMH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|194684669|emb|CAR46608.1| adenylosuccinate synthetase [Proteus mirabilis HI4320]
          Length = 432

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 206/434 (47%), Positives = 296/434 (68%), Gaps = 6/434 (1%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+N VVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R + +SII + VV+ P A + E+  L  +GI V  + L ++    LIL  H  LD  RE
Sbjct: 61  LRENVVSIIANGVVLSPEALMKEMTQLEERGIPVR-SRLLLSEACPLILPYHIALDNARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D +  ++K+++++ +HN    ++ 
Sbjct: 120 KAR--GEKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKKAFAQKLKEIIEYHNFQLVNYY 177

Query: 180 E-KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + + V Y+  L+++M   + +   +  +  LL + ++KG  ++FEGAQG LLD DHGTYP
Sbjct: 178 KVEPVDYQKTLDDIMAIADILTGMVVDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG+ P  +GYVLG++KAY+TRVG GPFPTEL ++TGDFL+E G+E
Sbjct: 238 YVTSSNTTAGGVATGSGLGPRYVGYVLGIIKAYSTRVGAGPFPTELFDETGDFLREKGQE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R RR GWLD+ ++RR+V IN + G  +TKLDVLDGL E+K+CVGYR+ +G  ++
Sbjct: 298 FGATTGRSRRTGWLDIIAIRRAVQINSLSGFCMTKLDVLDGLKEVKVCVGYRLPNGEVIE 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P  +      EP+Y  + GW +ST G++  A LP  A NYI+++EE+  VPV ++S G
Sbjct: 358 TTPLAADDWEGIEPIYESMPGWNESTFGVKDKAQLPQAALNYIKRVEELTGVPVDIVSTG 417

Query: 418 PERENTLIMSNPFE 431
           P+R  T+I+ +PF+
Sbjct: 418 PDRSETIILRHPFD 431


>gi|172046247|sp|Q1QP77|PURA_NITHX RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
          Length = 430

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 257/431 (59%), Positives = 329/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKL+LLPSGVV
Sbjct: 1   MTNVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVIDGNTYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DP AF+ E+  L  QG+ + P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RSSKLSIIGNGVVFDPQAFVDEVAKLKGQGVKIGPDNLRVAENVTLILPLHRELDSLREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  K+E+LL HHNALRR  G 
Sbjct: 121 A--SAATAIGTTQRGIGPAYEDKVGRRAIRLMDLADPQTLPHKVERLLTHHNALRRGHGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L++L     ++LP+ D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 AEVDSGALLKDLAAIAPRVLPYADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P +LGYVLG+ K+YTTRVG GPFPTELK++ G+ + + GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPSALGYVLGICKSYTTRVGQGPFPTELKDEIGELIGQRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V  +G+ G+ALTKLD+LDG D +++C GYR+DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAMLVRQTVRTSGIHGLALTKLDILDGFDTIEVCTGYRLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWKQ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKQPTANARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|92116701|ref|YP_576430.1| adenylosuccinate synthetase [Nitrobacter hamburgensis X14]
 gi|91799595|gb|ABE61970.1| Adenylosuccinate synthetase [Nitrobacter hamburgensis X14]
          Length = 457

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 257/431 (59%), Positives = 329/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++   YKL+LLPSGVV
Sbjct: 28  MTNVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVIDGNTYKLALLPSGVV 87

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DP AF+ E+  L  QG+ + P+NLR+A N +LIL +HR+LD LRE 
Sbjct: 88  RSSKLSIIGNGVVFDPQAFVDEVAKLKGQGVKIGPDNLRVAENVTLILPLHRELDSLREN 147

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  K+E+LL HHNALRR  G 
Sbjct: 148 A--SAATAIGTTQRGIGPAYEDKVGRRAIRLMDLADPQTLPHKVERLLTHHNALRRGHGI 205

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +L++L     ++LP+ D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 206 AEVDSGALLKDLAAIAPRVLPYADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 265

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P +LGYVLG+ K+YTTRVG GPFPTELK++ G+ + + GKEFG
Sbjct: 266 TSSNTVAAQAATGTGMGPSALGYVLGICKSYTTRVGQGPFPTELKDEIGELIGQRGKEFG 325

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V  +G+ G+ALTKLD+LDG D +++C GYR+DG+E+D LP
Sbjct: 326 VNTGRKRRCGWFDAMLVRQTVRTSGIHGLALTKLDILDGFDTIEVCTGYRLDGKEIDHLP 385

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWKQ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 386 AGEGAQARVEPIYETIEGWKQPTANARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 445

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 446 EDTILVQNPFE 456


>gi|322386620|ref|ZP_08060245.1| adenylosuccinate synthase [Streptococcus cristatus ATCC 51100]
 gi|321269293|gb|EFX52228.1| adenylosuccinate synthase [Streptococcus cristatus ATCC 51100]
          Length = 430

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSNAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + +    I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SQAMSVDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|226326638|ref|ZP_03802156.1| hypothetical protein PROPEN_00488 [Proteus penneri ATCC 35198]
 gi|225204859|gb|EEG87213.1| hypothetical protein PROPEN_00488 [Proteus penneri ATCC 35198]
          Length = 432

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 205/434 (47%), Positives = 294/434 (67%), Gaps = 6/434 (1%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+N VVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R + +SII + VV+ P A + E+  L  +GI V  + L ++    LIL  H  LD  RE
Sbjct: 61  LRENVVSIIANGVVLSPEALMKEMTQLEDRGIPVR-SRLLLSEACPLILPYHIALDNARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D +  ++K+++++ +HN    ++ 
Sbjct: 120 KAR--GEKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKKAFAQKLKEIIEYHNFQLVNYY 177

Query: 180 E-KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + + V Y+  L+++M   + +   +  +  LL + ++ G  ++FEGAQG LLD DHGTYP
Sbjct: 178 KVEPVDYQKTLDDIMAIADILTGMVVDVSDLLYKATQNGELVMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG+ P  +GYVLG++KAY+TRVG GPFPTEL ++ GDFL+E G+E
Sbjct: 238 YVTSSNTTAGGVATGSGLGPRYVGYVLGIIKAYSTRVGAGPFPTELFDEVGDFLREKGQE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R RR GWLD+ ++RR+V IN + G  +TKLDVLDGL E+K+CVGYR+ +G  +D
Sbjct: 298 FGATTGRSRRTGWLDIVAIRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRLPNGEVID 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P  +      EP+Y  + GW +ST G++  A LP  A NYI+++EE+  VPV ++S G
Sbjct: 358 TTPLAADEWEGIEPIYESMPGWNESTFGVKDHAQLPQAALNYIKRVEELTGVPVDIVSTG 417

Query: 418 PERENTLIMSNPFE 431
           P+R  T+I+ +PF+
Sbjct: 418 PDRSETIILRHPFD 431


>gi|158426294|ref|YP_001527586.1| adenylosuccinate synthetase [Azorhizobium caulinodans ORS 571]
 gi|158333183|dbj|BAF90668.1| adenylosuccinate synthetase [Azorhizobium caulinodans ORS 571]
          Length = 451

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 254/430 (59%), Positives = 325/430 (75%), Gaps = 2/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+ + YKLSLLPSGVVR
Sbjct: 23  ANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVDGVTYKLSLLPSGVVR 82

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
           P K+S+IG+ VV+DP A + E+  L  QG+ V P+ LRIA N  LIL +HR+LD LRE A
Sbjct: 83  PGKLSVIGNGVVLDPQALVDELARLESQGVHVGPDRLRIAENTPLILPLHRELDALRENA 142

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
               G  IGTT+RGIGPAYED+VGRRAIR++DL D + +  K+E+LL HHN +RR  G +
Sbjct: 143 --SEGTRIGTTKRGIGPAYEDKVGRRAIRLVDLVDPKALPAKVERLLTHHNLIRRGLGVE 200

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
           EV  + +++EL+    K+LP+MD +W LL++  + G  ILFEGAQG LLD DHGTYP+VT
Sbjct: 201 EVNPQALVDELLALAPKVLPYMDRVWELLDKARKDGKKILFEGAQGALLDIDHGTYPYVT 260

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSNT+++ A+ GSG+ PG+L YVLG+ KAYTTRVG GPFPTEL ++ G  L   G+EFG 
Sbjct: 261 SSNTVASSAAGGSGVGPGALDYVLGITKAYTTRVGEGPFPTELTDEVGKTLGTKGREFGV 320

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPD 361
           VT R RRCGW D   VR++V   G+ GIALTKLDVLDG DE+K+CVGY++DG+E+D+ P 
Sbjct: 321 VTGRPRRCGWFDAVLVRQTVRTCGIHGIALTKLDVLDGFDEIKVCVGYKLDGKEIDYFPS 380

Query: 362 DSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERE 421
           +     R EP+Y  +EGW  STAG R +ADLP +A  Y+R +EE++  PVA+LS  PER 
Sbjct: 381 EMGAQARVEPIYETIEGWTDSTAGARSWADLPAEAVKYVRWLEELIGCPVAVLSTSPERN 440

Query: 422 NTLIMSNPFE 431
           +T+++ NPF+
Sbjct: 441 DTILVHNPFQ 450


>gi|5542175|pdb|1CG4|A Chain A, Structure Of The Mutant (R303l) Of Adenylosuccinate
           Synthetase From E. Coli Complexed With, Gdp,
           6-Phosphoryl- Imp, And Mg2+
          Length = 431

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T  +RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGLRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|227357124|ref|ZP_03841493.1| adenylosuccinate synthetase [Proteus mirabilis ATCC 29906]
 gi|227162656|gb|EEI47623.1| adenylosuccinate synthetase [Proteus mirabilis ATCC 29906]
          Length = 436

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 206/434 (47%), Positives = 296/434 (68%), Gaps = 6/434 (1%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+N VVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 5   MSNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 64

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R + +SII + VV+ P A + E+  L  +GI V  + L ++    LIL  H  LD  RE
Sbjct: 65  LRENVVSIIANGVVLSPEALMKEMTQLEERGIPVR-SRLLLSEACPLILPYHIALDNARE 123

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D +  ++K+++++ +HN    ++ 
Sbjct: 124 KAR--GEKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKKAFAQKLKEIIEYHNFQLVNYY 181

Query: 180 E-KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + + V Y+  L+++M   + +   +  +  LL + ++KG  ++FEGAQG LLD DHGTYP
Sbjct: 182 KVEPVDYQKTLDDIMAIADILTGMVVDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYP 241

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG+ P  +GYVLG++KAY+TRVG GPFPTEL ++TGDFL+E G+E
Sbjct: 242 YVTSSNTTAGGVATGSGLGPRYVGYVLGIIKAYSTRVGAGPFPTELFDETGDFLREKGQE 301

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R RR GWLD+ ++RR+V IN + G  +TKLDVLDGL E+K+CVGYR+ +G  ++
Sbjct: 302 FGATTGRSRRTGWLDIIAIRRAVQINSLSGFCMTKLDVLDGLKEVKVCVGYRLPNGEVIE 361

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P  +      EP+Y  + GW +ST G++  A LP  A NYI+++EE+  VPV ++S G
Sbjct: 362 TTPLAADDWEGIEPIYESMPGWNESTFGVKDKAQLPQAALNYIKRVEELTGVPVDIVSTG 421

Query: 418 PERENTLIMSNPFE 431
           P+R  T+I+ +PF+
Sbjct: 422 PDRSETIILRHPFD 435


>gi|313891154|ref|ZP_07824773.1| adenylosuccinate synthase [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120517|gb|EFR43637.1| adenylosuccinate synthase [Streptococcus pseudoporcinus SPIN 20026]
          Length = 430

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIALDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGANKIGTTIKGIGPAYMDKAARVGIRIADLLDKDTFAERLRINLAEKNRLFEKMYD 176

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SSALDFDAIFEEYYAYGQEIKKYVTDTSLILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL +  GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDAVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD LKICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTLKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|239832771|ref|ZP_04681100.1| adenylosuccinate synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239825038|gb|EEQ96606.1| adenylosuccinate synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 429

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 333/432 (77%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F+SE+E L  QGI + P+ LRIA NA LILSIHRDLD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVSEVEKLRAQGIDINPDVLRIAENAPLILSIHRDLDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DL + E +  K+E+LL HHN LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLAEPETLEPKVERLLAHHNLLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + G  ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGDRILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGLDE+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGITGIALTKLDVLDGLDEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|172048300|sp|A5VS40|PURA_BRUO2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
          Length = 429

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 338/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y++DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYKLDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|149192030|ref|ZP_01870257.1| adenylosuccinate synthetase [Vibrio shilonii AK1]
 gi|148834131|gb|EDL51141.1| adenylosuccinate synthetase [Vibrio shilonii AK1]
          Length = 438

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 200/438 (45%), Positives = 272/438 (62%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNIKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEVFAEKLKEVMEFHNFQLEHFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y  +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DTVSYDEVLEQCMGYADLLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR+V IN + G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAVQINSISGFCLTKLDVLDGLEELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G      LP  A +YI++IEE+  VPV +
Sbjct: 360 SILEVSPMAAEAFEEATPIYETMPGWSETTFGATSIEQLPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I   PFE
Sbjct: 420 ISTGPDRNETIIKVQPFE 437


>gi|170744869|ref|YP_001773524.1| adenylosuccinate synthase [Methylobacterium sp. 4-46]
 gi|229576721|sp|B0UJ78|PURA_METS4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|168199143|gb|ACA21090.1| Adenylosuccinate synthase [Methylobacterium sp. 4-46]
          Length = 430

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 258/432 (59%), Positives = 323/432 (74%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWL+E ADV+VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLAEQADVVVRFQGGHNAGHTLVIDGVTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VVVDP   + EI  +  QG+ +TP  LRIA+NA+LIL +HR+LD  RE 
Sbjct: 61  RGGTLSVIGNGVVVDPWHLVDEIARIGTQGVSITPETLRIADNATLILPLHRELDHFRET 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV+DL D   +  KIE+LL HHNALRR  G 
Sbjct: 121 A--NATLKIGTTKRGIGPAYEDKVGRRAIRVVDLADEALLGAKIERLLAHHNALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +EV    +  EL+    KILP+ D +W LL+   R G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 EEVDGAALKAELLAIAPKILPYADTVWVLLDEARRGGQRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++AQA+ GSG+ P ++GYVLG+VKAYTTRVG GPFPTEL +  G+ + E G+EFG
Sbjct: 239 TSSNIVAAQAATGSGLGPSAIGYVLGIVKAYTTRVGEGPFPTELTDAIGEKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR++V  +G+ GIALTKLD+LDG + +KIC GYR+DGR +D LP
Sbjct: 299 VVTGRKRRCGWFDAALVRQTVRTSGIDGIALTKLDILDGFETIKICTGYRLDGRLIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  ++GW ++TAG R +A+LP QA  Y+R+IEE++   VALLS  PER
Sbjct: 359 ASQADQARVEPVYETIDGWFETTAGARSWAELPAQAIKYVRRIEELIGATVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPFED
Sbjct: 419 DDTILVHNPFED 430


>gi|322374039|ref|ZP_08048573.1| adenylosuccinate synthase [Streptococcus sp. C150]
 gi|321277005|gb|EFX54076.1| adenylosuccinate synthase [Streptococcus sp. C150]
          Length = 430

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 189/433 (43%), Positives = 282/433 (65%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+E L  +G+  + ++LR+++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELEYLHAEGV--STDSLRVSDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
           A       IGTT +GIGPAY D+  R  IR+ DL D E  +++++  L   N L  + +G
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEVFAERLKTNLAEKNRLFTKMYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEGLSFDDIFEEYYAYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL +  G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELSDGVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGCRSLDELPENARNYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|206579080|ref|YP_002240866.1| adenylosuccinate synthetase [Klebsiella pneumoniae 342]
 gi|226709083|sp|B5Y325|PURA_KLEP3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|206568138|gb|ACI09914.1| adenylosuccinate synthetase [Klebsiella pneumoniae 342]
          Length = 432

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI++IEE+  VPV ++S GP+
Sbjct: 360 PLAADNWEGIEPIYETMPGWSETTFGVKERSGLPQAALNYIQRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|23502541|ref|NP_698668.1| adenylosuccinate synthetase [Brucella suis 1330]
 gi|62290555|ref|YP_222348.1| adenylosuccinate synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82700471|ref|YP_415045.1| adenylosuccinate synthetase [Brucella melitensis biovar Abortus
           2308]
 gi|161619614|ref|YP_001593501.1| adenylosuccinate synthetase [Brucella canis ATCC 23365]
 gi|225853140|ref|YP_002733373.1| adenylosuccinate synthetase [Brucella melitensis ATCC 23457]
 gi|254689852|ref|ZP_05153106.1| adenylosuccinate synthetase [Brucella abortus bv. 6 str. 870]
 gi|254694345|ref|ZP_05156173.1| adenylosuccinate synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|254698001|ref|ZP_05159829.1| adenylosuccinate synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700345|ref|ZP_05162173.1| adenylosuccinate synthetase [Brucella suis bv. 5 str. 513]
 gi|254703464|ref|ZP_05165292.1| adenylosuccinate synthetase [Brucella suis bv. 3 str. 686]
 gi|254708449|ref|ZP_05170277.1| adenylosuccinate synthetase [Brucella pinnipedialis M163/99/10]
 gi|254708698|ref|ZP_05170509.1| adenylosuccinate synthetase [Brucella pinnipedialis B2/94]
 gi|254714545|ref|ZP_05176356.1| adenylosuccinate synthetase [Brucella ceti M644/93/1]
 gi|254717442|ref|ZP_05179253.1| adenylosuccinate synthetase [Brucella ceti M13/05/1]
 gi|254730887|ref|ZP_05189465.1| adenylosuccinate synthetase [Brucella abortus bv. 4 str. 292]
 gi|256030224|ref|ZP_05443838.1| adenylosuccinate synthetase [Brucella pinnipedialis M292/94/1]
 gi|256045294|ref|ZP_05448188.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061721|ref|ZP_05451858.1| adenylosuccinate synthetase [Brucella neotomae 5K33]
 gi|256114252|ref|ZP_05454997.1| adenylosuccinate synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|256160398|ref|ZP_05458088.1| adenylosuccinate synthetase [Brucella ceti M490/95/1]
 gi|256255606|ref|ZP_05461142.1| adenylosuccinate synthetase [Brucella ceti B1/94]
 gi|256258106|ref|ZP_05463642.1| adenylosuccinate synthetase [Brucella abortus bv. 9 str. C68]
 gi|256263369|ref|ZP_05465901.1| adenylosuccinate synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370093|ref|YP_003107604.1| adenylosuccinate synthetase [Brucella microti CCM 4915]
 gi|260167899|ref|ZP_05754710.1| adenylosuccinate synthetase [Brucella sp. F5/99]
 gi|260547199|ref|ZP_05822937.1| adenylosuccinate synthetase [Brucella abortus NCTC 8038]
 gi|260565814|ref|ZP_05836297.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260568771|ref|ZP_05839239.1| adenylosuccinate synthetase [Brucella suis bv. 4 str. 40]
 gi|260755384|ref|ZP_05867732.1| adenylosuccinate synthetase [Brucella abortus bv. 6 str. 870]
 gi|260758605|ref|ZP_05870953.1| adenylosuccinate synthetase [Brucella abortus bv. 4 str. 292]
 gi|260762437|ref|ZP_05874774.1| adenylosuccinate synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884400|ref|ZP_05896014.1| adenylosuccinate synthetase [Brucella abortus bv. 9 str. C68]
 gi|261214653|ref|ZP_05928934.1| adenylosuccinate synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261219274|ref|ZP_05933555.1| adenylosuccinate synthetase [Brucella ceti M13/05/1]
 gi|261222810|ref|ZP_05937091.1| adenylosuccinate synthetase [Brucella ceti B1/94]
 gi|261315948|ref|ZP_05955145.1| adenylosuccinate synthetase [Brucella pinnipedialis M163/99/10]
 gi|261316190|ref|ZP_05955387.1| adenylosuccinate synthetase [Brucella pinnipedialis B2/94]
 gi|261322335|ref|ZP_05961532.1| adenylosuccinate synthetase [Brucella ceti M644/93/1]
 gi|261325726|ref|ZP_05964923.1| adenylosuccinate synthetase [Brucella neotomae 5K33]
 gi|261750840|ref|ZP_05994549.1| adenylosuccinate synthetase [Brucella suis bv. 5 str. 513]
 gi|261754093|ref|ZP_05997802.1| adenylosuccinate synthetase [Brucella suis bv. 3 str. 686]
 gi|261757338|ref|ZP_06001047.1| adenylosuccinate synthetase [Brucella sp. F5/99]
 gi|265987253|ref|ZP_06099810.1| adenylosuccinate synthetase [Brucella pinnipedialis M292/94/1]
 gi|265991720|ref|ZP_06104277.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995557|ref|ZP_06108114.1| adenylosuccinate synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|265998768|ref|ZP_06111325.1| adenylosuccinate synthetase [Brucella ceti M490/95/1]
 gi|294850935|ref|ZP_06791611.1| adenylosuccinate synthetase [Brucella sp. NVSL 07-0026]
 gi|306844676|ref|ZP_07477261.1| adenylosuccinate synthetase [Brucella sp. BO1]
 gi|54038930|sp|P65879|PURA_BRUSU RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|54041745|sp|P65878|PURA_BRUME RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|88930438|sp|Q2YQI5|PURA_BRUA2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|90101581|sp|P0C115|PURA_BRUAB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|189038294|sp|A9M7I3|PURA_BRUC2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254784037|sp|C0REU7|PURA_BRUMB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|23348540|gb|AAN30583.1| adenylosuccinate synthetase [Brucella suis 1330]
 gi|62196687|gb|AAX74987.1| PurA, adenylosuccinate synthetase [Brucella abortus bv. 1 str.
           9-941]
 gi|82616572|emb|CAJ11651.1| Adenylosuccinate synthetase [Brucella melitensis biovar Abortus
           2308]
 gi|161336425|gb|ABX62730.1| adenylosuccinate synthetase [Brucella canis ATCC 23365]
 gi|225641505|gb|ACO01419.1| adenylosuccinate synthetase [Brucella melitensis ATCC 23457]
 gi|256000256|gb|ACU48655.1| adenylosuccinate synthetase [Brucella microti CCM 4915]
 gi|260095564|gb|EEW79442.1| adenylosuccinate synthetase [Brucella abortus NCTC 8038]
 gi|260151187|gb|EEW86282.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260154155|gb|EEW89237.1| adenylosuccinate synthetase [Brucella suis bv. 4 str. 40]
 gi|260668923|gb|EEX55863.1| adenylosuccinate synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672863|gb|EEX59684.1| adenylosuccinate synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675492|gb|EEX62313.1| adenylosuccinate synthetase [Brucella abortus bv. 6 str. 870]
 gi|260873928|gb|EEX80997.1| adenylosuccinate synthetase [Brucella abortus bv. 9 str. C68]
 gi|260916260|gb|EEX83121.1| adenylosuccinate synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260921394|gb|EEX88047.1| adenylosuccinate synthetase [Brucella ceti B1/94]
 gi|260924363|gb|EEX90931.1| adenylosuccinate synthetase [Brucella ceti M13/05/1]
 gi|261295025|gb|EEX98521.1| adenylosuccinate synthetase [Brucella ceti M644/93/1]
 gi|261295413|gb|EEX98909.1| adenylosuccinate synthetase [Brucella pinnipedialis B2/94]
 gi|261301706|gb|EEY05203.1| adenylosuccinate synthetase [Brucella neotomae 5K33]
 gi|261304974|gb|EEY08471.1| adenylosuccinate synthetase [Brucella pinnipedialis M163/99/10]
 gi|261737322|gb|EEY25318.1| adenylosuccinate synthetase [Brucella sp. F5/99]
 gi|261740593|gb|EEY28519.1| adenylosuccinate synthetase [Brucella suis bv. 5 str. 513]
 gi|261743846|gb|EEY31772.1| adenylosuccinate synthetase [Brucella suis bv. 3 str. 686]
 gi|262553457|gb|EEZ09226.1| adenylosuccinate synthetase [Brucella ceti M490/95/1]
 gi|262766841|gb|EEZ12459.1| adenylosuccinate synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263002676|gb|EEZ15079.1| adenylosuccinate synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093367|gb|EEZ17436.1| adenylosuccinate synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659450|gb|EEZ29711.1| adenylosuccinate synthetase [Brucella pinnipedialis M292/94/1]
 gi|294821578|gb|EFG38574.1| adenylosuccinate synthetase [Brucella sp. NVSL 07-0026]
 gi|306274848|gb|EFM56618.1| adenylosuccinate synthetase [Brucella sp. BO1]
 gi|326409696|gb|ADZ66761.1| adenylosuccinate synthetase [Brucella melitensis M28]
 gi|326539404|gb|ADZ87619.1| adenylosuccinate synthetase [Brucella melitensis M5-90]
          Length = 429

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 337/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|74316625|ref|YP_314365.1| adenylosuccinate synthetase [Thiobacillus denitrificans ATCC 25259]
 gi|90101724|sp|Q3SL57|PURA_THIDA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|74056120|gb|AAZ96560.1| adenylosuccinate synthetase [Thiobacillus denitrificans ATCC 25259]
          Length = 432

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/431 (48%), Positives = 290/431 (67%), Gaps = 4/431 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVDWL++ A  +VRFQGG+NAGHTL V      L L+PSG++R
Sbjct: 4   KNVVVIGTQWGDEGKGKIVDWLTDRAQGVVRFQGGHNAGHTLVVGGKKTVLHLIPSGILR 63

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +    IG+ VV+ P A + E++ L   G+ V  + L+I+    LI+  H  LD  RE A
Sbjct: 64  DNVTCYIGNGVVLAPDALLKEMDMLEAAGVDVA-SRLKISEACPLIMPHHVALDQAREIA 122

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RRA+R+ DL   E  + K+ ++L HHN + +++ + 
Sbjct: 123 --KGAGKIGTTGRGIGPAYEDKVARRALRLQDLFHRERFAAKLGEVLDHHNFMLKNYYKV 180

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           EV  +   L+ +M   E++ P +  +   L   ++ G ++LFEGAQG LLD DHGTYPFV
Sbjct: 181 EVVSFNQTLDGMMAMAERLKPMVADVPRSLYEANKAGGNLLFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN  +  A+ GSG+ P ++ YVLG+ KAYTTRVG GPFPTEL +  G +L E G EFG
Sbjct: 241 TSSNCTAGGAATGSGVGPSAMHYVLGITKAYTTRVGSGPFPTELFDDVGQYLGEKGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T RQRRCGW D A+++RS+ INGV G+ +TKLDVLDGL+ +++CVGY++DG   D LP
Sbjct: 301 ATTGRQRRCGWFDAAALKRSIQINGVSGLCVTKLDVLDGLETVRVCVGYKIDGEACDILP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +   T  EP+Y  L GW  +T G+++F  LP +A+ Y++++EE+ EVPV ++S GP+R
Sbjct: 361 VGAESITNVEPIYEDLPGWSDTTVGVQMFDKLPQKAQTYLKRMEELCEVPVDVVSTGPDR 420

Query: 421 ENTLIMSNPFE 431
             T++  +P+E
Sbjct: 421 VETIVRRHPYE 431


>gi|262283586|ref|ZP_06061351.1| adenylosuccinate synthetase [Streptococcus sp. 2_1_36FAA]
 gi|262260643|gb|EEY79344.1| adenylosuccinate synthetase [Streptococcus sp. 2_1_36FAA]
          Length = 430

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFRERLERNLAEKNRLFERLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAINFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRKLEDLPENARNYVRRVSELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|116628604|ref|YP_821223.1| adenylosuccinate synthetase [Streptococcus thermophilus LMD-9]
 gi|122266802|sp|Q03IE5|PURA_STRTD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|116101881|gb|ABJ67027.1| Adenylosuccinate synthetase [Streptococcus thermophilus LMD-9]
 gi|312279265|gb|ADQ63922.1| Adenylosuccinate synthetase [Streptococcus thermophilus ND03]
          Length = 430

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVV+G QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSGV 
Sbjct: 1   MTSVVVIGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGVF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+E L  +G+  +  NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELEYLHTEGV--STENLRISDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  + +++  L   N L     E
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFASRLKTNLAEKNRLFSKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E+ +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEELSFDEIFEEYYAYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGLDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R+I E++ + ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGCRSLDELPENARNYVRRIGELVGIRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|59712925|ref|YP_205701.1| adenylosuccinate synthetase [Vibrio fischeri ES114]
 gi|197336047|ref|YP_002157114.1| adenylosuccinate synthetase [Vibrio fischeri MJ11]
 gi|71648814|sp|Q5E2D3|PURA_VIBF1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|59481026|gb|AAW86813.1| adenylosuccinate synthetase [Vibrio fischeri ES114]
 gi|197317537|gb|ACH66984.1| adenylosuccinate synthetase [Vibrio fischeri MJ11]
          Length = 438

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 200/438 (45%), Positives = 276/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +GI V    L I+    LIL  H  LD  RE A
Sbjct: 63  DNVECIIGNGVVLSPDALLKEMAPLEARGIPVR-ERLFISEACPLILPYHVALDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++  HN    ++ + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLFDKVAFAEKLKEVMEFHNFALVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYEEVLEQAMSYADLLTSMVIDVTDTLDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPT      E ++  G  L  
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGITKAYCTRVGSGPFPTELYDGLEKQDPIGKHLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLSGMCLTKLDVLDGLEELKICTGYQMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       PVY  + GW ++T G +   +LP  A NYI++IE++  VP+ +
Sbjct: 360 SLLEVSPMAAEAFEEATPVYETMPGWSENTFGAKTLEELPQAALNYIKRIEDLTGVPIDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PF+
Sbjct: 420 ISTGPDRNETIIKVHPFQ 437


>gi|123440765|ref|YP_001004757.1| adenylosuccinate synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166234008|sp|A1JIS0|PURA_YERE8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122087726|emb|CAL10511.1| adenylosuccinate synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 432

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMTDLEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+E++   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDEVLAIADILTAMVVDVSELLDSARKRGDFMMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 300 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW + T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETMPGWSEVTFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|55821911|ref|YP_140353.1| adenylosuccinate synthetase [Streptococcus thermophilus LMG 18311]
 gi|55823827|ref|YP_142268.1| adenylosuccinate synthetase [Streptococcus thermophilus CNRZ1066]
 gi|81820216|sp|Q5LXQ5|PURA_STRT1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|81820381|sp|Q5M2A7|PURA_STRT2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|55737896|gb|AAV61538.1| adenylosuccinate synthetase [Streptococcus thermophilus LMG 18311]
 gi|55739812|gb|AAV63453.1| adenylosuccinate synthetase [Streptococcus thermophilus CNRZ1066]
          Length = 430

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 193/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVV+G QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSGV 
Sbjct: 1   MTSVVVIGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGVF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+E L  +G+  +  NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELEYLHTEGV--STENLRISDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  + +++  L   N L     E
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFASRLKTNLAEKNRLFSKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E+ +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEELSFDEIFEEYYAYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSGI P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGIGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGLDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R+I E++ + ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGCRSLDELPENARNYVRRIGELVGIRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|323137384|ref|ZP_08072462.1| adenylosuccinate synthetase [Methylocystis sp. ATCC 49242]
 gi|322397371|gb|EFX99894.1| adenylosuccinate synthetase [Methylocystis sp. ATCC 49242]
          Length = 430

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 252/432 (58%), Positives = 322/432 (74%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL ++ + YKL+LLPSG+V
Sbjct: 1   MANVAVVGAQWGDEGKGKIVDWLSLEADVVVRFQGGHNAGHTLVIDGVTYKLALLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VVVDPH  + EI+ L  QG+ ++P N ++A NA LILS+HR+LD  RE 
Sbjct: 61  RPGKLSVIGNGVVVDPHFLVGEIDRLREQGVAISPVNFKVAENAPLILSLHRELDAHREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A    G+ IGTT+RGIGPAYED+VGRR+IR+MDL + + +  KI ++L HHN LRR  G 
Sbjct: 121 A--GGGSKIGTTKRGIGPAYEDKVGRRSIRLMDLAEPDTLDDKIARVLAHHNPLRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV   T+ EEL+    +ILPFMD +W LL+ E R G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEVAPATLREELLGVAPRILPFMDAVWDLLDAERRAGKRILFEGAQGVLLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ PG++GYVLG+ KAYTTRVGGGPFPTEL ++ G  + + G EFG
Sbjct: 239 TSSNTVAASAASGSGLGPGAIGYVLGIAKAYTTRVGGGPFPTELHDEIGTLIGDRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D    R++V  +G+ G+ALTKLD+LDG DE++IC  Y +DG  +D LP
Sbjct: 299 TNTGRRRRCGWFDAVLTRQAVKTSGINGVALTKLDILDGFDEIRICTHYMLDGARIDRLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY    GWK+ST+G R +  LP QA  Y+R+IEE++E PVALLS  PER
Sbjct: 359 ASQAAQARVTPVYESFPGWKESTSGARSWGALPAQAVKYVRRIEELIEAPVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPF+D
Sbjct: 419 DDTILVHNPFQD 430


>gi|222152346|ref|YP_002561521.1| adenylosuccinate synthetase [Streptococcus uberis 0140J]
 gi|254788723|sp|B9DT31|PURA_STRU0 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|222113157|emb|CAR40590.1| adenylosuccinate synthetase [Streptococcus uberis 0140J]
          Length = 430

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 194/433 (44%), Positives = 276/433 (63%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +GI  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGI--TTDNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFAERLRINLAEKNRLFEKMYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E   + +I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEALDFDSIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLDDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWAN 429


>gi|307706898|ref|ZP_07643699.1| adenylosuccinate synthetase [Streptococcus mitis SK321]
 gi|307710058|ref|ZP_07646502.1| adenylosuccinate synthetase [Streptococcus mitis SK564]
 gi|301800991|emb|CBW33653.1| adenylosuccinate synthetase [Streptococcus pneumoniae INV200]
 gi|307617690|gb|EFN96856.1| adenylosuccinate synthetase [Streptococcus mitis SK321]
 gi|307619038|gb|EFN98170.1| adenylosuccinate synthetase [Streptococcus mitis SK564]
          Length = 428

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIAFDDIFEEYYEYGQQIKKYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|220927318|ref|YP_002502620.1| adenylosuccinate synthetase [Methylobacterium nodulans ORS 2060]
 gi|254788712|sp|B8IPM5|PURA_METNO RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|219951925|gb|ACL62317.1| adenylosuccinate synthetase [Methylobacterium nodulans ORS 2060]
          Length = 430

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 259/432 (59%), Positives = 324/432 (75%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWL+E ADV+VRFQGG+NAGHTL ++   YKLSLLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLAEQADVVVRFQGGHNAGHTLVIDGTTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VVVDP   + EI  L  QG+ +TP  LRIA+NA+LIL +HR+LD  RE 
Sbjct: 61  RGGTLSVIGNGVVVDPWHLVDEIARLGQQGVTITPETLRIADNATLILPLHRELDHFRET 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV+DL D + +  KIE+LL HHNALRR  G 
Sbjct: 121 A--NATLRIGTTKRGIGPAYEDKVGRRAIRVVDLADADLLGAKIERLLAHHNALRRGLGI 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +EV    +  EL+    +ILPF D +W+LL+   R G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 EEVDGAALKTELLAIAPRILPFADTVWALLDEARRAGRRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++AQA+ GSG+ P ++GYVLG+VKAYTTRVG GPFPTEL +  G+ + E G+EFG
Sbjct: 239 TSSNIVAAQAATGSGLGPSAIGYVLGIVKAYTTRVGEGPFPTELTDAIGEKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D A VR++V  +G+ GIALTKLD+LDG + +KIC GYR+DGR +D LP
Sbjct: 299 VVTGRKRRCGWFDAALVRQTVRTSGIDGIALTKLDILDGFETIKICTGYRLDGRIIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  ++GW ++TAG R +A+LP QA  Y+R+IEE++   VALLS  PER
Sbjct: 359 ASQADQARVEPVYETIDGWFETTAGARSWAELPAQAIKYVRRIEELIGATVALLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPFED
Sbjct: 419 DDTILVHNPFED 430


>gi|224826459|ref|ZP_03699561.1| Adenylosuccinate synthase [Lutiella nitroferrum 2002]
 gi|224601560|gb|EEG07741.1| Adenylosuccinate synthase [Lutiella nitroferrum 2002]
          Length = 431

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 219/432 (50%), Positives = 294/432 (68%), Gaps = 5/432 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVVV+G QWGDEGKGKIVDWL+++A  +VRFQGG+NAGHTL V      L L+PSG+
Sbjct: 1   MSKNVVVIGTQWGDEGKGKIVDWLTDHARGVVRFQGGHNAGHTLVVGGKKTVLRLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R      IG+ VV+ P A + EI+ L   GI V  + L+IA N +LI+  H  LD  RE
Sbjct: 61  LREGVDCFIGNGVVLSPEALLKEIDELESAGIDVA-SRLKIAENCTLIMPYHVALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSF 178
            A       IGTT RGIGPAYED+V RRA+RV+DL D E  + K+++ L ++N  L + F
Sbjct: 120 AA--KGAGKIGTTGRGIGPAYEDKVARRALRVIDLFDAELFAAKLKENLDYYNFQLTQYF 177

Query: 179 GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
             + V + + LE  M   E+I P +  +   L   ++    +LFEGAQG LLD DHGTYP
Sbjct: 178 KSEPVDFTSTLETTMQLAERIKPMVADVSRTLYELNKADVPLLFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           FVTSSN ++  A+ G+G++P  L YVLG+VK YTTRVG GPFPTE +N  G FL + G E
Sbjct: 238 FVTSSNCVAGAAAPGAGVAPQMLNYVLGIVKGYTTRVGSGPFPTEQENDIGAFLAKRGNE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDF 358
           FG+VT R RRCGW D A+++RS+ INGV G+ +TKLDV+DGL+E+ +CVGY++DG+EVD 
Sbjct: 298 FGSVTGRPRRCGWFDAAALKRSIQINGVSGLCVTKLDVMDGLEEILLCVGYKIDGKEVDI 357

Query: 359 LPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGP 418
           LP  S    + EP+Y  + GW  ST G++ + DLP  AR Y+ +I E+ E PV ++S GP
Sbjct: 358 LPFGSEAVAKCEPIYETMPGWSDSTFGVKKWDDLPENARAYLTRIAEICEAPVDIISTGP 417

Query: 419 ERENTLIMSNPF 430
           +RE T++M +PF
Sbjct: 418 DREETIVMRHPF 429


>gi|260467079|ref|ZP_05813259.1| adenylosuccinate synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259029188|gb|EEW30484.1| adenylosuccinate synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 432

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 271/432 (62%), Positives = 336/432 (77%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+  VYKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVVDGKVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+SIIG+ VV DPHAF++E+  L  QG+ VTP+ L+IA N +LILS+HR+LD  RE 
Sbjct: 61  RQGKLSIIGNGVVFDPHAFVAEVAKLKAQGVEVTPDRLKIAENTALILSLHRELDGFRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +  G  IGTT+RGIGPAYED+VGRRA+RVMDL D+E +  K+++LL HHNALRR  G 
Sbjct: 121 AATNSGTKIGTTRRGIGPAYEDKVGRRAVRVMDLADLETLPLKVDRLLTHHNALRRGLGH 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV +  I+ EL    ++ILP+MD +W +L+ + R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 181 AEVTHDAIMTELTSVADEILPYMDRVWKILDDKRRAGERILFEGAQGTLLDIDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ G+G+ PG++GYVLG+ KAYTTRVG GPFPTE KN+ G+FL   G EFG
Sbjct: 241 TSSNTVAGQAAAGAGVGPGAIGYVLGITKAYTTRVGEGPFPTEQKNEVGEFLGTRGHEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V +NG+KGIALTKLDVLDGLDE+K+C GY +DG  +D+LP
Sbjct: 301 VVTGRKRRCGWFDAVLVRQAVAVNGIKGIALTKLDVLDGLDEIKVCTGYSLDGEAIDYLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EPVY  LEGWK +TAG R + DLP QA  Y+R IEE++  PVALLS  PER
Sbjct: 361 ASQGAQARVEPVYETLEGWKGTTAGARSWNDLPAQAVKYVRYIEELIGAPVALLSTSPER 420

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF+D
Sbjct: 421 DDTILVTDPFQD 432


>gi|90425561|ref|YP_533931.1| adenylosuccinate synthetase [Rhodopseudomonas palustris BisB18]
 gi|122475331|sp|Q20Z24|PURA_RHOPB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|90107575|gb|ABD89612.1| Adenylosuccinate synthetase [Rhodopseudomonas palustris BisB18]
          Length = 430

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 255/431 (59%), Positives = 327/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGQTYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV DP AF+ E++ L  QG+ ++P+NLRIA N +LIL +HR+LD LRE 
Sbjct: 61  RPSKLSVIGNGVVFDPQAFLDEVKKLQDQGVAISPDNLRIAENVTLILPLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D+  +  KI++LL HHNALRR F  
Sbjct: 121 A--SKATAIGTTQRGIGPAYEDKVGRRAIRLMDLADLATLPPKIDRLLAHHNALRRGFSL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E     IL+EL     K+LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEFDAGKILQELTAFAPKLLPYAETVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P ++GYVLG+ KAYTTRVG GPFPTEL N+ G+ +   GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPSTVGYVLGICKAYTTRVGQGPFPTELTNEIGEEIGRRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++CVGY +DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFDSIEVCVGYMLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 +R EP+Y  +EGWK+ TA  R +ADLP QA  Y+R++EE++  P+ALLS  PER
Sbjct: 359 AGEGAQSRVEPIYETIEGWKEPTANARSWADLPAQAIKYVRRVEELVGCPIALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|320539672|ref|ZP_08039336.1| adenylosuccinate synthetase [Serratia symbiotica str. Tucson]
 gi|320030284|gb|EFW12299.1| adenylosuccinate synthetase [Serratia symbiotica str. Tucson]
          Length = 432

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMGELEARGIPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVSDLLNKETFAVKLKEVVDYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+  L+ ++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQATLDYVLSIADILTAMVVDVSELLDNARKRGELIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG++L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEYLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGRE+   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREMTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A +YI++IEE+  +PV ++S GP+
Sbjct: 360 PLAAEDWEGIEPIYESMPGWSESTFGVKEHSKLPQAALDYIKRIEELTGIPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|126725626|ref|ZP_01741468.1| adenylosuccinate synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126704830|gb|EBA03921.1| adenylosuccinate synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 430

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 239/432 (55%), Positives = 305/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLSE AD+I RFQGG+NAGHTL ++  V+KLSLLPSG++
Sbjct: 1   MANVAVVGTQWGDEGKGKIVDWLSERADIIARFQGGHNAGHTLVIDGEVFKLSLLPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+ +IG+ VV+DP A   EIE +  +G+ V+P NL IA N  LIL +H +LD  REG
Sbjct: 61  REGKLGVIGNGVVLDPWALGEEIERITSRGVKVSPENLMIAENTPLILPVHGELDRAREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED+VGRR +RV DL D   +  ++++LL+HH+ALRR  G 
Sbjct: 121 --QNAVAKIGTTGRGIGPAYEDKVGRRTVRVADLADEATLDARLDRLLIHHDALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV    +  +LM    KILPF   +W +L    + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 AEVDRADLKAKLMEIAPKILPFAKPVWKILNDRRKAGDRILFEGAQGSLLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS T++  A+ G+G+ P S+ +VLG+VKAYTTRVG GPF  EL +  G+ L  VG E G
Sbjct: 239 TSSTTLAGAAATGTGLGPNSVNFVLGIVKAYTTRVGEGPFACELFDDVGEHLATVGHEKG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VR++  ++GVKGIALTKLDVLDGL ELKICVGY +DG  +D+LP
Sbjct: 299 TVTGRSRRCGWFDAVLVRQTCALSGVKGIALTKLDVLDGLKELKICVGYDLDGERLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  +EGW   T G R +A+LP  A  Y+R+IEE+++ PVA+LS  PER
Sbjct: 359 TAADQQARVTPIYETMEGWDDVTVGARSWAELPAAAIKYVRRIEELIDCPVAMLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 419 DDTILVTDPFAD 430


>gi|332365218|gb|EGJ42981.1| adenylosuccinate synthase [Streptococcus sanguinis SK1059]
          Length = 430

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 279/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E++ L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELKYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|146321818|ref|YP_001201529.1| adenylosuccinate synthase [Streptococcus suis 98HAH33]
 gi|145692624|gb|ABP93129.1| Adenylosuccinate synthase [Streptococcus suis 98HAH33]
 gi|292559235|gb|ADE32236.1| putative adenylosuccinate synthetase [Streptococcus suis GZ1]
          Length = 469

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 273/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 40  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGTKYKLHLIPSGIF 99

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + EI  L   G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 100 FPEKISVIGNGVVVNPKSLVKEINYLHDSGV--TTDNLRISDRAHVILPYHIKLDQLQEE 157

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 158 --SKGENKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRTNLAEKNRLFEKMYE 215

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 216 STPIEFDEIFEEYYAYGQEIKKYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 275

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+GKE+
Sbjct: 276 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELHDEIGDRIREIGKEY 335

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL  LKICV Y +DG  +D  
Sbjct: 336 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLGTLKICVAYDLDGERIDHY 395

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  + GW +   G+R   +LP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 396 PASLEQLKRCKPIYEEMPGWSEDITGVRSLDELPEAARNYVRRISELVGVRISTFSVGPG 455

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 456 REQTNILESVW 466


>gi|326391666|ref|ZP_08213192.1| adenylosuccinate synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|325992278|gb|EGD50744.1| adenylosuccinate synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 426

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 195/429 (45%), Positives = 281/429 (65%), Gaps = 5/429 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ +V+VG QWGDEGKGKI D+L+E ADV+VR+QGGNNAGHT++   + YKL L+PSG++
Sbjct: 1   MSTLVIVGTQWGDEGKGKITDYLAEKADVVVRYQGGNNAGHTVEKGGVQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            PDK+ IIG+ VV+DP + I EIE+L  QG+  +  NL+I++ A ++   H   D L E 
Sbjct: 61  YPDKICIIGNGVVIDPASLIEEIENLEKQGV--SIENLKISDRAHIVFPYHIRQDELEEL 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
           A       +GTT++GIGP Y D+  R  IRV DL   + + +K+++ +   N L R  +G
Sbjct: 119 A--KGKNDLGTTRKGIGPCYMDKSERIGIRVCDLIKPKVLEEKLKRNIEKKNKLFRDLYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +   +  + ++ +   EKI PF+     LL    + G  +LFEGAQG LLD D GTYP+
Sbjct: 177 VEGFDFDEMYKKYLEYAEKIKPFVTDTTVLLYDLIKSGKKVLFEGAQGTLLDLDLGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++   ++G+GI P  +  V+GVVKAYTTRVG GPFPTEL ++ GDFL+E G E+
Sbjct: 237 VTASHPIAGGVTVGAGIGPTMIDEVIGVVKAYTTRVGKGPFPTELFDENGDFLREKGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   ++ SV ++G+   ALTKLD L GL ++KIC GYR  G  +   
Sbjct: 297 GTTTGRPRRCGWLDAVILKYSVRVSGITHFALTKLDTLTGLKKIKICTGYRFKGEIITDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EPVY   +GW++   G + F DLP  A+ YI++IEE++ +  A++S+GPE
Sbjct: 357 PASLEDLAQCEPVYEEFDGWEEDIQGAKTFDDLPYNAQKYIKRIEELIGIKAAIISVGPE 416

Query: 420 RENTLIMSN 428
           R  T+++ +
Sbjct: 417 RNQTIVLRD 425


>gi|225871378|ref|YP_002747325.1| adenylosuccinate synthetase [Streptococcus equi subsp. equi 4047]
 gi|254788721|sp|C0MAE4|PURA_STRE4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|225700782|emb|CAW95454.1| adenylosuccinate synthetase [Streptococcus equi subsp. equi 4047]
          Length = 430

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ +++  +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIKLDQLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  +++++  L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFAERLKTNLAEKNRLFEKMYD 176

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SAPIAFDEIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++E+G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL+ +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLETVKICVAYDLDGKRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRIGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|307704428|ref|ZP_07641339.1| adenylosuccinate synthetase [Streptococcus mitis SK597]
 gi|307622001|gb|EFO01027.1| adenylosuccinate synthetase [Streptococcus mitis SK597]
          Length = 428

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIDFDDIFEEYYEYGQQIKKYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|254481070|ref|ZP_05094316.1| adenylosuccinate synthetase [marine gamma proteobacterium HTCC2148]
 gi|41582274|gb|AAS07888.1| adenylosuccinate synthetase [uncultured marine bacterium 463]
 gi|214038865|gb|EEB79526.1| adenylosuccinate synthetase [marine gamma proteobacterium HTCC2148]
          Length = 431

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 207/434 (47%), Positives = 284/434 (65%), Gaps = 7/434 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVVV+G QWGDEGKGKIVD L++ A  +VRFQGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSKNVVVLGTQWGDEGKGKIVDLLTDQASAVVRFQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R     +IG+ VV+ P A + E+  L  +G+ V  + L+I+    LIL  H  LD  RE
Sbjct: 61  LREHVQCLIGNGVVLSPEALLKEMAQLEEKGVPVR-DRLKISPACPLILPYHVALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSF 178
                    IGTT RGIGPAYED+V RR +R+ DL D E  ++K+++++ +HN AL   +
Sbjct: 120 AKR--GSEKIGTTGRGIGPAYEDKVARRGLRLGDLQDKERFARKLKEVMEYHNFALEHYY 177

Query: 179 GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
             + + Y+ +LEE +   E++ P +  + ++L    +  A I+FEGAQG LLD DHGTYP
Sbjct: 178 HAEPLSYENVLEEALTMGEQLKPMIADVTAILHECRKTNAKIMFEGAQGSLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG  P  L YVLG+ KAYTTRVG GPFPTEL + TG  L E G E
Sbjct: 238 YVTSSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFDATGAHLAEKGHE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVD 357
           FG  T R RRCGW D  ++R +V IN V G+ LTKLDVLDGL+ ++ICVGY  ++G  V 
Sbjct: 298 FGATTGRPRRCGWFDAVALRNAVNINSVSGLCLTKLDVLDGLESIQICVGYACVNGNPVP 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P DS  +    PVY  + GW ++T G +   +LP  AR+YI+KIEEV+  P+ ++S G
Sbjct: 358 N-PVDSDDYEGLHPVYEEVPGWSETTLGAQSLEELPQAARDYIQKIEEVVGAPIDIISTG 416

Query: 418 PERENTLIMSNPFE 431
           P+R  T+++ +PFE
Sbjct: 417 PDRVETIVLRHPFE 430


>gi|152973048|ref|YP_001338194.1| adenylosuccinate synthetase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238892662|ref|YP_002917396.1| adenylosuccinate synthetase [Klebsiella pneumoniae NTUH-K2044]
 gi|262045390|ref|ZP_06018414.1| adenylosuccinate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|166232459|sp|A6TH93|PURA_KLEP7 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|150957897|gb|ABR79927.1| adenylosuccinate synthetase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238544978|dbj|BAH61329.1| adenylosuccinate synthetase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259037308|gb|EEW38555.1| adenylosuccinate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI++IEE+  VPV ++S GP+
Sbjct: 360 PLAADNWEGIEPIYETMPGWSETTFGVKERSGLPQAALNYIQRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|260772091|ref|ZP_05881008.1| adenylosuccinate synthetase [Vibrio metschnikovii CIP 69.14]
 gi|260612958|gb|EEX38160.1| adenylosuccinate synthetase [Vibrio metschnikovii CIP 69.14]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 270/431 (62%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A I E+  L  +GI V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVKCIIGNGVVLSPDALIKEMTPLEERGIPV-KERLFISEACPLILPYHIALDQARELA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL ++   ++K+++++  HN     F + 
Sbjct: 122 RGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFNMVSFAEKLKEVMEFHNFQLEHFYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y  +L ++    E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DPVSYDDVLAQVQGYAELLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL ++ G+ L   G EFG
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELDDEVGNHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RRCGW D  ++RR++ IN V G  LTKLDVLDGL+ELKIC GY+M DG      
Sbjct: 300 ATTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLEELKICTGYQMPDGSVAQVS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P+Y  + GW ++T G      LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PMAADAFEAVTPIYETMPGWSENTFGATSIESLPQAAINYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I  +PF
Sbjct: 420 RNETIIKVHPF 430


>gi|288937523|ref|YP_003441582.1| adenylosuccinate synthetase [Klebsiella variicola At-22]
 gi|290512261|ref|ZP_06551628.1| adenylosuccinate synthetase [Klebsiella sp. 1_1_55]
 gi|288892232|gb|ADC60550.1| adenylosuccinate synthetase [Klebsiella variicola At-22]
 gi|289775256|gb|EFD83257.1| adenylosuccinate synthetase [Klebsiella sp. 1_1_55]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVISIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI +IEE+  VPV ++S GP+
Sbjct: 360 PLAADNWEGIEPIYETMPGWSETTFGVKERSGLPQAALNYIARIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|307267329|ref|ZP_07548826.1| adenylosuccinate synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917650|gb|EFN47927.1| adenylosuccinate synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 426

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 197/429 (45%), Positives = 283/429 (65%), Gaps = 5/429 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ +V+VG QWGDEGKGKI D+L+E ADV+VR+QGGNNAGHT++   I YKL L+PSG++
Sbjct: 1   MSTLVIVGTQWGDEGKGKITDYLAEKADVVVRYQGGNNAGHTVEKESIQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+ +IG+ VV+DP + I EIE+L  QGI  + +NL+I++ A ++   H   D L E 
Sbjct: 61  YPEKICVIGNGVVIDPASLIEEIENLQKQGI--SVDNLKISDRAHIVFPYHIKQDELEEI 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
             S     +GTT+RGIGP Y D+  R  IRV DL + +   +K+ + +   N L +  +G
Sbjct: 119 --SKGKNDLGTTKRGIGPCYMDKSERIGIRVCDLINPKVFEEKLRRNVEKKNKLFKEIYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E  ++ I ++ +   EKI PF+     LL    + G  +LFEGAQG LLD D GTYP+
Sbjct: 177 AEEFDFEEIYKKYLEYAEKIKPFVTDTTVLLYDLIKNGKKVLFEGAQGTLLDLDLGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++   +IG+GI P  +  V+GVVKAYTTRVG GPFPTEL ++  +FL+E G E+
Sbjct: 237 VTASHPIAGGVTIGAGIGPTMIDEVMGVVKAYTTRVGKGPFPTELFDENAEFLREKGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   ++ SV ++G+   ALTKLD L GL ++KIC GYR+ G  +   
Sbjct: 297 GTTTGRARRCGWLDAVILKYSVRVSGITHFALTKLDTLTGLKKIKICTGYRLKGEIITDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EPVY   +GW++   G + F DLP  A+ Y+R+IEE++ +  A++S+GPE
Sbjct: 357 PASLEDLAQCEPVYEEFDGWEEDIQGAKTFDDLPYNAQKYVRRIEELIGIKAAIISVGPE 416

Query: 420 RENTLIMSN 428
           R  T+I+ +
Sbjct: 417 RNQTIILRD 425


>gi|292489615|ref|YP_003532505.1| adenylosuccinate synthetase [Erwinia amylovora CFBP1430]
 gi|292898165|ref|YP_003537534.1| adenylosuccinate synthetase [Erwinia amylovora ATCC 49946]
 gi|291198013|emb|CBJ45115.1| adenylosuccinate synthetase [Erwinia amylovora ATCC 49946]
 gi|291555052|emb|CBA23131.1| adenylosuccinate synthetase [Erwinia amylovora CFBP1430]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G  V    L I+    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVR-ERLFISEACPLILEYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAAKLKEVMEYHNFQLVNYYKT 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLADVMAIADILTSMVVDVSELLDGARQRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DG EV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGSEVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSETTFGVKTLDGLPQAARDYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|148557575|ref|YP_001265157.1| adenylosuccinate synthetase [Sphingomonas wittichii RW1]
 gi|166232499|sp|A5VFF3|PURA_SPHWW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|148502765|gb|ABQ71019.1| Adenylosuccinate synthetase [Sphingomonas wittichii RW1]
          Length = 429

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 310/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWL+E A V+VRFQGG+NAGHTL V +  YKLSLLPSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLAERAHVVVRFQGGHNAGHTLVVGNQTYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VV DP  F  E+  L  QG+ +TP+NL+IA  A LIL  HRDLD LRE 
Sbjct: 61  R-GTLSVIGNGVVFDPWHFRDEVAKLQGQGVTITPDNLQIAETAPLILPFHRDLDGLRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV DL  ++ +  +++++  HH+ALR  F E
Sbjct: 120 A--SGSGKIGTTRRGIGPAYEDKVGRRAIRVCDLAHLDDLELQLDRICAHHDALRAGFNE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +  + +  +L    + ILPF   +W  L    + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 178 PPIDREALKAQLAEIADFILPFAKPVWLTLNEARKAGRRILFEGAQGVLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  AS GSG+ P + G+VLG+VKAYTTRVG GPFP+EL+++ G  L E G EFG
Sbjct: 238 TSSNTIAGTASGGSGLGPSAAGFVLGIVKAYTTRVGSGPFPSELEDEMGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+S  ++G+ G+ALTKLDVLDG DE+KIC GY +DG+  D+LP
Sbjct: 298 TVTGRKRRCGWFDAVLVRQSAAVSGITGVALTKLDVLDGFDEIKICTGYELDGKTYDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  +EGW QSTAG R +A+LP QA  YIR++EE+++ PVAL+S  PER
Sbjct: 358 PHPQDQARVTPIYETIEGWSQSTAGARSWAELPAQAIKYIRRVEELIQCPVALVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PF D
Sbjct: 418 EDTILVRDPFAD 429


>gi|163802750|ref|ZP_02196640.1| adenylosuccinate synthetase [Vibrio sp. AND4]
 gi|159173457|gb|EDP58279.1| adenylosuccinate synthetase [Vibrio sp. AND4]
          Length = 438

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 197/437 (45%), Positives = 275/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEVFAEKLKEVMEFHNFQLEHFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           K V Y+ +LE+ M   E +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 KTVSYEEVLEQCMGYAELLTSMVMDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL E+KIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLTGMCLTKLDVLDGLKEIKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IEE+  VPV +
Sbjct: 360 AILEVSPMSAESFEEATPIYETMPGWSETTFGAKSIDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 ISTGPDRNETIIKVHPY 436


>gi|153947819|ref|YP_001402602.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|167011944|sp|A7FMX4|PURA_YERP3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|152959314|gb|ABS46775.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis IP 31758]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 204/432 (47%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLKEIVEYHNFQLVHYYKE 179

Query: 182 -EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 AAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+C+GYRM DGREVD  
Sbjct: 300 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCIGYRMPDGREVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI+++EE+  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 420 RDETMILRDPFD 431


>gi|259416032|ref|ZP_05739952.1| adenylosuccinate synthetase [Silicibacter sp. TrichCH4B]
 gi|259347471|gb|EEW59248.1| adenylosuccinate synthetase [Silicibacter sp. TrichCH4B]
          Length = 437

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 237/438 (54%), Positives = 304/438 (69%), Gaps = 7/438 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDKKVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + EIE++  QG+ +TP  L IA N  LI+  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLMKEIETVRAQGVEITPETLMIAENTPLIMPFHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRAIRVADLADHATLEARVDRALQHHDPLRKGLGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    +++ L     +ILPF   +W ++  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EPIDRDALVDLLKEIAGEILPFAAPVWKVMNEKRKAGKRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFLKE 294
           TSSN ++ QA+ G GI P S+ YVLG+VKAYTTRVG GPFPTE        +  G+ L  
Sbjct: 240 TSSNVIAGQAATGVGIGPNSIDYVLGIVKAYTTRVGEGPFPTELLGADGKPDADGERLGT 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR 354
            G EFGT T RQRRCGW D   VR++   +G+ GI+LTKLDVLDG + LKICVGY +DG 
Sbjct: 300 RGHEFGTTTGRQRRCGWFDACLVRQTCATSGINGISLTKLDVLDGFETLKICVGYDLDGT 359

Query: 355 EVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALL 414
            +D+LP  +    R  P+Y  +EGW +ST G R +ADLP  A  Y+R++EE+++ PVALL
Sbjct: 360 RLDYLPTAADQQARCTPIYEEMEGWSESTEGARSWADLPANAIKYVRRVEELIQCPVALL 419

Query: 415 SIGPERENTLIMSNPFED 432
           S  PER++T+++++PF D
Sbjct: 420 STSPERDDTILVTDPFAD 437


>gi|315612143|ref|ZP_07887059.1| adenylosuccinate synthase [Streptococcus sanguinis ATCC 49296]
 gi|315315806|gb|EFU63842.1| adenylosuccinate synthase [Streptococcus sanguinis ATCC 49296]
          Length = 444

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 17  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 76

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 77  FPEKISVIGNGMVVNPRSLVKELTYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 134

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 135 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 192

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 193 STPISVDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 252

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 253 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 312

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 313 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 373 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 432

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 433 REQTNILESVW 443


>gi|307132699|ref|YP_003884715.1| adenylosuccinate synthetase [Dickeya dadantii 3937]
 gi|306530228|gb|ADN00159.1| adenylosuccinate synthetase [Dickeya dadantii 3937]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+ +L  +G+ V    + ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDALLKEMTALEARGVPVR-ERMLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN     + + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDRESFAVKLKEIMDYHNFQLVHYYKT 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L +++   + +   +  +  LL +  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DPVDYQKTLNDVLEVADILTAMVVDVSDLLHKAHQRGDRVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL +  G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFDDVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPNGSEVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW +ST G++ ++ LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSESTFGVKEYSKLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+++ +PF+
Sbjct: 420 REETMVLRDPFD 431


>gi|51594782|ref|YP_068973.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108809896|ref|YP_653812.1| adenylosuccinate synthetase [Yersinia pestis Antiqua]
 gi|108813453|ref|YP_649220.1| adenylosuccinate synthetase [Yersinia pestis Nepal516]
 gi|145600843|ref|YP_001164919.1| adenylosuccinate synthetase [Yersinia pestis Pestoides F]
 gi|150260578|ref|ZP_01917306.1| adenylosuccinate synthetase [Yersinia pestis CA88-4125]
 gi|162420739|ref|YP_001605274.1| adenylosuccinate synthetase [Yersinia pestis Angola]
 gi|165926785|ref|ZP_02222617.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936420|ref|ZP_02224988.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011870|ref|ZP_02232768.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214012|ref|ZP_02240047.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167418867|ref|ZP_02310620.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423419|ref|ZP_02315172.1| adenylosuccinate synthetase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167470113|ref|ZP_02334817.1| adenylosuccinate synthetase [Yersinia pestis FV-1]
 gi|170026008|ref|YP_001722513.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis YPIII]
 gi|186893790|ref|YP_001870902.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|218927581|ref|YP_002345456.1| adenylosuccinate synthetase [Yersinia pestis CO92]
 gi|229836638|ref|ZP_04456804.1| adenylosuccinate synthetase [Yersinia pestis Pestoides A]
 gi|229840250|ref|ZP_04460409.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842328|ref|ZP_04462483.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903933|ref|ZP_04519046.1| adenylosuccinate synthetase [Yersinia pestis Nepal516]
 gi|270489080|ref|ZP_06206154.1| adenylosuccinate synthase [Yersinia pestis KIM D27]
 gi|294502486|ref|YP_003566548.1| adenylosuccinate synthetase [Yersinia pestis Z176003]
 gi|21263882|sp|Q8ZIV7|PURA_YERPE RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|81825957|sp|Q66FB0|PURA_YERPS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122979284|sp|Q1C105|PURA_YERPA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122979957|sp|Q1CEG0|PURA_YERPN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|166234009|sp|A4TRN4|PURA_YERPP RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229598017|sp|B2K2K4|PURA_YERPB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229598018|sp|A9QYM6|PURA_YERPG RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229598019|sp|B1JMN3|PURA_YERPY RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|238828318|pdb|3HID|A Chain A, Crystal Structure Of Adenylosuccinate Synthetase From
           Yersinia Pestis Co92
 gi|51588064|emb|CAH19670.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108777101|gb|ABG19620.1| Adenylosuccinate synthetase [Yersinia pestis Nepal516]
 gi|108781809|gb|ABG15867.1| Adenylosuccinate synthetase [Yersinia pestis Antiqua]
 gi|115346192|emb|CAL19060.1| adenylosuccinate synthetase [Yersinia pestis CO92]
 gi|145212539|gb|ABP41946.1| Adenylosuccinate synthetase [Yersinia pestis Pestoides F]
 gi|149289986|gb|EDM40063.1| adenylosuccinate synthetase [Yersinia pestis CA88-4125]
 gi|162353554|gb|ABX87502.1| adenylosuccinate synthetase [Yersinia pestis Angola]
 gi|165915536|gb|EDR34145.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921408|gb|EDR38632.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989229|gb|EDR41530.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204807|gb|EDR49287.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962861|gb|EDR58882.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167057589|gb|EDR67335.1| adenylosuccinate synthetase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169752542|gb|ACA70060.1| Adenylosuccinate synthase [Yersinia pseudotuberculosis YPIII]
 gi|186696816|gb|ACC87445.1| adenylosuccinate synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|229679703|gb|EEO75806.1| adenylosuccinate synthetase [Yersinia pestis Nepal516]
 gi|229690638|gb|EEO82692.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696616|gb|EEO86663.1| adenylosuccinate synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229706322|gb|EEO92330.1| adenylosuccinate synthetase [Yersinia pestis Pestoides A]
 gi|262364464|gb|ACY61021.1| adenylosuccinate synthetase [Yersinia pestis D182038]
 gi|270337584|gb|EFA48361.1| adenylosuccinate synthase [Yersinia pestis KIM D27]
 gi|294352945|gb|ADE63286.1| adenylosuccinate synthetase [Yersinia pestis Z176003]
 gi|320013756|gb|ADV97327.1| adenylosuccinate synthetase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 432

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLKEIVEYHNFQLVHYYKE 179

Query: 182 -EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 AAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 300 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI+++EE+  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 420 RDETMILRDPFD 431


>gi|189426300|ref|YP_001953477.1| adenylosuccinate synthetase [Geobacter lovleyi SZ]
 gi|229576715|sp|B3EAS4|PURA_GEOLS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|189422559|gb|ACD96957.1| Adenylosuccinate synthase [Geobacter lovleyi SZ]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 273/430 (63%), Gaps = 2/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VD  +E AD IVR+QGGNNAGHTL V +    L L+PSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKVVDIYTEYADEIVRYQGGNNAGHTLVVGEEKVVLHLIPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VV+DP  FI E+  L   G     + L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HAGKRCVIGNGVVLDPEVFIMEVNRLKAAGRLEDDSTLLLSESLHIIMPYHKAIDIARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT RGIGP YED++GRR IR+MDL D    S+K+ + L   NA+    GE
Sbjct: 120 -AKSGDKKIGTTGRGIGPCYEDKIGRRGIRLMDLIDPVAFSRKLRENLEEKNAILERLGE 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + + Y  I        E +  +M     +L +    G  +LFEGAQG LLD DHGTYPFV
Sbjct: 179 EPLGYNEIYRTYQDFAEILKKYMADTSLVLSKSVAAGKKLLFEGAQGTLLDVDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T +  A+ G+G+SP  +  V+G+ KAY TRVG GPFPTEL ++TG+ L++VG EFG
Sbjct: 239 TSSSTCAGGAATGTGVSPREIHEVVGISKAYVTRVGSGPFPTELLDETGEKLRQVGGEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +R +V ING+ GIALTKLDVL   + +K+C GYR +G+E++ LP
Sbjct: 299 ATTGRPRRCGWFDAMVIRYAVRINGLTGIALTKLDVLSDFETIKVCTGYRFEGQELETLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EPVY  L GWK    G+R +  LP  A+ Y+R++EE+   P+ ++S+GP R
Sbjct: 359 AKLETFENCEPVYEELPGWKVDITGVRSYDQLPENAKKYVRRLEELAGCPIVMVSVGPRR 418

Query: 421 ENTLIMSNPF 430
           + T+++ NPF
Sbjct: 419 DQTMMIKNPF 428


>gi|331268225|ref|YP_004394717.1| adenylosuccinate synthase [Clostridium botulinum BKT015925]
 gi|329124775|gb|AEB74720.1| Adenylosuccinate synthase [Clostridium botulinum BKT015925]
          Length = 427

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 282/426 (66%), Gaps = 2/426 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E ADV+VRFQGGNNAGHT+ V +  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAETADVVVRFQGGNNAGHTVVVGEEEYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK++I+G+ VV+DP A   E++ L   G+ VTP  L+I++ A LI+  HR LD L+E 
Sbjct: 61  YEDKINILGNGVVIDPKALFEEMDYLEDLGVKVTPKKLKISDRAQLIMPYHRILDGLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL   +   +K+ Q +   N L   +G 
Sbjct: 121 ARGKND--IGTTGKGIGPAYTDKAERSGIRICDLMHKDVFEEKLRQNINDKNELIELYGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +++ +  I EE     E++ P+++ I  ++  E ++  ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EKLDFNKIFEEYNSFAERMRPYVEDISVIIYDEMKENKNVLFEGAQGSLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS+T++     G+G+ P ++   +G+ KAYTTRVG GPFPTEL ++ GD L+E G E+G
Sbjct: 239 TSSSTVAGGVCTGAGVGPTAITGAVGIAKAYTTRVGKGPFPTELLDEMGDALREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  I+G+    +TK+D L GLD++K+C GY+ +G+ +D+ P
Sbjct: 299 VTTGRARRCGWLDLVILKSTARISGLTSFVVTKIDTLAGLDKIKVCTGYKFNGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  + EPVY   +GW  S A  R + +LP  A+ Y++KIEE     V+++S+GP+R
Sbjct: 359 ASLEDLAKCEPVYEEFDGWDDSIAEARSYDELPENAKIYLKKIEEFTNTKVSIVSVGPKR 418

Query: 421 ENTLIM 426
           + T+++
Sbjct: 419 DQTIVV 424


>gi|327467873|gb|EGF13363.1| adenylosuccinate synthase [Streptococcus sanguinis SK330]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|322390388|ref|ZP_08063910.1| adenylosuccinate synthase [Streptococcus parasanguinis ATCC 903]
 gi|321142899|gb|EFX38355.1| adenylosuccinate synthase [Streptococcus parasanguinis ATCC 903]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  + ++LRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--STDSLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N       +
Sbjct: 119 --SKGENKIGTTIKGIGPAYMDKAARVGIRIADLLDRDVFAERLRINLEEKNRQFTKLYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E   +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 AEALSFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|312173793|emb|CBX82047.1| adenylosuccinate synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 432

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G  V    L I+    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVR-ERLFISEACPLILEYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAAKLKEVMEYHNFQLVNYYKT 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLADVMAIADILTSMVVDVSELLDGARQRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DG EV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGSEVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSETTFGVKTLEGLPQAARDYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|260779510|ref|ZP_05888400.1| adenylosuccinate synthetase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604319|gb|EEX30623.1| adenylosuccinate synthetase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 438

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 195/438 (44%), Positives = 274/438 (62%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEMFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y+ +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYEEVLEQCMGYADLLTSMVMDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFP       + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGQDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL E+KIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLTGMCLTKLDVLDGLKEIKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IEE+  VPV +
Sbjct: 360 AILEVSPMAAESFEEATPIYETMPGWSETTFGAKSIDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +P+E
Sbjct: 420 ISTGPDRNETIIKVHPYE 437


>gi|324989862|gb|EGC21805.1| adenylosuccinate synthase [Streptococcus sanguinis SK353]
 gi|324992585|gb|EGC24506.1| adenylosuccinate synthase [Streptococcus sanguinis SK405]
 gi|324995885|gb|EGC27796.1| adenylosuccinate synthase [Streptococcus sanguinis SK678]
 gi|325695391|gb|EGD37291.1| adenylosuccinate synthase [Streptococcus sanguinis SK150]
 gi|327459990|gb|EGF06329.1| adenylosuccinate synthase [Streptococcus sanguinis SK1]
 gi|327463520|gb|EGF09839.1| adenylosuccinate synthase [Streptococcus sanguinis SK1057]
 gi|332360092|gb|EGJ37906.1| adenylosuccinate synthase [Streptococcus sanguinis SK1056]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|172079545|ref|ZP_02708690.2| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|172079622|ref|ZP_02709642.2| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|172079634|ref|ZP_02709733.2| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|322378195|ref|ZP_08052679.1| adenylosuccinate synthase [Streptococcus sp. M334]
 gi|172042043|gb|EDT50089.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|172042132|gb|EDT50178.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|172042972|gb|EDT51018.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|321280825|gb|EFX57841.1| adenylosuccinate synthase [Streptococcus sp. M334]
          Length = 442

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIAFDDIFEEYYEYGQQIKKYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|254719687|ref|ZP_05181498.1| adenylosuccinate synthetase [Brucella sp. 83/13]
 gi|265984702|ref|ZP_06097437.1| adenylosuccinate synthetase [Brucella sp. 83/13]
 gi|306837855|ref|ZP_07470717.1| adenylosuccinate synthetase [Brucella sp. NF 2653]
 gi|264663294|gb|EEZ33555.1| adenylosuccinate synthetase [Brucella sp. 83/13]
 gi|306407094|gb|EFM63311.1| adenylosuccinate synthetase [Brucella sp. NF 2653]
          Length = 429

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 267/432 (61%), Positives = 337/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIVVTPDVLRVAENAPLILSIHRELDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGLDE+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLDEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|5542173|pdb|1CG1|A Chain A, Structure Of The Mutant (K16q) Of Adenylosuccinate
           Synthetase From E. Coli Complexed With Hadacidin, Gdp,
           6- Phosphoryl-Imp, And Mg2+
          Length = 431

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEG+GKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGQGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|327488580|gb|EGF20380.1| adenylosuccinate synthase [Streptococcus sanguinis SK1058]
 gi|328944680|gb|EGG38841.1| adenylosuccinate synthase [Streptococcus sanguinis SK1087]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAINFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|225869371|ref|YP_002745319.1| adenylosuccinate synthetase [Streptococcus equi subsp.
           zooepidemicus]
 gi|259547094|sp|C0MFY0|PURA_STRS7 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|197941215|gb|ACH78327.1| adenylosuccinate synthetase [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702647|emb|CAX00722.1| adenylosuccinate synthetase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 430

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ +++  +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIKLDQLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  +++++  L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFAERLKTNLAEKNRLFEKMYD 176

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SAPIAFDEIFEEYYGYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++E+G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL+ +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLETVKICVAYDLDGKRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRIGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|167038627|ref|YP_001666205.1| adenylosuccinate synthetase [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040965|ref|YP_001663950.1| adenylosuccinate synthetase [Thermoanaerobacter sp. X514]
 gi|300913824|ref|ZP_07131141.1| adenylosuccinate synthetase [Thermoanaerobacter sp. X561]
 gi|307725490|ref|YP_003905241.1| adenylosuccinate synthetase [Thermoanaerobacter sp. X513]
 gi|320117019|ref|YP_004187178.1| adenylosuccinate synthetase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|229576759|sp|B0K8D7|PURA_THEP3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229576760|sp|B0K5I0|PURA_THEPX RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|166855205|gb|ABY93614.1| Adenylosuccinate synthase [Thermoanaerobacter sp. X514]
 gi|166857461|gb|ABY95869.1| Adenylosuccinate synthase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300890509|gb|EFK85654.1| adenylosuccinate synthetase [Thermoanaerobacter sp. X561]
 gi|307582551|gb|ADN55950.1| adenylosuccinate synthetase [Thermoanaerobacter sp. X513]
 gi|319930110|gb|ADV80795.1| adenylosuccinate synthetase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 426

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 195/429 (45%), Positives = 282/429 (65%), Gaps = 5/429 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ +V+VG QWGDEGKGKI D+L+E ADV+VR+QGGNNAGHT++   + YKL L+PSG++
Sbjct: 1   MSTLVIVGTQWGDEGKGKITDYLAEKADVVVRYQGGNNAGHTVEKEGVQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ IIG+ VVVDP + I EIE+L  QGI  + +NL+I++ A ++   H   D L E 
Sbjct: 61  YSEKICIIGNGVVVDPASLIEEIENLQKQGI--SVDNLKISDRAHIVFPYHIKQDELEEI 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
             S     +GTT+RGIGP Y D+  R  IRV DL   +   +K+ + +   N L +  +G
Sbjct: 119 --SKGKNDLGTTKRGIGPCYMDKSERIGIRVCDLLKPKVFEEKLRRNVEKKNKLFKELYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +   ++ + ++ +   EKI PF+     LL    + G  +LFEGAQG LLD D GTYP+
Sbjct: 177 AEGFDFEEMYQKYLEYAEKIKPFVTDTTVLLYDLIKSGKKVLFEGAQGTLLDLDLGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++   ++G+GI P  +  V+GVVKAYTTRVG GPFPTEL ++ G+FL+E G E+
Sbjct: 237 VTASHPIAGGVTVGAGIGPTMIDEVMGVVKAYTTRVGKGPFPTELFDENGEFLREKGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   ++ SV ++G+   ALTKLD L GL ++KIC GY+ +GR +   
Sbjct: 297 GTTTGRARRCGWLDAVILKYSVRVSGITHFALTKLDTLTGLKKIKICTGYKFNGRIITDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EPVY   +GW++   G + F DLP  A+ YIR+IEE++ +  A++S+GPE
Sbjct: 357 PASLEDLAQCEPVYEEFDGWEEDIQGAKTFDDLPYNAQKYIRRIEELIGIKAAIISVGPE 416

Query: 420 RENTLIMSN 428
           R  T+++ +
Sbjct: 417 RNQTIVLRD 425


>gi|188535080|ref|YP_001908877.1| adenylosuccinate synthetase [Erwinia tasmaniensis Et1/99]
 gi|229576708|sp|B2VCW8|PURA_ERWT9 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|188030122|emb|CAO98008.1| Adenylosuccinate synthetase (IMP-aspartate ligase) [Erwinia
           tasmaniensis Et1/99]
          Length = 432

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G  V    L I+    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVR-ERLFISEACPLILEYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAAKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLADVMAIADILTGMVVDVSELLDGARQRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+K+CV YRM DG EV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVAYRMPDGSEVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSETTFGVKTLDGLPQAARDYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|332077310|gb|EGI87771.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA41301]
          Length = 428

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 280/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSVNAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R F DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNFEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|22124549|ref|NP_667972.1| adenylosuccinate synthetase [Yersinia pestis KIM 10]
 gi|45440388|ref|NP_991927.1| adenylosuccinate synthetase [Yersinia pestis biovar Microtus str.
           91001]
 gi|167400477|ref|ZP_02305986.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|21957348|gb|AAM84223.1|AE013666_3 adenylosuccinate synthetase [Yersinia pestis KIM 10]
 gi|45435244|gb|AAS60804.1| adenylosuccinate synthetase [Yersinia pestis biovar Microtus str.
           91001]
 gi|167049845|gb|EDR61253.1| adenylosuccinate synthetase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|262360516|gb|ACY57237.1| adenylosuccinate synthetase [Yersinia pestis D106004]
          Length = 436

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVISIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLKEIVEYHNFQLVHYYKE 183

Query: 182 -EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 184 AAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI+++EE+  VP+ ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 424 RDETMILRDPFD 435


>gi|15899967|ref|NP_344571.1| adenylosuccinate synthetase [Streptococcus pneumoniae TIGR4]
 gi|15902065|ref|NP_357615.1| adenylosuccinate synthetase [Streptococcus pneumoniae R6]
 gi|116515772|ref|YP_815439.1| adenylosuccinate synthetase [Streptococcus pneumoniae D39]
 gi|148985359|ref|ZP_01818564.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP3-BS71]
 gi|148987737|ref|ZP_01819200.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP6-BS73]
 gi|148995216|ref|ZP_01824051.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|148998956|ref|ZP_01826390.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP11-BS70]
 gi|149004077|ref|ZP_01828882.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP14-BS69]
 gi|149006820|ref|ZP_01830506.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP18-BS74]
 gi|149010879|ref|ZP_01832184.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP19-BS75]
 gi|149023457|ref|ZP_01836046.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP23-BS72]
 gi|168495077|ref|ZP_02719220.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC3059-06]
 gi|221230965|ref|YP_002510117.1| adenylosuccinate synthetase [Streptococcus pneumoniae ATCC 700669]
 gi|54038934|sp|P65888|PURA_STRR6 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|54041750|sp|P65887|PURA_STRPN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|122279564|sp|Q04N48|PURA_STRP2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|254788722|sp|B8ZJJ5|PURA_STRPJ RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|14971483|gb|AAK74211.1| adenylosuccinate synthetase [Streptococcus pneumoniae TIGR4]
 gi|15457550|gb|AAK98825.1| Adenylosuccinate synthetase [Streptococcus pneumoniae R6]
 gi|116076348|gb|ABJ54068.1| adenylosuccinate synthetase [Streptococcus pneumoniae D39]
 gi|147755164|gb|EDK62217.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP11-BS70]
 gi|147757889|gb|EDK64898.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP14-BS69]
 gi|147761735|gb|EDK68699.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP18-BS74]
 gi|147764515|gb|EDK71445.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP19-BS75]
 gi|147922317|gb|EDK73437.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP3-BS71]
 gi|147926201|gb|EDK77274.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP6-BS73]
 gi|147926818|gb|EDK77873.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|147929780|gb|EDK80770.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP23-BS72]
 gi|183575063|gb|EDT95591.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC3059-06]
 gi|220673425|emb|CAR67885.1| adenylosuccinate synthetase [Streptococcus pneumoniae ATCC 700669]
 gi|301799165|emb|CBW31678.1| adenylosuccinate synthetase [Streptococcus pneumoniae OXC141]
 gi|327390435|gb|EGE88775.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA04375]
 gi|332075676|gb|EGI86143.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA17570]
 gi|332076480|gb|EGI86942.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA17545]
 gi|332201900|gb|EGJ15969.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA41317]
          Length = 428

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|301793340|emb|CBW35701.1| adenylosuccinate synthetase [Streptococcus pneumoniae INV104]
 gi|332204047|gb|EGJ18112.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA47901]
          Length = 428

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSGI P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGIGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGARNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|168214808|ref|ZP_02640433.1| adenylosuccinate synthetase [Clostridium perfringens CPE str.
           F4969]
 gi|170713709|gb|EDT25891.1| adenylosuccinate synthetase [Clostridium perfringens CPE str.
           F4969]
          Length = 428

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 275/427 (64%), Gaps = 2/427 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E A+V+VRFQGGNNAGHT++V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAEEAEVVVRFQGGNNAGHTVEVEDKQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+++IG+ VVVDP A  +EI+ L   G+ VTP  L +++ A LI+  H  LD L+E 
Sbjct: 61  HDEKLNVIGNGVVVDPKALFTEIDYLEGLGVKVTPEKLIVSDRAHLIMPYHITLDKLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGP Y D+  R  IRV DL   +  ++K+   +   N   +  G 
Sbjct: 121 ARGKND--IGTTCKGIGPCYTDKYERSGIRVCDLMHKDSFAEKLRINIEMKNGYIKLLGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  I  E M   E++ P++      +    +   ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELNFDEIYNEYMAFAERLRPYVKDTSVEIYNAIQADKNVLFEGAQGMLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT S   + G+GI P  +   +G+ KAYTTRVG GPFPTEL+N+TGD+++E G E+G
Sbjct: 239 TSSNTTSCGVASGAGIGPNMVTNAVGIAKAYTTRVGKGPFPTELENETGDWIREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  + G+  + +TK+D L GLD++++CVGY +DG+ +D+ P
Sbjct: 299 VTTGRSRRCGWLDLVILKTTTRVCGLTSLVVTKIDTLAGLDKIQMCVGYELDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +PVY   EGW +  A  R + +LP  A+ Y+R+IEE     V+++ +GP+R
Sbjct: 359 ASLEDLARCKPVYEEFEGWGEEVADARSYEELPENAKAYLRRIEEFTGTKVSIVGVGPKR 418

Query: 421 ENTLIMS 427
             T+ + 
Sbjct: 419 NQTIRVR 425


>gi|117924821|ref|YP_865438.1| adenylosuccinate synthetase [Magnetococcus sp. MC-1]
 gi|117608577|gb|ABK44032.1| Adenylosuccinate synthetase [Magnetococcus sp. MC-1]
          Length = 442

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 292/431 (67%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NVV+VG QWGDEGKGKIVD L+E AD++VRFQGG+NAGHTL V+   Y L L+PSG++
Sbjct: 11  MSNVVIVGTQWGDEGKGKIVDLLTEQADMVVRFQGGHNAGHTLVVDGKKYILHLIPSGII 70

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K   IG+ VV+DP A ++E+  LA  G+ ++P NL+IA+  +LIL  H  LD  R  
Sbjct: 71  RPGKQCAIGNGVVLDPAALLAEMAKLAEVGVAISPENLKIADRTNLILPYHNALDQAR-E 129

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT RGIGP YED+  RR IR++DL +     +K+ + L   N L +++  
Sbjct: 130 KKKGEEKKIGTTGRGIGPCYEDKSARRGIRLVDLYNPALFEEKLRENLDLVNFLLKNYYH 189

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +E      I ++ +   +++ P+ + +   LE+   +G +ILFEGAQG LLD D GTYPF
Sbjct: 190 EEGFQLADIRDDYLRMGDQLAPYCEDLAPWLEQAQAEGKNILFEGAQGALLDVDFGTYPF 249

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS T ++ A  GSG++PG L YVLG+VKAYTTRVG GPFPTEL+   G +L + G EF
Sbjct: 250 VTSSTTNASGACSGSGVAPGKLDYVLGIVKAYTTRVGSGPFPTELECADGQYLAKKGHEF 309

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   VR S  ++G+ GI +TKLDV+DG+ E+++C GYR+DG+E  ++
Sbjct: 310 GATTGRPRRCGWFDAVVVRHSARVSGLNGICITKLDVMDGMSEVRLCTGYRIDGKETAYV 369

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+    R EP+Y  + GW++ST G + + DLP  A+ Y+ ++ +V+ VP+++LS GP+
Sbjct: 370 PADTAKLDRVEPIYETMPGWRESTVGCKNWQDLPAAAQAYLNRLVQVVGVPISILSTGPD 429

Query: 420 RENTLIMSNPF 430
           R  TLI+ NPF
Sbjct: 430 RSETLIVQNPF 440


>gi|332205026|gb|EGJ19090.1| adenylosuccinate synthetase [Streptococcus pneumoniae GA47368]
          Length = 428

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSGI P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGIGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|171473050|sp|A0L7T9|PURA_MAGSM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
          Length = 432

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 292/431 (67%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NVV+VG QWGDEGKGKIVD L+E AD++VRFQGG+NAGHTL V+   Y L L+PSG++
Sbjct: 1   MSNVVIVGTQWGDEGKGKIVDLLTEQADMVVRFQGGHNAGHTLVVDGKKYILHLIPSGII 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K   IG+ VV+DP A ++E+  LA  G+ ++P NL+IA+  +LIL  H  LD  R  
Sbjct: 61  RPGKQCAIGNGVVLDPAALLAEMAKLAEVGVAISPENLKIADRTNLILPYHNALDQAR-E 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT RGIGP YED+  RR IR++DL +     +K+ + L   N L +++  
Sbjct: 120 KKKGEEKKIGTTGRGIGPCYEDKSARRGIRLVDLYNPALFEEKLRENLDLVNFLLKNYYH 179

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +E      I ++ +   +++ P+ + +   LE+   +G +ILFEGAQG LLD D GTYPF
Sbjct: 180 EEGFQLADIRDDYLRMGDQLAPYCEDLAPWLEQAQAEGKNILFEGAQGALLDVDFGTYPF 239

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS T ++ A  GSG++PG L YVLG+VKAYTTRVG GPFPTEL+   G +L + G EF
Sbjct: 240 VTSSTTNASGACSGSGVAPGKLDYVLGIVKAYTTRVGSGPFPTELECADGQYLAKKGHEF 299

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   VR S  ++G+ GI +TKLDV+DG+ E+++C GYR+DG+E  ++
Sbjct: 300 GATTGRPRRCGWFDAVVVRHSARVSGLNGICITKLDVMDGMSEVRLCTGYRIDGKETAYV 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+    R EP+Y  + GW++ST G + + DLP  A+ Y+ ++ +V+ VP+++LS GP+
Sbjct: 360 PADTAKLDRVEPIYETMPGWRESTVGCKNWQDLPAAAQAYLNRLVQVVGVPISILSTGPD 419

Query: 420 RENTLIMSNPF 430
           R  TLI+ NPF
Sbjct: 420 RSETLIVQNPF 430


>gi|153008562|ref|YP_001369777.1| adenylosuccinate synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|166232478|sp|A6WY94|PURA_OCHA4 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|151560450|gb|ABS13948.1| Adenylosuccinate synthase [Ochrobactrum anthropi ATCC 49188]
          Length = 429

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 265/432 (61%), Positives = 332/432 (76%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E E L  QGI + P+ LRIA NA LILSIHRDLD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAETEKLRAQGIDINPDVLRIAENAPLILSIHRDLDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DL + E +  K+E+LL HHN LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLAEPETLQPKVERLLAHHNLLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + G  ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGDRILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGLDE+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGITGIALTKLDVLDGLDEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|209696178|ref|YP_002264108.1| adenylosuccinate synthetase [Aliivibrio salmonicida LFI1238]
 gi|208010131|emb|CAQ80456.1| adenylosuccinate synthetase [Aliivibrio salmonicida LFI1238]
          Length = 438

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 202/438 (46%), Positives = 280/438 (63%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +GI V    L I+    LIL  H  LD  RE A
Sbjct: 63  NNVECIIGNGVVLSPDALLKEMAPLEARGIPVR-ERLFISEACPLILPYHIALDQARELA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    ++ + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLFDKVTFAEKLKEVMEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +EV Y+ +LE++M   + ++  +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EEVNYEEVLEQVMSYADLLVSMVIDVTDTLDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHLGYILGITKAYCTRVGSGPFPTELYDGLDKQDPIGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RRCGW D  ++RR++ IN + GI LTKLDVLDGL ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRCGWFDAVAMRRAIQINSLSGICLTKLDVLDGLKELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       PVY  + GW ++T G +    LP  A +YI++IEE+  VP+ +
Sbjct: 360 SLLEVSPMAAEAFEEATPVYETMPGWSENTFGAQTIEALPQAALDYIKRIEELTGVPIDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T++  +PFE
Sbjct: 420 ISTGPDRNETIVKVHPFE 437


>gi|307294839|ref|ZP_07574681.1| adenylosuccinate synthetase [Sphingobium chlorophenolicum L-1]
 gi|306879313|gb|EFN10531.1| adenylosuccinate synthetase [Sphingobium chlorophenolicum L-1]
          Length = 429

 Score =  497 bits (1281), Expect = e-139,   Method: Composition-based stats.
 Identities = 248/432 (57%), Positives = 311/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWLSE ADV+ RFQGG+NAGHTL V + VYKLSLLPSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLSERADVVARFQGGHNAGHTLVVGEKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VV+DP  F  E+  L  QG+ +TP+NL+IA    LIL  HRDLD LRE 
Sbjct: 61  R-GTLSVIGNGVVLDPWHFRDEVAKLKGQGVEITPDNLQIAETCPLILPFHRDLDGLRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV DL  ++ +  ++++L  HH+ALR  F E
Sbjct: 120 A--SGAGKIGTTRRGIGPAYEDKVGRRAIRVCDLAHLDDLGPQLDRLTAHHDALRAGFNE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +  + ++ EL      ILPF+  +W  L +   +G  ILFEGAQG LLD DHGTYPFV
Sbjct: 178 APIDREALMAELRDIAAFILPFVKPVWLTLNKAKAEGKRILFEGAQGTLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G+ P   G+VLG+VKAYTTRVG GPFPTE +N  G  L E G EFG
Sbjct: 238 TSSNTVAGTAASGTGLGPSGAGFVLGIVKAYTTRVGSGPFPTEQENDVGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+SV ++GV GIALTKLDVLDG +ELKICVGY++  R  D+LP
Sbjct: 298 TVTGRKRRCGWFDAVLVRQSVAVSGVTGIALTKLDVLDGFEELKICVGYKIGDRNFDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    + EPVY  +EGW+ +TAG R +ADLP QA  YIR+IEE++  PV L+S  PER
Sbjct: 358 AHAQDQAKAEPVYESIEGWQDTTAGARSWADLPAQAIKYIRRIEELIGCPVTLVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PF D
Sbjct: 418 EDTILVRDPFAD 429


>gi|295098331|emb|CBK87421.1| Adenylosuccinate synthetase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 432

 Score =  497 bits (1281), Expect = e-139,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+++M   + +   +  +  LL++  ++G  ++ EGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDFVMSEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A +YI++IEE+ EVP+ ++S GP+
Sbjct: 360 PLAADDWEGIEPIYETMPGWSETTFGVKERSGLPKAALDYIKRIEELTEVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|306841402|ref|ZP_07474104.1| adenylosuccinate synthetase [Brucella sp. BO2]
 gi|306288508|gb|EFM59860.1| adenylosuccinate synthetase [Brucella sp. BO2]
          Length = 429

 Score =  497 bits (1281), Expect = e-139,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 337/432 (78%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIVVTPDVLRVAENAPLILSIHRELDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP QA  Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|303260655|ref|ZP_07346618.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP-BS293]
 gi|303260819|ref|ZP_07346768.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP14-BS292]
 gi|303263146|ref|ZP_07349069.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS397]
 gi|303267492|ref|ZP_07353342.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS457]
 gi|303269459|ref|ZP_07355226.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS458]
 gi|302637656|gb|EFL68142.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP14-BS292]
 gi|302638185|gb|EFL68657.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP-BS293]
 gi|302640993|gb|EFL71373.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS458]
 gi|302642967|gb|EFL73264.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS457]
 gi|302646919|gb|EFL77143.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS397]
          Length = 428

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|110801589|ref|YP_699876.1| adenylosuccinate synthetase [Clostridium perfringens SM101]
 gi|110682090|gb|ABG85460.1| adenylosuccinate synthase [Clostridium perfringens SM101]
          Length = 428

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 276/427 (64%), Gaps = 2/427 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E A+V+VRFQGGNNAGHT++V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAEEAEVVVRFQGGNNAGHTVEVEDKQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+++IG+ VVVDP A  +EI+ L   G+ VTP  L +++ A LI+  H  LD L+E 
Sbjct: 61  HDEKLNVIGNGVVVDPKALFTEIDYLEGLGVKVTPEKLIVSDRAHLIMPYHITLDKLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGP Y D+  R  IRV DL   +  ++K++  +   N   +  G 
Sbjct: 121 ARGKND--IGTTCKGIGPCYTDKYERSGIRVCDLMHKDSFAEKLKINIEMKNGYIKLLGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  I  E M   E++ P++      +    +   ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELNFDEIYNEYMAFAERLRPYVKDTSVEIYNAIQADKNVLFEGAQGMLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT S   + G+GI P  +   +G+ KAYTTRVG GPFPTEL+N+TGD+++E G E+G
Sbjct: 239 TSSNTTSCGVASGAGIGPNMVTNAVGIAKAYTTRVGKGPFPTELENETGDWIREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  + G+  + +TK+D L GLD++++CVGY +DG+ +D+ P
Sbjct: 299 VTTGRSRRCGWLDLVILKTTTRVCGLTSLVVTKIDTLAGLDKIQMCVGYELDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +PVY   EGW +  A  R + +LP  A+ Y+R+IEE     V+++ +GP+R
Sbjct: 359 ASLEDLARCKPVYEEFEGWGEEVADARSYEELPENAKAYLRRIEEFTGTKVSIVGVGPKR 418

Query: 421 ENTLIMS 427
             T+ + 
Sbjct: 419 NQTIRVR 425


>gi|19745328|ref|NP_606464.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS8232]
 gi|50913529|ref|YP_059501.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS10394]
 gi|24212111|sp|Q8P2U1|PURA_STRP8 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|68053079|sp|Q5XE45|PURA_STRP6 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|19747430|gb|AAL96963.1| putative adenylosuccinate synthetase [Streptococcus pyogenes
           MGAS8232]
 gi|50902603|gb|AAT86318.1| Adenylosuccinate synthetase [Streptococcus pyogenes MGAS10394]
          Length = 430

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDAVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRIGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|146310025|ref|YP_001175099.1| adenylosuccinate synthetase [Enterobacter sp. 638]
 gi|167011940|sp|A4W5R8|PURA_ENT38 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|145316901|gb|ABP59048.1| Adenylosuccinate synthetase [Enterobacter sp. 638]
          Length = 432

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  DNVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVMAVADILTGMVVDVSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL +  G+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDDIGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +VRR+V IN + G  LTKLDVLDGL E+K+C+GYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDVVAVRRAVQINSLSGFCLTKLDVLDGLKEVKLCIGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A +YI++IEE+ EVP+ ++S GP+
Sbjct: 360 PLAADDWEGIEPIYETMPGWSETTFGVKARSGLPQAALDYIKRIEELTEVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|323171609|gb|EFZ57255.1| adenylosuccinate synthetase [Escherichia coli LT-68]
          Length = 432

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      E +Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVESIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|91978357|ref|YP_571016.1| adenylosuccinate synthetase [Rhodopseudomonas palustris BisB5]
 gi|123748801|sp|Q131X4|PURA_RHOPS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|91684813|gb|ABE41115.1| Adenylosuccinate synthetase [Rhodopseudomonas palustris BisB5]
          Length = 430

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 255/431 (59%), Positives = 325/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++ RFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVARFQGGHNAGHTLVINGETYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV DP AF+ E+E L  QG+ ++P NLR+A N +LIL +HR+LD LRE 
Sbjct: 61  RPSKLAVIGNGVVFDPQAFLDEVERLTKQGVAISPENLRVAENVTLILPLHRELDALREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D++ +  KIE+LL HHNALRR  G 
Sbjct: 121 A--SKATSIGTTQRGIGPAYEDKVGRRAIRLMDLADIDTLPHKIERLLTHHNALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E     IL+EL     ++LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 SEFEAGAILKELTALAPRLLPYAETVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ PGS+GYVLG+ KAYTTRVG GPFPTEL N+ G  + E G+EFG
Sbjct: 239 TSSNTVAAQAATGTGMGPGSVGYVLGICKAYTTRVGQGPFPTELDNEIGRKIGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R RRCGW D   VR++V   G+ G+ALTKLD+LDG D +++CVGY +DG+E+D LP
Sbjct: 299 TNTGRPRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFDSIEVCVGYMLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  +EGWK+ TA  R +ADLP QA  Y+R++EE++  P+ALLS  PER
Sbjct: 359 AGEGAQARVVPIYETIEGWKEPTANARSWADLPAQAVKYVRRVEELVGCPIALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|332365641|gb|EGJ43400.1| adenylosuccinate synthase [Streptococcus sanguinis SK355]
          Length = 430

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAINFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|24378775|ref|NP_720730.1| adenylosuccinate synthetase [Streptococcus mutans UA159]
 gi|290581222|ref|YP_003485614.1| adenylosuccinate synthetase [Streptococcus mutans NN2025]
 gi|30173279|sp|Q8DW14|PURA_STRMU RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|24376646|gb|AAN58036.1|AE014876_2 adenylosuccinate synthetase [Streptococcus mutans UA159]
 gi|254998121|dbj|BAH88722.1| adenylosuccinate synthetase [Streptococcus mutans NN2025]
          Length = 429

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 280/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E++ L  +G+    +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKVSVIGNGMVVNPKSLVEELDYLHQEGV--ATDNLRISDRAHIILPYHIKLDQLQE- 117

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D +  +++++  L   N L     E
Sbjct: 118 -ASKGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKDIFAERLKANLAEKNRLFEKMYE 176

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              V + TI +E     +KI  ++     +L +   KG  +LFEGAQG +LD D GTYPF
Sbjct: 177 SSPVAFDTIFDEYYAYGQKIKDYVTDTSVILNKALDKGRRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL +QTG+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDQTGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNCIDVLSGLDIVKICVAYDLDGKRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|238797603|ref|ZP_04641100.1| Adenylosuccinate synthetase [Yersinia mollaretii ATCC 43969]
 gi|238718600|gb|EEQ10419.1| Adenylosuccinate synthetase [Yersinia mollaretii ATCC 43969]
          Length = 436

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVTSIIGNGVVLAPDALMKEMTELEARGIPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN  L   + E
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 183

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L++++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 184 DAVDYQTVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLQEVKLCVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI ++EE+  VPV ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIARVEELTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 424 RDETMILRDPFD 435


>gi|78224451|ref|YP_386198.1| adenylosuccinate synthetase [Geobacter metallireducens GS-15]
 gi|123570835|sp|Q39QK1|PURA_GEOMG RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|78195706|gb|ABB33473.1| Adenylosuccinate synthetase [Geobacter metallireducens GS-15]
          Length = 430

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 275/431 (63%), Gaps = 3/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGK+VD  +E+AD +VR+QGGNNAGHTL VN     L L+PSG++
Sbjct: 1   MANVVVVGAQWGDEGKGKVVDIYTEHADDVVRYQGGNNAGHTLVVNGEKTVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  IIG+ VV+DP  FI EI  L  +G     + L ++ +  +I+  H+ +D+ RE 
Sbjct: 61  HKGKRCIIGNGVVLDPEVFIMEINRLKEKGRLQDDSALLVSESVHIIMPYHKQIDLARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT RGIGP YED++GRR IR+MDL D E  ++K+ + L   N +  +  G
Sbjct: 120 -AKSGDKKIGTTGRGIGPTYEDKIGRRGIRLMDLLDPEIFARKLRENLEEKNFILEKLLG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           EK + +  I +      + +  ++     +L ++   G  +LFEGAQG LLD DHGTYPF
Sbjct: 179 EKPLSFDEIHKTYSGYADILRKYVANTSLILCKDIAAGKKLLFEGAQGTLLDVDHGTYPF 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS+T +  A  G+G+ P  +  ++G+ KAY TRVG GPFPTEL +  G+ L++ G EF
Sbjct: 239 VTSSSTCAGGACTGTGVGPRDIHEIIGISKAYVTRVGSGPFPTELLDADGEQLRQTGGEF 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGW D   VR +V +NG+ G+ALTKLDVL+  D +KIC GY  +G+ V+ L
Sbjct: 299 GATTGRPRRCGWFDAMVVRFAVRVNGLTGVALTKLDVLNDFDTIKICTGYTYEGKPVEDL 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + +PVY  + GWK    G+R F DLP +AR Y+ +++E++  P+ L+SIGP 
Sbjct: 359 PANLAVFEKCQPVYEEMPGWKSDIRGVRRFEDLPEKARLYVHRLQELISCPIVLVSIGPG 418

Query: 420 RENTLIMSNPF 430
           R+ T+ + NPF
Sbjct: 419 RDETITIRNPF 429


>gi|115526135|ref|YP_783046.1| adenylosuccinate synthetase [Rhodopseudomonas palustris BisA53]
 gi|122294981|sp|Q07J18|PURA_RHOP5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|115520082|gb|ABJ08066.1| Adenylosuccinate synthetase [Rhodopseudomonas palustris BisA53]
          Length = 430

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 255/431 (59%), Positives = 326/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGV+
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGETYKLALLPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+++IG+ VV DP AF+ E++ L  QG+ ++P NLR+A N +LIL +HR+LD  RE 
Sbjct: 61  RPSKLAVIGNGVVFDPQAFLDEVKKLQAQGVAISPENLRVAENVTLILPLHRELDAQRET 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D+  +  KI++LL HHNALRR  G 
Sbjct: 121 AAKAGA--IGTTQRGIGPAYEDKVGRRAIRLMDLADLAALPPKIDRLLAHHNALRRGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    IL EL     ++LP+ + +W LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEIDGAAILNELAALAPQLLPYAETVWRLLDIKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ G+G+ P S+GYVLG+ KAYTTRVG GPFPTELKN+ G+ +   GKEFG
Sbjct: 239 TSSNTVAAQAATGTGMGPSSVGYVLGICKAYTTRVGAGPFPTELKNEIGEEIGRRGKEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG + +++CVGYR+DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFETIEVCVGYRLDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP+Y  +EGWK+ TA  R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 359 AGEGAQARVEPIYETIEGWKEPTANARSWADLPAQAIKYVRRIEELVGCPVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|239996204|ref|ZP_04716728.1| adenylosuccinate synthetase [Alteromonas macleodii ATCC 27126]
          Length = 432

 Score =  497 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 199/432 (46%), Positives = 276/432 (63%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDRAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L+I+    LIL  H  LD+ RE A
Sbjct: 63  DNVTCIIGNGVVLSPDALMKEMTMLEERGVPVR-ERLKISEACPLILPYHIALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K++++L  HN  L + +GE
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNAEDFAAKLKEVLDVHNFTLTQYYGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V +   L+  M   + +   +  +   L++    G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDFDETLKGAMEVADILKAMVVDVTDELDKAHNAGLPIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P  L YVLG+VKAYTTRVG GPFPTEL+ + G  L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLKLDYVLGIVKAYTTRVGSGPFPTELECEVGQHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R+RR GW D  +++R+V IN + G  LTKLDVLDGL+ L+ICVGY+  DG   D  
Sbjct: 300 ATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLESLQICVGYKDADGNVKDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW  +T G+  F  LP  A+NYI+++EE+  VPV ++S GP+
Sbjct: 360 PMAADGYEKVTPVYEEMPGWTDNTFGVTEFEALPQAAKNYIKRLEELTGVPVDIVSTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +P++
Sbjct: 420 RNETIVLRSPYD 431


>gi|306828457|ref|ZP_07461652.1| adenylosuccinate synthase [Streptococcus mitis ATCC 6249]
 gi|304429256|gb|EFM32341.1| adenylosuccinate synthase [Streptococcus mitis ATCC 6249]
          Length = 444

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 17  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 76

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 77  FPAKISVIGNGMVVNPKSLVKELRYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 134

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 135 A--KGENKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 192

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I +E     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 193 STPISVDDIFDEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 252

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 253 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 312

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 313 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 373 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 432

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 433 REQTNILESVW 443


>gi|157150412|ref|YP_001451239.1| adenylosuccinate synthetase [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189038343|sp|A8AZM9|PURA_STRGC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|157075206|gb|ABV09889.1| adenylosuccinate synthetase [Streptococcus gordonii str. Challis
           substr. CH1]
          Length = 430

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAIKIDDIFEEYYEYGQQIKQYVTDTSVILNNALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRKLEDLPENARNYVRRVSELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|325688866|gb|EGD30874.1| adenylosuccinate synthase [Streptococcus sanguinis SK115]
          Length = 430

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++++ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLKRNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRINHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|92113408|ref|YP_573336.1| adenylosuccinate synthetase [Chromohalobacter salexigens DSM 3043]
 gi|122420258|sp|Q1QY21|PURA_CHRSD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|91796498|gb|ABE58637.1| Adenylosuccinate synthetase [Chromohalobacter salexigens DSM 3043]
          Length = 431

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 279/432 (64%), Gaps = 4/432 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E+A  +VRFQGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTESAATVVRFQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            DK  +IG+ VV+ P A + EI  L  +G+ V    LR++    LIL  H  LD  RE A
Sbjct: 63  ADKTCVIGNGVVLSPEALMDEIRELEAKGVPVR-ERLRLSPACPLILPYHVRLDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSFGE 180
                A IGTT RGIGPAYED+V RR +R+ D+   E  + K+ ++L +HN  L +   E
Sbjct: 122 R--GIAKIGTTGRGIGPAYEDKVARRGLRLGDMLHRERFASKLGEVLDYHNFVLTQYHHE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V ++ +L+E M   E++ P +    SL+    + G +ILFEGAQG LLD DHGTYP+V
Sbjct: 180 APVDFQRVLDEAMEIAEELRPMVCDTVSLVHDTRKAGENILFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L YVLG+ KAYTTRVG GPFPTEL ++ G  L E G EFG
Sbjct: 240 TSSNTTAGGTATGSGVGPLYLDYVLGITKAYTTRVGSGPFPTELFDEFGRHLAEKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D  ++R +V IN V G+ LTKLDVLDGL+ +++C+GYR    E    P
Sbjct: 300 ATTGRARRCGWFDAVALRHAVQINSVSGLCLTKLDVLDGLENIRVCIGYRSKDGETIDTP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            DS  +   EP+Y  L GW +ST G++   DLP  AR YI  +EE   VP+ ++S GP+R
Sbjct: 360 VDSEGYEVIEPLYQDLPGWSESTLGVKRIEDLPNNARAYISFLEEQTGVPIDIISTGPDR 419

Query: 421 ENTLIMSNPFED 432
             T+++ NPF D
Sbjct: 420 NETIVLRNPFLD 431


>gi|254441213|ref|ZP_05054706.1| adenylosuccinate synthetase [Octadecabacter antarcticus 307]
 gi|198251291|gb|EDY75606.1| adenylosuccinate synthetase [Octadecabacter antarcticus 307]
          Length = 427

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 231/428 (53%), Positives = 300/428 (70%), Gaps = 1/428 (0%)

Query: 5   VVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDK 64
           +VVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVVR  K
Sbjct: 1   MVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVVRGGK 60

Query: 65  MSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSP 124
           +S+IG+ VV+DP   + EI ++  QG+ ++P  L IA N  LIL +H +LD  RE   S 
Sbjct: 61  LSVIGNGVVLDPWHLMKEIATVRAQGVEISPETLMIAENTPLILPMHGELDRAREEVASK 120

Query: 125 CGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVL 184
            G  IGTT RGIGP YED+VGRRAIRV DL D   +  ++++ L HH+ LR+  G K V 
Sbjct: 121 -GTKIGTTGRGIGPCYEDKVGRRAIRVADLADPATLEARVDRALQHHDPLRKGLGIKAVD 179

Query: 185 YKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSN 244
              ++ +L     +ILPF   +W +L  + + G  ILFEGAQG LLD D GTYPFVTSSN
Sbjct: 180 RDQLIADLQAISAEILPFAAPVWKVLNEKRKAGKRILFEGAQGALLDIDFGTYPFVTSSN 239

Query: 245 TMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTN 304
            ++ QA+ G G+ P ++ +VLG+VKAYTTRVG GPFPTEL++  G  L E G EFGT T 
Sbjct: 240 VIAGQAATGVGVGPTAIDFVLGIVKAYTTRVGEGPFPTELEDADGQMLGERGHEFGTTTG 299

Query: 305 RQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSI 364
           R+RRCGW D   +R++   +GV GIALTKLDVLDG + LKICV Y +DG  +D+LP  + 
Sbjct: 300 RKRRCGWFDACLLRQTCATSGVSGIALTKLDVLDGFETLKICVAYDLDGERLDYLPTAAD 359

Query: 365 YHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTL 424
              R  P+Y  ++GW  ST G R +ADLP +A  Y+R++EE+++ PVALLS  PERE+T+
Sbjct: 360 QQARCTPIYEEMKGWSDSTEGARSWADLPAEAIKYVRRVEELIDCPVALLSTSPEREDTI 419

Query: 425 IMSNPFED 432
           ++++PF D
Sbjct: 420 LVTDPFAD 427


>gi|221133965|ref|ZP_03560270.1| adenylosuccinate synthetase [Glaciecola sp. HTCC2999]
          Length = 432

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 196/432 (45%), Positives = 278/432 (64%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERATYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A ++E+  L  +GI V    L I+    LIL  H  LD  RE A
Sbjct: 63  DNVTCVIGNGVVLSPEALMTEMSMLEARGIPV-KERLVISEACPLILPYHIALDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + +  ++K++++L +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLFNAKDFAEKLKEILAYHNFMLTEYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V + ++  + M   + + P +  +  LL+   + G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DPVDFDSVYNDAMEVAKVLKPMIVDVTDLLDEARKAGKEIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P +L YVLG+VKAYTTRVG GPFPTEL  + G  L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLNLDYVLGIVKAYTTRVGSGPFPTELDCEVGQHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R+RR GW D   ++R+V IN + G+ LTKLDVLDGL+ L+IC GY+  DG      
Sbjct: 300 ATTGRKRRTGWFDAVVMKRAVQINSITGLCLTKLDVLDGLETLEICTGYKDKDGNIATVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +   EPVY  + GW ++T G++ + +LP  A+NYI+++EE+  VP+ ++S GP+
Sbjct: 360 PMAADGYDVIEPVYESMPGWSENTFGVQSYDELPQAAKNYIKRLEELTGVPIDIVSTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +P++
Sbjct: 420 RVETIVLRDPYD 431


>gi|70734075|ref|YP_257715.1| adenylosuccinate synthetase [Pseudomonas fluorescens Pf-5]
 gi|110826519|sp|Q4KJ68|PURA_PSEF5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|68348374|gb|AAY95980.1| adenylosuccinate synthetase [Pseudomonas fluorescens Pf-5]
          Length = 430

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 278/430 (64%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALMREIVKLEEKGVPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 R--GEQKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + + L +  R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYAELLKPMMLDVTAELHQLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGVGPMYLDYILGITKAYTTRVGSGPFPTELFDDIGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ +N + G+ LTKLDVLDGL+ + ICVGY+     V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIDVNSISGLCLTKLDVLDGLETINICVGYKNQDGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G +   +LP  A+ YI++IEE++  P+ ++S GP+R
Sbjct: 360 TDADSYIGLEPVYEQMPGWSESTLGAKTLEELPAAAQAYIKRIEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|307707915|ref|ZP_07644390.1| adenylosuccinate synthetase [Streptococcus mitis NCTC 12261]
 gi|307615980|gb|EFN95178.1| adenylosuccinate synthetase [Streptococcus mitis NCTC 12261]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIAFDDIFEEYYEYGQQIKKYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+G+ KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGLCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|289579462|ref|YP_003478089.1| adenylosuccinate synthetase [Thermoanaerobacter italicus Ab9]
 gi|289529175|gb|ADD03527.1| adenylosuccinate synthetase [Thermoanaerobacter italicus Ab9]
          Length = 426

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 283/429 (65%), Gaps = 5/429 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ +V+VG QWGDEGKGKI D+L+E ADV+VR+QGGNNAGHT++   I YKL L+PSG++
Sbjct: 1   MSTLVIVGTQWGDEGKGKITDYLAEKADVVVRYQGGNNAGHTVEKESIQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+ +IG+ VV+DP + I EIE+L  QGI  + +NL+I++ A ++   H   D L E 
Sbjct: 61  YPEKICVIGNGVVIDPASLIEEIENLQKQGI--SVDNLKISDRAHIVFPYHIKQDELEEI 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
             S     +GTT+RGIGP Y D+  R  IRV D  + +   +K+ + +   N L +  +G
Sbjct: 119 --SKGKNDLGTTKRGIGPCYMDKSERIGIRVCDFINPKVFEEKLRRNVEKKNKLFKEIYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E  ++ I ++ +   EKI PF+     LL    + G  +LFEGAQG LLD D GTYP+
Sbjct: 177 TEEFDFEEIYKKYLEYAEKIKPFVTDTTVLLYDLIKNGKRVLFEGAQGTLLDLDLGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++   +IG+GI P  +  V+GVVKAYTTRVG GPFPTEL ++  +FL+E G E+
Sbjct: 237 VTASHPIAGGVTIGAGIGPTMIDEVMGVVKAYTTRVGKGPFPTELFDENAEFLREKGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   ++ SV ++G+   ALTKLD L GL ++KIC+GY+ +GR +   
Sbjct: 297 GTTTGRARRCGWLDAVILKYSVRVSGITHFALTKLDTLTGLKKIKICIGYKFNGRIITDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EPVY   +GW++   G + F DLP  A+ Y+++IEE++ +   ++S+GPE
Sbjct: 357 PASLEDLAQCEPVYEEFDGWEEDIQGAKTFEDLPYNAQKYVKRIEELMGIKATIISVGPE 416

Query: 420 RENTLIMSN 428
           R  T+I+ +
Sbjct: 417 RNQTIILKD 425


>gi|169832536|ref|YP_001693450.1| adenylosuccinate synthetase [Streptococcus pneumoniae Hungary19A-6]
 gi|183603291|ref|ZP_02711238.2| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1087-00]
 gi|183603345|ref|ZP_02714317.2| adenylosuccinate synthetase [Streptococcus pneumoniae SP195]
 gi|183603893|ref|ZP_02722787.2| adenylosuccinate synthetase [Streptococcus pneumoniae MLV-016]
 gi|194397970|ref|YP_002036740.1| adenylosuccinate synthetase [Streptococcus pneumoniae G54]
 gi|225853632|ref|YP_002735144.1| adenylosuccinate synthetase [Streptococcus pneumoniae JJA]
 gi|225855753|ref|YP_002737264.1| adenylosuccinate synthetase [Streptococcus pneumoniae P1031]
 gi|225860062|ref|YP_002741571.1| adenylosuccinate synthetase [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650014|ref|ZP_04524266.1| adenylosuccinate synthetase [Streptococcus pneumoniae CCRI 1974]
 gi|237822611|ref|ZP_04598456.1| adenylosuccinate synthetase [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229198|ref|ZP_06962879.1| adenylosuccinate synthetase [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254030|ref|ZP_06977616.1| adenylosuccinate synthetase [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298501810|ref|YP_003723750.1| adenylosuccinate synthetase [Streptococcus pneumoniae TCH8431/19A]
 gi|307066654|ref|YP_003875620.1| adenylosuccinate synthase [Streptococcus pneumoniae AP200]
 gi|307126195|ref|YP_003878226.1| adenylosuccinate synthetase [Streptococcus pneumoniae 670-6B]
 gi|168995038|gb|ACA35650.1| adenylosuccinate synthetase [Streptococcus pneumoniae Hungary19A-6]
 gi|183570331|gb|EDT90859.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC1087-00]
 gi|183571509|gb|EDT92037.1| adenylosuccinate synthetase [Streptococcus pneumoniae SP195]
 gi|183577435|gb|EDT97963.1| adenylosuccinate synthetase [Streptococcus pneumoniae MLV-016]
 gi|194357637|gb|ACF56085.1| adenylosuccinate synthetase [Streptococcus pneumoniae G54]
 gi|225722510|gb|ACO18363.1| adenylosuccinate synthetase [Streptococcus pneumoniae JJA]
 gi|225726054|gb|ACO21906.1| adenylosuccinate synthetase [Streptococcus pneumoniae P1031]
 gi|225726632|gb|ACO22483.1| adenylosuccinate synthetase [Streptococcus pneumoniae Taiwan19F-14]
 gi|298237405|gb|ADI68536.1| adenylosuccinate synthetase [Streptococcus pneumoniae TCH8431/19A]
 gi|306408191|gb|ADM83618.1| Adenylosuccinate synthase [Streptococcus pneumoniae AP200]
 gi|306483257|gb|ADM90126.1| adenylosuccinate synthetase [Streptococcus pneumoniae 670-6B]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|183603685|ref|ZP_02716449.2| adenylosuccinate synthetase [Streptococcus pneumoniae CDC0288-04]
 gi|183573489|gb|EDT94017.1| adenylosuccinate synthetase [Streptococcus pneumoniae CDC0288-04]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSGI P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGIGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|111657256|ref|ZP_01408024.1| hypothetical protein SpneT_02001536 [Streptococcus pneumoniae
           TIGR4]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|154243995|ref|YP_001414953.1| adenylosuccinate synthetase [Xanthobacter autotrophicus Py2]
 gi|154158080|gb|ABS65296.1| Adenylosuccinate synthase [Xanthobacter autotrophicus Py2]
          Length = 448

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 257/430 (59%), Positives = 326/430 (75%), Gaps = 1/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V  + YKLSLLPSGVVR
Sbjct: 19  ANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGGVTYKLSLLPSGVVR 78

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
             K+S+IG+ VV+DP A + E+  LA QG+ + P+ LRIA    LIL +HR+LD LRE A
Sbjct: 79  GGKLSVIGNGVVLDPQALVDELARLAAQGVEIGPDRLRIAETVPLILPLHRELDALRESA 138

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
            +  GA IGTT+RGIGPAYED+VGRRAIR++DL+D   +  K+++LL HHN +RR  G +
Sbjct: 139 -TAEGARIGTTKRGIGPAYEDKVGRRAIRLVDLSDPSTLPAKVDRLLTHHNLIRRGLGME 197

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
           EV    ++ EL+    K+LPFMD +W LL++  R G  ILFEGAQG LLD DHGTYP+VT
Sbjct: 198 EVNRDALVAELLAIAPKVLPFMDRVWELLDKARRDGKKILFEGAQGALLDIDHGTYPYVT 257

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSNT++  A+ G+GI PG+L YVLG+ KAYTTRVG GPFPTEL ++ G  L   G+EFG 
Sbjct: 258 SSNTVAGSAASGTGIGPGALDYVLGITKAYTTRVGEGPFPTELTDEVGQTLGSKGREFGV 317

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPD 361
           VT R RRCGW D   VR++V   G+ GIALTKLDVLDG  ELK+CVGYR+DG+E+D+LP 
Sbjct: 318 VTGRARRCGWFDAVLVRQTVRTCGIHGIALTKLDVLDGFTELKVCVGYRVDGKEIDYLPA 377

Query: 362 DSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERE 421
           +S    R EP+Y  +EGW+ STAG R +ADLP +A  Y+R++EE++  PVA+LS  PER+
Sbjct: 378 ESGAQARAEPIYETMEGWQDSTAGARSWADLPAEAVKYVRRVEELIGCPVAVLSTSPERD 437

Query: 422 NTLIMSNPFE 431
           +T+++ NPF+
Sbjct: 438 DTILVHNPFQ 447


>gi|293364573|ref|ZP_06611294.1| adenylosuccinate synthase [Streptococcus oralis ATCC 35037]
 gi|291316831|gb|EFE57263.1| adenylosuccinate synthase [Streptococcus oralis ATCC 35037]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELTYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFRERLERNLTEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 STPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|182682989|ref|YP_001834736.1| adenylosuccinate synthetase [Streptococcus pneumoniae CGSP14]
 gi|303255426|ref|ZP_07341490.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS455]
 gi|182628323|gb|ACB89271.1| adenylosuccinate synthetase [Streptococcus pneumoniae CGSP14]
 gi|302597566|gb|EFL64648.1| adenylosuccinate synthetase [Streptococcus pneumoniae BS455]
          Length = 442

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|238757524|ref|ZP_04618709.1| Adenylosuccinate synthetase [Yersinia aldovae ATCC 35236]
 gi|238704286|gb|EEP96818.1| Adenylosuccinate synthetase [Yersinia aldovae ATCC 35236]
          Length = 436

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVTSIIGNGVVLAPDALMKEMTELEARGIPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + + 
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFATKLKEIVDYHNFQLVHYYKV 183

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 184 DAVDYQKVLDDVLAIADILTAMVVDVSELLDSARKRGDFMMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW + T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYETMPGWSEVTFGVKEHSKLPQAALNYIQRVEELTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 424 REETMILRDPFD 435


>gi|332358123|gb|EGJ35955.1| adenylosuccinate synthase [Streptococcus sanguinis SK49]
          Length = 430

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVSDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCQPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|328542554|ref|YP_004302663.1| adenylosuccinate synthetase [polymorphum gilvum SL003B-26A1]
 gi|326412300|gb|ADZ69363.1| Adenylosuccinate synthetase [Polymorphum gilvum SL003B-26A1]
          Length = 429

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 269/432 (62%), Positives = 333/432 (77%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVIDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DPHA + EI  L  QG+ V P  LRIA N +LILS+HR+LD LRE 
Sbjct: 61  R-GKLSVIGNGVVLDPHALVDEIGRLGAQGVTVDPQMLRIAENVTLILSLHRELDALRES 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIR+MDL ++  +  KI++LL+HHNALR   G+
Sbjct: 120 --SNTGTRIGTTKRGIGPAYEDKVGRRAIRLMDLANLSTLPAKIDRLLVHHNALRMGLGQ 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V  + I +EL    +K+LP+MD +WSLL+R+ R+G  +LFEGAQG LLD DHGTYPFV
Sbjct: 178 DPVSAQAIYDELASVADKVLPYMDSVWSLLDRQRREGKRLLFEGAQGALLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ PGS+GYVLG+ KAYTTRVG GPFPTE  N+ GDFL   G EFG
Sbjct: 238 TSSNTVAGQAATGSGLGPGSVGYVLGITKAYTTRVGEGPFPTEQVNEIGDFLGTRGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+ELKICVGY +DG+ +D+LP
Sbjct: 298 TVTGRKRRCGWFDAVLVRQTVCTSGINGIALTKLDVLDGLEELKICVGYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  L GWK+ST G R +ADLP QA  Y+R +EE++  PVALLS  PER
Sbjct: 358 ASQGAQERVVPIYETLPGWKESTEGARSWADLPAQAVKYVRHVEELIGAPVALLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPF+D
Sbjct: 418 DDTILVQNPFQD 429


>gi|330003372|ref|ZP_08304593.1| adenylosuccinate synthase [Klebsiella sp. MS 92-3]
 gi|328537000|gb|EGF63291.1| adenylosuccinate synthase [Klebsiella sp. MS 92-3]
          Length = 432

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVR-ERLLLSEACPLILDYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V R  +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARCGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+++M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDVMAIADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI++IEE+  VPV ++S GP+
Sbjct: 360 PLAADNWEGIEPIYETMPGWSETTFGVKERSGLPQAALNYIQRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|18311604|ref|NP_563538.1| adenylosuccinate synthetase [Clostridium perfringens str. 13]
 gi|110799195|ref|YP_697312.1| adenylosuccinate synthetase [Clostridium perfringens ATCC 13124]
 gi|168211592|ref|ZP_02637217.1| adenylosuccinate synthetase [Clostridium perfringens B str. ATCC
           3626]
 gi|168218016|ref|ZP_02643641.1| adenylosuccinate synthetase [Clostridium perfringens NCTC 8239]
 gi|169343437|ref|ZP_02864437.1| adenylosuccinate synthetase [Clostridium perfringens C str.
           JGS1495]
 gi|182626405|ref|ZP_02954158.1| adenylosuccinate synthetase [Clostridium perfringens D str.
           JGS1721]
 gi|21263866|sp|Q8XH63|PURA_CLOPE RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|18146288|dbj|BAB82328.1| adenylosuccinate synthase [Clostridium perfringens str. 13]
 gi|110673842|gb|ABG82829.1| adenylosuccinate synthetase [Clostridium perfringens ATCC 13124]
 gi|169298389|gb|EDS80478.1| adenylosuccinate synthetase [Clostridium perfringens C str.
           JGS1495]
 gi|170710469|gb|EDT22651.1| adenylosuccinate synthetase [Clostridium perfringens B str. ATCC
           3626]
 gi|177908279|gb|EDT70832.1| adenylosuccinate synthetase [Clostridium perfringens D str.
           JGS1721]
 gi|182379929|gb|EDT77408.1| adenylosuccinate synthetase [Clostridium perfringens NCTC 8239]
          Length = 428

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 275/427 (64%), Gaps = 2/427 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E A+V+VRFQGGNNAGHT++V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAEEAEVVVRFQGGNNAGHTVEVEDKQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+++IG+ VVVDP A  +EI+ L   G+ VTP  L +++ A LI+  H  LD L+E 
Sbjct: 61  HDEKLNVIGNGVVVDPKALFTEIDYLEGLGVKVTPEKLIVSDRAHLIMPYHITLDKLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGP Y D+  R  IRV DL   +  ++K+   +   N   +  G 
Sbjct: 121 ARGKND--IGTTCKGIGPCYTDKYERSGIRVCDLMHKDSFAEKLRINIEMKNGYIKLLGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  I  E M   E++ P++      +    +   ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELNFDEIYNEYMAFAERLRPYVKDTSVEIYNAIQADKNVLFEGAQGMLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT S   + G+GI P  +   +G+ KAYTTRVG GPFPTEL+N+TGD+++E G E+G
Sbjct: 239 TSSNTTSCGVASGAGIGPNMVTNAVGIAKAYTTRVGKGPFPTELENETGDWIREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  + G+  + +TK+D L GLD++++CVGY +DG+ +D+ P
Sbjct: 299 VTTGRSRRCGWLDLVILKTTTRVCGLTSLVVTKIDTLAGLDKIQMCVGYELDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +PVY   EGW +  A  R + +LP  A+ Y+R+IEE     V+++ +GP+R
Sbjct: 359 ASLEDLARCKPVYEEFEGWGEEVADARSYEELPENAKTYLRRIEEFTGTKVSIVGVGPKR 418

Query: 421 ENTLIMS 427
             T+ + 
Sbjct: 419 NQTIRVR 425


>gi|259907183|ref|YP_002647539.1| adenylosuccinate synthetase [Erwinia pyrifoliae Ep1/96]
 gi|224962805|emb|CAX54262.1| Adenylosuccinate synthetase (IMP-aspartate ligase) [Erwinia
           pyrifoliae Ep1/96]
 gi|283476991|emb|CAY72883.1| adenylosuccinate synthetase [Erwinia pyrifoliae DSM 12163]
 gi|310765327|gb|ADP10277.1| adenylosuccinate synthetase [Erwinia sp. Ejp617]
          Length = 432

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G  V    L I+    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVR-ERLFISEACPLILEYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFATKLKEVMEYHNFQLVNYYKT 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLADVMAIADILTSMVVDVSELLDGARQRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL   G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCRQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DG EV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGSEVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSETTFGVKTLDGLPQAARDYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|147406|gb|AAA24446.1| adenylosuccinate synthetase (EC 6.3.4.4) [Escherichia coli]
          Length = 432

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S  P+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTDPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|327472531|gb|EGF17962.1| adenylosuccinate synthase [Streptococcus sanguinis SK408]
          Length = 430

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDNIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|238787544|ref|ZP_04631342.1| Adenylosuccinate synthetase [Yersinia frederiksenii ATCC 33641]
 gi|238724331|gb|EEQ15973.1| Adenylosuccinate synthetase [Yersinia frederiksenii ATCC 33641]
          Length = 436

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 213/432 (49%), Positives = 293/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVTSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN  L   + E
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 183

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L+E++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 184 DAVDYQTVLDEVLAIADILTAMVVDVSQLLDNARKQGEFIMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y I+ GW ++T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYEIMPGWSETTFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 424 REETMILRDPFD 435


>gi|319941499|ref|ZP_08015826.1| adenylosuccinate synthetase [Sutterella wadsworthensis 3_1_45B]
 gi|319804973|gb|EFW01812.1| adenylosuccinate synthetase [Sutterella wadsworthensis 3_1_45B]
          Length = 432

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 204/432 (47%), Positives = 279/432 (64%), Gaps = 3/432 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVDWL+E A  +VRF GG+NAGHTL +N     L L+PSG++ 
Sbjct: 3   KNVVVIGAQWGDEGKGKIVDWLTEQASGVVRFNGGHNAGHTLVINGKKTILRLIPSGIMH 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                 IG+ VV  P AF  E++ L   G+      LR++ N  LI+  H  LD  RE A
Sbjct: 63  ATSTCYIGNGVVFSPEAFFREVDELNAVGVPNVEKRLRVSGNCPLIMPYHIALDQAREAA 122

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-GE 180
           L      IGTT RGIGPAYED+V RR +RV DL   E  ++++  ++  HN +   F G 
Sbjct: 123 L--GAKKIGTTGRGIGPAYEDKVARRTVRVADLYHPERFAEQVRAVMKLHNFILTQFLGA 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +  + ++ + +   E++ P +  +   L  +  +G   LFEGAQG +LD DHGTYP+V
Sbjct: 181 EALDPEKVIADTLVYAERLKPMVCDVSETLHEQMDEGRQFLFEGAQGSMLDIDHGTYPYV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A  G+G+ P  L YVLG+ KAY TRVG GPFPTEL ++TG+ L+  G EFG
Sbjct: 241 TSSNTVAGSACAGAGVGPEKLNYVLGITKAYCTRVGEGPFPTELLDETGELLRRKGNEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R RRCGW D A++RR+V ING+ G+A+ KLDVLDGLD +K+ VGY+MDG+E+  +P
Sbjct: 301 AVTGRPRRCGWFDGAALRRAVQINGITGLAVMKLDVLDGLDTIKLGVGYKMDGKELKVMP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    + EP+Y    GW +ST G+  + +LP  AR Y+ ++ EV   P+AL+S GP+R
Sbjct: 361 SGADAVAKCEPIYEEFPGWTESTFGLTEWDELPESARQYLSRLSEVAGAPIALVSTGPDR 420

Query: 421 ENTLIMSNPFED 432
           E T++  NPF D
Sbjct: 421 EQTILHVNPFAD 432


>gi|261856593|ref|YP_003263876.1| adenylosuccinate synthetase [Halothiobacillus neapolitanus c2]
 gi|261837062|gb|ACX96829.1| adenylosuccinate synthetase [Halothiobacillus neapolitanus c2]
          Length = 431

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 206/430 (47%), Positives = 286/430 (66%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            +VVV+G QWGDEGKGKIVD L+E A  +VRFQGG+NAGHTL +      L L+PSGV+R
Sbjct: 3   KSVVVLGSQWGDEGKGKIVDLLTERAQAVVRFQGGHNAGHTLVIGGKKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A I E+  L  QG+      L ++    LIL  H  LD  RE A
Sbjct: 63  ENVQCLIGNGVVLSPEALIKEMSELESQGVPAR-ERLMLSEACPLILPYHVSLDQAREQA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                A IGTT RGIGPAYED+V RRAIR+ D+   E ++ K+ ++L  HN + R++   
Sbjct: 122 R--GAAKIGTTGRGIGPAYEDKVARRAIRLEDIFHRERLAAKLGEVLDFHNFVLRNYFHT 179

Query: 182 -EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V ++ +L++++   E + P +  + S L    R+GA+++FEGAQG LLD DHGTYP+V
Sbjct: 180 STVDFQAVLDQVLAQAEILAPMVGDVPSRLMDLRRQGANLMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +  AS G+G+ P  L YVLG+ KAYTTRVGGGPFPTEL +  G+ L   G E G
Sbjct: 240 TSSNTTAGGASTGTGVGPLELDYVLGITKAYTTRVGGGPFPTELDDAIGNHLAVKGHEVG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D  ++RR+V I+ + G+ LTKLDVLDG++ +++CVGY +DG+ V   P
Sbjct: 300 ATTGRARRCGWFDAVALRRAVEISSISGLCLTKLDVLDGIERIRVCVGYEIDGQPVKTAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +  + R  PVY  + GW  ST G+R   DLP++AR YI++IEE++ VPV ++S GP+R
Sbjct: 360 LSAETYARCVPVYEEISGWSGSTVGIRQLEDLPVEARRYIQRIEELVGVPVDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
           + T+++ +P+
Sbjct: 420 DETIVLRDPY 429


>gi|309800123|ref|ZP_07694314.1| adenylosuccinate synthetase [Streptococcus infantis SK1302]
 gi|308116252|gb|EFO53737.1| adenylosuccinate synthetase [Streptococcus infantis SK1302]
          Length = 442

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHDEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGENKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SNPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRTLEDLPENARNYVRRVSELVGVRISTFSVGPD 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|237809124|ref|YP_002893564.1| adenylosuccinate synthetase [Tolumonas auensis DSM 9187]
 gi|259547123|sp|C4L9M5|PURA_TOLAT RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|237501385|gb|ACQ93978.1| adenylosuccinate synthetase [Tolumonas auensis DSM 9187]
          Length = 432

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 198/432 (45%), Positives = 283/432 (65%), Gaps = 5/432 (1%)

Query: 3   NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRP 62
           +VV++G QWGDEGKGKIVD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R 
Sbjct: 4   SVVILGTQWGDEGKGKIVDLLTDKAQFVVRYQGGHNAGHTLVIDGKKTVLHLIPSGILRD 63

Query: 63  DKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGAL 122
           +   IIG+ VV+ P A + E+  L   G  V  + L ++    LIL  H  LD  RE A 
Sbjct: 64  NCKCIIGNGVVLAPDALLKEMNELESSGYPVR-DRLFLSEACPLILPYHVALDKARELAR 122

Query: 123 SPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGEK 181
                 IGTT RGIGPAYED+V RR +RV DL +++  ++K+++++ +HN  L + +G +
Sbjct: 123 --GNKAIGTTGRGIGPAYEDKVARRGLRVGDLFNMDTFAEKLKEVMTYHNFQLTQFYGVE 180

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
            V Y+ +L  +      ++  +  +  +L++  ++G  I+FEGAQG LLD DHGTYP+VT
Sbjct: 181 AVSYEDVLAAVKEYASLLISMVVDVTEMLDQARKRGDKIMFEGAQGTLLDIDHGTYPYVT 240

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSNT +   + GSG  P  + YVLG+ KAYTTRVGGGPFPTEL +  G+ L   G E+G 
Sbjct: 241 SSNTTAGGVATGSGYGPRFVEYVLGIAKAYTTRVGGGPFPTELFDDVGENLCARGHEYGA 300

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFLP 360
            T R+RRCGW D  +++R++ IN + G  LTKLDVLDGLDE+KIC+GY+  DG   D  P
Sbjct: 301 TTGRKRRCGWFDAVAMKRAIQINSISGFCLTKLDVLDGLDEVKICIGYKGEDGTVRDVPP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +  +    PVY  + GWK++T G++  ADLP  A NYI +IE +  VP+ ++S GP+R
Sbjct: 361 MAADGYDLVTPVYESMPGWKENTFGVKSIADLPQAAINYIHRIEAITGVPIDIISTGPDR 420

Query: 421 ENTLIMSNPFED 432
           + T+I+ +PF D
Sbjct: 421 DETMILRHPFAD 432


>gi|94496029|ref|ZP_01302608.1| Adenylosuccinate synthase [Sphingomonas sp. SKA58]
 gi|94424721|gb|EAT09743.1| Adenylosuccinate synthase [Sphingomonas sp. SKA58]
          Length = 429

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 245/432 (56%), Positives = 305/432 (70%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWLSE ADV+ RFQGG+NAGHTL V D VYKLSLLPSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLSERADVVARFQGGHNAGHTLVVGDKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VV+DP  F  E+  L  QG+ +TP+NL+IA    LIL  HRDLD LRE 
Sbjct: 61  R-GTLSVIGNGVVLDPWHFRDEVAKLKGQGVEITPDNLQIAETCPLILPFHRDLDGLRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV DL  ++ +  +I++L  HH+ALR  F E
Sbjct: 120 A--SGAGKIGTTRRGIGPAYEDKVGRRAIRVCDLAHLDDLGPQIDRLTAHHDALRAGFNE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    ++ EL      ILPF+  +W  L +   +G  ILFEGAQG LLD DHGTYPFV
Sbjct: 178 APIDRAALIAELTEIASFILPFVKPVWLTLNKAKSEGKRILFEGAQGTLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G+ P   G+VLG+ KAYTTRVG GPFP+E  N  G  L E G EFG
Sbjct: 238 TSSNTVAGTAASGTGLGPSGAGFVLGITKAYTTRVGSGPFPSEQDNDIGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+SV ++GV GIALTKLDVLDG +EL+IC GYR+  R  D+LP
Sbjct: 298 TVTGRKRRCGWFDAVLVRQSVAVSGVTGIALTKLDVLDGFEELRICTGYRIGERTFDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R EP+Y  + GW  +TAG R +ADLP QA  YIR+IEE++  PV L+S  PER
Sbjct: 358 AHAQDQARAEPIYETIGGWSDTTAGARSWADLPAQAIKYIRRIEELIGCPVTLVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           ++T+++ +PF D
Sbjct: 418 DDTILVRDPFAD 429


>gi|168207895|ref|ZP_02633900.1| adenylosuccinate synthetase [Clostridium perfringens E str.
           JGS1987]
 gi|170660790|gb|EDT13473.1| adenylosuccinate synthetase [Clostridium perfringens E str.
           JGS1987]
          Length = 428

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 185/427 (43%), Positives = 274/427 (64%), Gaps = 2/427 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  VV+G QWGDEGKGK+ D+L+E A+V+VRFQGGNNAGHT++V D  YKL L+PSG++
Sbjct: 1   MSAFVVLGAQWGDEGKGKMTDYLAEEAEVVVRFQGGNNAGHTVEVEDKQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+++IG+ VVVDP A  +EI+ L   G+ VTP  L +++ A LI+  H  LD L+E 
Sbjct: 61  HDEKLNVIGNGVVVDPKALFTEIDYLEGLGVKVTPEKLIVSDRAHLIMPYHITLDKLKEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGP Y D+  R  IRV DL   +  ++K+   +   N   +  G 
Sbjct: 121 ARGKND--IGTTCKGIGPCYTDKYERSGIRVCDLMHKDSFAEKLRINIEMKNGYIKLLGG 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+ +  I  E M   E++ P++      +    +   ++LFEGAQG LLD D+GTYP+V
Sbjct: 179 EELNFDEIYNEYMAFAERLRPYVKDTSVEIYNAIQADKNVLFEGAQGMLLDIDYGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT S   + G+GI P  +   +G+ KAYTTRVG GPFPTEL+N+ GD+++E G E+G
Sbjct: 239 TSSNTTSCGVASGAGIGPNMVTNAVGIAKAYTTRVGKGPFPTELENEIGDWIREKGHEYG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGWLDL  ++ +  + G+  + +TK+D L GL+++++CVGY +DG+ +D+ P
Sbjct: 299 VTTGRSRRCGWLDLVILKTTTRVCGLTSLVVTKIDTLAGLEKIQMCVGYELDGKVIDYFP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y   EGW +  A  R + +LP  A+ Y+R+IEE     V+++ +GP+R
Sbjct: 359 ASLEDLARCKPIYEEFEGWGEEVADARSYDELPENAKTYLRRIEEFTGTKVSIVGVGPKR 418

Query: 421 ENTLIMS 427
             T+ + 
Sbjct: 419 NQTIRVR 425


>gi|288906318|ref|YP_003431540.1| adenylosuccinate synthase [Streptococcus gallolyticus UCN34]
 gi|306832375|ref|ZP_07465528.1| adenylosuccinate synthase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325979332|ref|YP_004289048.1| adenylosuccinate synthetase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288733044|emb|CBI14625.1| adenylosuccinate synthase [Streptococcus gallolyticus UCN34]
 gi|304425415|gb|EFM28534.1| adenylosuccinate synthase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325179260|emb|CBZ49304.1| adenylosuccinate synthetase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 430

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 279/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + ++E++ L  +GI  T ++LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVTELKYLHDEGI--TTDSLRISDRAHVILPYHIKLDRLQES 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRVNLEEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + ++ I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 CEPIKFEDIFEEYYEYGQQIKDYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELLDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G R   +LP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGCRSLDELPENARNYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           R+ T I+ + + +
Sbjct: 417 RDQTNILESVWAN 429


>gi|71902800|ref|YP_279603.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS6180]
 gi|94989647|ref|YP_597747.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS10270]
 gi|110826525|sp|Q48VK8|PURA_STRPM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|166232501|sp|Q1JIX0|PURA_STRPD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|71801895|gb|AAX71248.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS6180]
 gi|94543155|gb|ABF33203.1| Adenylosuccinate synthetase [Streptococcus pyogenes MGAS10270]
          Length = 430

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|312866803|ref|ZP_07727016.1| adenylosuccinate synthase [Streptococcus parasanguinis F0405]
 gi|311097586|gb|EFQ55817.1| adenylosuccinate synthase [Streptococcus parasanguinis F0405]
          Length = 430

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VV++P + + E+  L  +G+  T ++LRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGVVINPKSLVKELAYLHEEGV--TTDSLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N       E
Sbjct: 119 --SKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDVFAERLRINLEEKNRQFTKLYE 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E   +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 AEALSFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|113971598|ref|YP_735391.1| adenylosuccinate synthetase [Shewanella sp. MR-4]
 gi|114046190|ref|YP_736740.1| adenylosuccinate synthetase [Shewanella sp. MR-7]
 gi|113886282|gb|ABI40334.1| Adenylosuccinate synthetase [Shewanella sp. MR-4]
 gi|113887632|gb|ABI41683.1| Adenylosuccinate synthetase [Shewanella sp. MR-7]
          Length = 431

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVINGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI+ L  +GI V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEIKMLKERGIPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMAYHNFMLTEYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 DAVDYEQTLSDALALADYLKSMCVDVTELLDNARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQHSDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW +ST G      LP  A NYI++IEE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVYETMPGWSESTFGATSLEQLPQAAINYIKRIEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ +PF
Sbjct: 420 RNETMILVSPF 430


>gi|297545606|ref|YP_003677908.1| adenylosuccinate synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296843381|gb|ADH61897.1| adenylosuccinate synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 426

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 195/429 (45%), Positives = 282/429 (65%), Gaps = 5/429 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ +V+VG QWGDEGKGKI D+L+E ADV+VR+QGGNNAGHT++   I YKL L+PSG++
Sbjct: 1   MSTLVIVGTQWGDEGKGKITDYLAEKADVVVRYQGGNNAGHTVEKESIQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+ +IG+ VV+DP + I EIE+L  QGI  + +NL+I++ A ++   H   D L E 
Sbjct: 61  YPEKICVIGNGVVIDPASLIEEIENLQKQGI--SVDNLKISDRAHIVFPYHIKQDELEEI 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
             S     +GTT+RGIGP Y D+  R  IRV D  + +   +K+ + +   N L +  +G
Sbjct: 119 --SKGKNDLGTTKRGIGPCYMDKSERIGIRVCDFINPKVFEEKLRRNVEKKNKLFKEIYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +E  ++ I ++ +   EKI PF+     LL    + G  +LFEGAQG LLD D GTYP+
Sbjct: 177 TEEFDFEEIYKKYLEYAEKIKPFVTDTTVLLYDLIKNGKRVLFEGAQGTLLDLDLGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++   +IG+GI P  +  V+GVVKAYTTRVG GPFPTEL ++  +FL+E G E+
Sbjct: 237 VTASHPIAGGVTIGAGIGPTMIDEVIGVVKAYTTRVGKGPFPTELFDENAEFLREKGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   +R SV ++G+   ALTKLD L GL ++KIC GY+ +GR +   
Sbjct: 297 GTTTGRARRCGWLDAVILRYSVRVSGITHFALTKLDTLTGLKKIKICTGYKFNGRIITDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       + EPVY   +GW ++  G + F DLP  A+ Y+++IEE++ +   ++S+GPE
Sbjct: 357 PASLEDLAQCEPVYEEFDGWDENIQGAKTFEDLPYNAQKYVKRIEELMGIKATIISVGPE 416

Query: 420 RENTLIMSN 428
           R  T+I+ +
Sbjct: 417 RNQTIILKD 425


>gi|251788137|ref|YP_003002858.1| adenylosuccinate synthetase [Dickeya zeae Ech1591]
 gi|247536758|gb|ACT05379.1| adenylosuccinate synthetase [Dickeya zeae Ech1591]
          Length = 432

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 289/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+ +L  +G+ V    + ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDALLKEMTALEARGVPVR-ERMLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN     + + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDRESFAIKLKEIMEYHNFQLVHYYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L +++   + +   +  +  LL +  ++G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKTLNDVLAVADILTGMVVDVSDLLYKAHQRGDYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++ G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFDEVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL+E+KIC+GYRM DG  VD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLNEVKICIGYRMPDGSNVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW +ST G++ ++ LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAADGWEGIEPIYETLPGWSESTFGVKEYSKLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|294010167|ref|YP_003543627.1| adenylosuccinate synthase [Sphingobium japonicum UT26S]
 gi|292673497|dbj|BAI95015.1| adenylosuccinate synthase [Sphingobium japonicum UT26S]
          Length = 429

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 249/432 (57%), Positives = 310/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWLSE ADV+ RFQGG+NAGHTL V + VYKLSLLPSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLSERADVVARFQGGHNAGHTLVVGEKVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R   +S+IG+ VV+DP  F  E+  L  QG+ +TP+NL+IA    LIL  HRDLD LRE 
Sbjct: 61  R-GTLSVIGNGVVLDPWHFRDEVAKLKGQGVEITPDNLQIAETCPLILPFHRDLDGLRED 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAIRV DL  ++ +  ++++L  HH+ALR  F E
Sbjct: 120 A--SGAGKIGTTRRGIGPAYEDKVGRRAIRVCDLAHLDDLGPQLDRLTAHHDALRAGFNE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    ++ EL      ILPF+  +W  L +   +G  ILFEGAQG LLD DHGTYPFV
Sbjct: 178 APIDRDALMAELRDIAGFILPFVKPVWLTLNKAKAEGKRILFEGAQGTLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G+ P   G+VLG+VKAYTTRVG GPFPTE +N  G  L E G EFG
Sbjct: 238 TSSNTVAGTAASGTGLGPNGAGFVLGIVKAYTTRVGSGPFPTEQENDVGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+SV ++GV GIALTKLDVLDG DELKICVGYR+  R  D+LP
Sbjct: 298 TVTGRKRRCGWFDAVLVRQSVAVSGVTGIALTKLDVLDGFDELKICVGYRIGDRHFDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    + EPVY  +EGW+ +TAG R +A+LP QA  YIR+IEE++  PV L+S  PER
Sbjct: 358 AHAQDQAKAEPVYESIEGWQDTTAGARSWAELPAQAIKYIRRIEELIGCPVTLVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PF D
Sbjct: 418 EDTILVRDPFAD 429


>gi|171777582|ref|ZP_02919270.1| hypothetical protein STRINF_00105 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283191|gb|EDT48615.1| hypothetical protein STRINF_00105 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 430

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 280/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + ++E++ L  +GI  T ++LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVTELKYLHDEGI--TTDSLRISDRAHVILPYHIKLDRLQES 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRVNLEEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + ++ I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 CEPIKFEDIFEEYYEYGQQIKDYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVIGVCKAYTSRVGDGPFPTELLDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G R   +LP  AR+Y+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGCRSLDELPENARDYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           R+ T I+ + + +
Sbjct: 417 RDQTNILESVWAN 429


>gi|238764697|ref|ZP_04625641.1| Adenylosuccinate synthetase [Yersinia kristensenii ATCC 33638]
 gi|238697093|gb|EEP89866.1| Adenylosuccinate synthetase [Yersinia kristensenii ATCC 33638]
          Length = 432

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+E++   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDEVLAIADILTAMVVDVSELLDGARKRGDFMMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREV   
Sbjct: 300 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI ++EE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETMPGWTETTFGVKEHSKLPQAALNYIARVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|330939876|gb|EGH43104.1| adenylosuccinate synthetase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P +  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLILDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEEMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|71909950|ref|YP_281500.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS5005]
 gi|94987769|ref|YP_595870.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS9429]
 gi|166232500|sp|Q1JNS3|PURA_STRPC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|71852732|gb|AAZ50755.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS5005]
 gi|94541277|gb|ABF31326.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS9429]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLGFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|262275150|ref|ZP_06052961.1| adenylosuccinate synthetase [Grimontia hollisae CIP 101886]
 gi|262221713|gb|EEY73027.1| adenylosuccinate synthetase [Grimontia hollisae CIP 101886]
          Length = 438

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 199/439 (45%), Positives = 276/439 (62%), Gaps = 12/439 (2%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+N VVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MSNNVVVLGTQWGDEGKGKIVDLLTEDAQYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   IIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LDM RE
Sbjct: 61  LRNNVKCIIGNGVVLSPDALMKEMGELEARGIPVR-ERLFLSEACPLILPYHVALDMARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F 
Sbjct: 120 KAR--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEAFAEKLKEVMELHNFQLEHFY 177

Query: 180 E-KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + + V Y+  L ++M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP
Sbjct: 178 KAEPVSYEETLAKVMEQADILTSMVIDVTQELDDARQRGDKIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP------TELKNQTGDFL 292
           +VTSSNT +   ++GSG  P  LGY+LG+ KAY TRVG GPFP       + ++  G  L
Sbjct: 238 YVTSSNTTAGGVAVGSGFGPRHLGYILGIAKAYCTRVGSGPFPTELYDGKDKQDPVGKHL 297

Query: 293 KEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RM 351
            EVG EFG  T R RR GW D  ++RR++ IN + G  LTKLDVLDGL+E+KIC GY + 
Sbjct: 298 GEVGHEFGATTGRLRRTGWFDAVAMRRAIQINSISGFCLTKLDVLDGLEEIKICTGYQKA 357

Query: 352 DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPV 411
           DG  +   P  +  +    P+Y  + GW ++T G +   +LP  A +YI++IEE+  VPV
Sbjct: 358 DGTILTVSPMAADDYENITPIYETVPGWSENTFGAKSIEELPQAALDYIKRIEELTGVPV 417

Query: 412 ALLSIGPERENTLIMSNPF 430
            ++S GP+R  T+I  +PF
Sbjct: 418 DIISTGPDRNETIIKVHPF 436


>gi|94993537|ref|YP_601635.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS10750]
 gi|166232502|sp|Q1J8S0|PURA_STRPF RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|94547045|gb|ABF37091.1| Adenylosuccinate synthetase [Streptococcus pyogenes MGAS10750]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L ++G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHNEGV--TTDNLRISDRAQVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PANLEQLKRCKPIYEELPGWQEDITGVRSLEELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|323350633|ref|ZP_08086295.1| adenylosuccinate synthase [Streptococcus sanguinis VMC66]
 gi|322123315|gb|EFX95000.1| adenylosuccinate synthase [Streptococcus sanguinis VMC66]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/433 (43%), Positives = 277/433 (63%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +    +R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITSVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|21909661|ref|NP_663929.1| adenylosuccinate synthetase [Streptococcus pyogenes MGAS315]
 gi|28895039|ref|NP_801389.1| adenylosuccinate synthetase [Streptococcus pyogenes SSI-1]
 gi|25008996|sp|Q8K8S7|PURA_STRP3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|21903843|gb|AAM78732.1| putative adenylosuccinate synthetase [Streptococcus pyogenes
           MGAS315]
 gi|28810284|dbj|BAC63222.1| putative adenylosuccinate synthetase [Streptococcus pyogenes SSI-1]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L  + + 
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYN 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|223933526|ref|ZP_03625508.1| Adenylosuccinate synthase [Streptococcus suis 89/1591]
 gi|302024534|ref|ZP_07249745.1| adenylosuccinate synthase [Streptococcus suis 05HAS68]
 gi|330833580|ref|YP_004402405.1| adenylosuccinate synthase [Streptococcus suis ST3]
 gi|223897786|gb|EEF64165.1| Adenylosuccinate synthase [Streptococcus suis 89/1591]
 gi|329307803|gb|AEB82219.1| Adenylosuccinate synthase [Streptococcus suis ST3]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGTKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + EI  L   G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKEINYLHDSGV--TTDNLRISDRAHVILPYHIKLDQLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGENKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRTNLAEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPIEFDEIFEEYYAYGQEIKKYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+GKE+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELHDEIGDRIREIGKEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL+ LKICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLETLKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  + GW +   G+R   +LP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEEMPGWSEDITGVRSLDELPEAARNYVRRISELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|238795258|ref|ZP_04638841.1| Adenylosuccinate synthetase [Yersinia intermedia ATCC 29909]
 gi|238725426|gb|EEQ16997.1| Adenylosuccinate synthetase [Yersinia intermedia ATCC 29909]
          Length = 436

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A+ +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERANYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVTSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + + 
Sbjct: 126 R--GEKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKA 183

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L+E++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 184 DAVDYQTVLDEVLAIADILTAMVVDVSDLLDSARKRGDLIMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW + T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYETMPGWSEITFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 424 RDETMILRDPFD 435


>gi|2564709|gb|AAB86714.1| adenylosuccinate synthetase [Edwardsiella ictaluri 93-146]
          Length = 432

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 215/432 (49%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIANGVVLAPDALLREMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    ++   
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKASFAVKLKEIMEYHNFQLVNYYHV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+++L+E+M   + +   +  +  LL +  R G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQSVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL +  G+FL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRRVDYVLGIVKAYSTRVGAGPFPTELFDSVGEFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGLDE+KICVGYR+ DGREVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y +L GWK+ST G+++   LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVLPGWKESTFGVKLRDGLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+++ +PF+
Sbjct: 420 REETIVLRHPFD 431


>gi|331265453|ref|YP_004325083.1| adenylosuccinate synthetase [Streptococcus oralis Uo5]
 gi|326682125|emb|CBY99741.1| adenylosuccinate synthetase [Streptococcus oralis Uo5]
          Length = 444

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 17  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 76

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 77  FPEKISVIGNGMVVNPKSLVKELTYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 134

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L+  N L     +
Sbjct: 135 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLVEKNRLFEKLYD 192

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 193 STPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 252

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 253 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 312

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 313 GTTTGRPRRVGWFDSVVMRHSSRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 373 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 432

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 433 REQTNILESVW 443


>gi|311281271|ref|YP_003943502.1| adenylosuccinate synthetase [Enterobacter cloacae SCF1]
 gi|308750466|gb|ADO50218.1| adenylosuccinate synthetase [Enterobacter cloacae SCF1]
          Length = 432

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  DNVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    +F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFADKLKEVMEYHNFQLVNFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+++M   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVMAVADVLTAMVVDVSDLLDSARKRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDSVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      E +Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWEGIEAIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RTETMILRDPFD 431


>gi|15674367|ref|NP_268541.1| adenylosuccinate synthetase [Streptococcus pyogenes M1 GAS]
 gi|21263911|sp|Q9A1P8|PURA_STRP1 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|13621455|gb|AAK33262.1| putative adenylosuccinate synthetase [Streptococcus pyogenes M1
           GAS]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPNKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PANLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|323492113|ref|ZP_08097275.1| adenylosuccinate synthetase [Vibrio brasiliensis LMG 20546]
 gi|323313674|gb|EGA66776.1| adenylosuccinate synthetase [Vibrio brasiliensis LMG 20546]
          Length = 438

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 199/438 (45%), Positives = 274/438 (62%), Gaps = 11/438 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A I E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNIKCVIGNGVVLSPEALIKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDQAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEVFAEKLKEVMEFHNFQLEHFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y  +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EPVSYDEVLEQCMGYADLLTSMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG+EFG  T R RR GW D  ++RR+V IN + G  LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGQEFGATTGRLRRTGWFDAVAMRRAVQINSISGFCLTKLDVLDGLEELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G      LP  A +YI++IEE+  V V +
Sbjct: 360 SILEVSPMAAEAFEEATPIYETMPGWSENTFGATSIDALPKAALDYIKRIEELTGVTVDI 419

Query: 414 LSIGPERENTLIMSNPFE 431
           +S GP+R  T+I  +PFE
Sbjct: 420 ISTGPDRNETIIKVHPFE 437


>gi|319940018|ref|ZP_08014372.1| adenylosuccinate synthetase [Streptococcus anginosus 1_2_62CV]
 gi|319810732|gb|EFW07059.1| adenylosuccinate synthetase [Streptococcus anginosus 1_2_62CV]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDHKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAIQFDDIFEEYYAYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGNRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLTGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|312865453|ref|ZP_07725680.1| adenylosuccinate synthase [Streptococcus downei F0415]
 gi|311098971|gb|EFQ57188.1| adenylosuccinate synthase [Streptococcus downei F0415]
          Length = 430

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 187/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VV++P + ++E++ L  +G+    ++LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVINPKSLVTELDYLHKEGV--ATDSLRISDRAHVILPYHIKLDQLQEA 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     E
Sbjct: 119 A--KGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKDIFAQRLRANLAEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + +  I EE     + I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 CQPLSFDDIFEEYYQYGQAIKDYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++TGD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELNDETGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL  +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLPTIKICVAYDLDGKRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G R   +LP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGCRSLDELPEAARNYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           R+ T I+ + + +
Sbjct: 417 RDQTNILDSVWAN 429


>gi|209886267|ref|YP_002290124.1| adenylosuccinate synthetase [Oligotropha carboxidovorans OM5]
 gi|209874463|gb|ACI94259.1| adenylosuccinate synthetase [Oligotropha carboxidovorans OM5]
          Length = 506

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 256/431 (59%), Positives = 330/431 (76%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGVV
Sbjct: 77  MTNVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGKTYKLALLPSGVV 136

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV DP AFI E+E L  QG+ V+P+NLR+A N +LIL +HR+LD +RE 
Sbjct: 137 RPSKLSVIGNGVVFDPQAFIIEMERLKEQGVAVSPDNLRVAENVTLILPLHRELDAVREN 196

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  K+++LL HHNALRR    
Sbjct: 197 A--SKATAIGTTQRGIGPAYEDKVGRRAIRLMDLDDPQTLPHKVDRLLAHHNALRRGLSL 254

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    ++++L     K+LPF D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 255 PEIDATALIKDLAELAPKVLPFADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 314

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++AQA+ GSG+ P +LGYVLG+ KAYTTRVG GPFPTEL + TG+ + E G+EFG
Sbjct: 315 TSSNTVAAQAATGSGMGPNALGYVLGICKAYTTRVGQGPFPTELMDATGELIGERGREFG 374

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG +E+K+CVGY +DG+E+D LP
Sbjct: 375 VNTGRKRRCGWFDAVLVRQTVRTCGIHGLALTKLDILDGFEEIKVCVGYELDGKEIDHLP 434

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 +R +P+Y  +EGW++ TA  R +ADLP QA  Y+R++EE++   VALLS  PER
Sbjct: 435 AGEGAQSRIKPIYETIEGWQEPTANARSWADLPAQAIKYVRRVEELVGCSVALLSTSPER 494

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 495 EDTILVQNPFE 505


>gi|195978912|ref|YP_002124156.1| adenylosuccinate synthetase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195975617|gb|ACG63143.1| adenylosuccinate synthetase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 438

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 188/431 (43%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ +++  +KL L+PSG+ 
Sbjct: 9   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF 68

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 69  FQEKISVIGNGVVVNPKSLVKELAYLHKEGV--TTDNLRISDRAHVILPYHIKLDQLQEE 126

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  +++++  L   N L     +
Sbjct: 127 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFAERLKTNLAEKNRLFEKMYD 184

Query: 181 K-EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 185 SAPIAFDEIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 244

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++E+G E+
Sbjct: 245 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREIGHEY 304

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL+ +KICV Y +DG+ +D  
Sbjct: 305 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLETVKICVAYDLDGKRIDHY 364

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 365 PASLEQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRIGELVGVRISTFSVGPG 424

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 425 REQTNILESVW 435


>gi|307702825|ref|ZP_07639773.1| adenylosuccinate synthetase [Streptococcus oralis ATCC 35037]
 gi|307623505|gb|EFO02494.1| adenylosuccinate synthetase [Streptococcus oralis ATCC 35037]
          Length = 428

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELTYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFRERLERNLTEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|28872051|ref|NP_794670.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967929|ref|ZP_03396075.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato T1]
 gi|289672590|ref|ZP_06493480.1| adenylosuccinate synthetase [Pseudomonas syringae pv. syringae FF5]
 gi|301384449|ref|ZP_07232867.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|302064116|ref|ZP_07255657.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato K40]
 gi|302132263|ref|ZP_07258253.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|37999556|sp|Q87VJ9|PURA_PSESM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|28855304|gb|AAO58365.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927272|gb|EEB60821.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tomato T1]
 gi|331014615|gb|EGH94671.1| adenylosuccinate synthetase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 430

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEEMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|153835428|ref|ZP_01988095.1| adenylosuccinate synthetase [Vibrio harveyi HY01]
 gi|156972469|ref|YP_001443376.1| adenylosuccinate synthetase [Vibrio harveyi ATCC BAA-1116]
 gi|148868033|gb|EDL67218.1| adenylosuccinate synthetase [Vibrio harveyi HY01]
 gi|156524063|gb|ABU69149.1| hypothetical protein VIBHAR_00089 [Vibrio harveyi ATCC BAA-1116]
          Length = 438

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 195/437 (44%), Positives = 273/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEMFAEKLKEVMEFHNFQLEHFYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y  +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DTVSYDEVLEQCMGYADLLTSMVMDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL E+KIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLTGMCLTKLDVLDGLKEIKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IEE+  VPV +
Sbjct: 360 AILEVSPMAAESFEEATPIYETMPGWSETTFGAKSIDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 ISTGPDRNETIIKVHPY 436


>gi|306834488|ref|ZP_07467601.1| adenylosuccinate synthase [Streptococcus bovis ATCC 700338]
 gi|304423290|gb|EFM26443.1| adenylosuccinate synthase [Streptococcus bovis ATCC 700338]
          Length = 430

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 279/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + ++E++ L  +GI  T ++LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVTELKYLHDEGI--TTDSLRISDRAHVILPYHIKLDRLQES 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGDNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRVNLEEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + ++ I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 CEPIKFEDIFEEYYEYGQQIKDYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELLDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G R   +LP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLKQLKRCKPIYEELPGWSEDITGCRSLDELPENARNYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           R+ T I+ + + +
Sbjct: 417 RDQTNILESVWAN 429


>gi|34498983|ref|NP_903198.1| adenylosuccinate synthetase [Chromobacterium violaceum ATCC 12472]
 gi|46396784|sp|Q7NS98|PURA2_CHRVO RecName: Full=Adenylosuccinate synthetase 2; Short=AMPSase 2;
           Short=AdSS 2; AltName: Full=IMP--aspartate ligase 2
 gi|34104833|gb|AAQ61190.1| adenylosuccinate synthetase [Chromobacterium violaceum ATCC 12472]
          Length = 431

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 215/432 (49%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVVV+G QWGDEGKGKIVDWL+++A  +VRFQGG+NAGHTL VN     + L+PSG+
Sbjct: 1   MSKNVVVIGTQWGDEGKGKIVDWLTDHARAVVRFQGGHNAGHTLWVNGKKTVVRLVPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +RPD    IG+ VV+ P A + EI+ L   G+  +   L+IA    LIL  H  LD  RE
Sbjct: 61  LRPDVECFIGNGVVLSPEALLKEIDELEAAGVNASA-RLKIAEGCPLILPYHIALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A     A IGTT RGIGP YED+V RRA++V+DL D      K+++ + ++N L  +  
Sbjct: 120 AA--KGDAKIGTTGRGIGPCYEDKVARRALKVIDLFDPARFETKLKENVDYYNFLLTNLF 177

Query: 180 E-KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
           + + V Y+ IL + M   E+I P +  +   L    + G  ILFEGAQG LLD DHGTYP
Sbjct: 178 KAEPVSYEAILADTMKMAERIKPMVADVSRTLYDLDKAGTPILFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSN ++  A+ G+G+ P  L YVLG+VK Y TRVG GPFPTE +N+ G FL + G E
Sbjct: 238 YVTSSNCVAGAAAPGAGVPPQMLNYVLGIVKGYATRVGSGPFPTEQENEIGAFLAKRGNE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDF 358
           FG+VT R RRCGW D A+++RS+ INGV G+ + KLDV+DGL+E+K+C GY +DG++VD 
Sbjct: 298 FGSVTGRPRRCGWFDAAALKRSIQINGVSGLCVMKLDVMDGLEEIKLCTGYMLDGQKVDI 357

Query: 359 LPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGP 418
           LP  S   T+ EPVY  L GW  +T G++ + DLP  A+ Y+++IEEV   PV ++S GP
Sbjct: 358 LPFGSDAVTKCEPVYETLPGWTGTTVGVKRWEDLPANAQAYLKRIEEVCGAPVDIVSTGP 417

Query: 419 ERENTLIMSNPF 430
           +RE T+++ +PF
Sbjct: 418 DREETIVLRHPF 429


>gi|163845263|ref|YP_001622918.1| adenylosuccinate synthetase [Brucella suis ATCC 23445]
 gi|189038295|sp|A9WWG0|PURA_BRUSI RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|163675986|gb|ABY40096.1| adenylosuccinate synthetase [Brucella suis ATCC 23445]
          Length = 429

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 265/432 (61%), Positives = 336/432 (77%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVIVR+QGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDPH F++E+E L  QGI VTP+ LR+A NA LILSIHR+LD +REG
Sbjct: 61  R-GKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREG 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S  G  IGTT+RGIGPAYED+VGRRAIRV+DLT+ E +  K+E+LL HHN+LRR  G 
Sbjct: 120 --SNSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGL 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +E+  +TIL EL    ++ILP++D +W +L+   + GA ILFEGAQG LLDNDHGTYPFV
Sbjct: 178 EEIAVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P ++GYVLG+ KAYTTRVG GPFPTEL ++ G+FL   G EFG
Sbjct: 238 TSSNTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RRCGW D   VR++V  +G+ GIALTKLDVLDGL+E+KICV Y +DG+ +D+LP
Sbjct: 298 VVTGRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  L GW ++TAG R + DLP Q   Y+R IEE++  PVA+LS  PER
Sbjct: 358 SSMGAQARVKPIYETLPGWSETTAGARSWNDLPAQTVKYVRHIEELIGAPVAMLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++++PF D
Sbjct: 418 EDTILVTDPFHD 429


>gi|229542342|ref|ZP_04431402.1| adenylosuccinate synthetase [Bacillus coagulans 36D1]
 gi|229326762|gb|EEN92437.1| adenylosuccinate synthetase [Bacillus coagulans 36D1]
          Length = 429

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 269/431 (62%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSENA+V+ R+QGGNNAGHT++ N   YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSENAEVVSRYQGGNNAGHTIRFNGETYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+ +IG+ VVVDP A + E++ L  +GI  +  NLRI+N A +IL  H  LD   E 
Sbjct: 61  YKDKICVIGNGVVVDPKALVEELDYLNGRGI--STENLRISNRAHVILPYHIKLDGAEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT++GIGPAY D+  R  IR+ DL D E   +K+ + L   N L     E
Sbjct: 119 R--KGSNKIGTTKKGIGPAYMDKAARTGIRIADLLDYEEFKEKLTRNLEEKNRLFEKIYE 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E    + ILE      ++   ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 TEGFTLEEILEPYYEYGQRFKQYVCDTSVVLNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  + +V+G+ KAYTTRVG GPFPTEL ++TGD ++E G E+
Sbjct: 237 VTSSNPIAGGVTIGSGVGPSKINHVVGIAKAYTTRVGDGPFPTELLDETGDRIRETGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  +++  LDVL G++ LKICV YR  G+ ++  
Sbjct: 297 GTTTGRARRVGWFDSVVVRHARRVSGLTDLSVNLLDVLTGIETLKICVAYRYKGKVLEAF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EPVY  L GW +   G R   +LP  AR+Y+ +I ++  VP+++ S+GP+
Sbjct: 357 PASLKVLAECEPVYEELPGWTEDITGCRSLDELPDNARHYLERISQLTGVPLSMFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R  T+++ + +
Sbjct: 417 RLQTIVVQSVW 427


>gi|299134305|ref|ZP_07027498.1| adenylosuccinate synthetase [Afipia sp. 1NLS2]
 gi|298591052|gb|EFI51254.1| adenylosuccinate synthetase [Afipia sp. 1NLS2]
          Length = 430

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 254/431 (58%), Positives = 327/431 (75%), Gaps = 2/431 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL +N   YKL+LLPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGKTYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV DP AF++E+  L  QG+ V+P+NLR+A N +LIL +HR+LD +RE 
Sbjct: 61  RPSKLSVIGNGVVFDPQAFVTEVARLKEQGVAVSPDNLRVAENVTLILPLHRELDAVREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTTQRGIGPAYED+VGRRAIR+MDL D + +  KIE+LL HHNALRR    
Sbjct: 121 A--SKATAIGTTQRGIGPAYEDKVGRRAIRLMDLADPQTLPHKIERLLAHHNALRRGLSL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    +L+EL     ++LP+ D +W+LL+ + R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 179 PEIDPGLVLKELAEVAPQVLPYADSVWNLLDHKRREGKRILFEGAQGALLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ P SLGYVLG+ KAYTTRVG GPFPTEL + TG+ + + G+EFG
Sbjct: 239 TSSNTVAASAATGSGMGPSSLGYVLGICKAYTTRVGMGPFPTELTDATGELIGQRGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ G+ALTKLD+LDG +E+K+CVGY +DG+E+D LP
Sbjct: 299 VNTGRKRRCGWFDAMLVRQTVRTCGIHGLALTKLDILDGFEEIKVCVGYELDGKEIDHLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  +EGW++ TA  R +ADLP QA  Y+R++EE++   VALLS  PER
Sbjct: 359 AGEGAQARVKPIYETIEGWQEPTANARSWADLPAQAIKYVRRVEELVGCSVALLSTSPER 418

Query: 421 ENTLIMSNPFE 431
           E+T+++ NPFE
Sbjct: 419 EDTILVQNPFE 429


>gi|289166925|ref|YP_003445192.1| adenylosuccinate synthetase [Streptococcus mitis B6]
 gi|288906490|emb|CBJ21320.1| adenylosuccinate synthetase [Streptococcus mitis B6]
          Length = 428

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SKAIAFDDIFEEYYEYGQQIKKYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R  P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCMPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|148981044|ref|ZP_01816264.1| adenylosuccinate synthetase [Vibrionales bacterium SWAT-3]
 gi|145961020|gb|EDK26343.1| adenylosuccinate synthetase [Vibrionales bacterium SWAT-3]
          Length = 438

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/437 (44%), Positives = 275/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEMFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y+ +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYEDVLEQCMGYADLLTSMVMDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL+E+KIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLTGMCLTKLDVLDGLEEIKICTGYKMADG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IE++  VP+ +
Sbjct: 360 SILEVSPMAAESFEEATPIYETMPGWSETTFGAKSIDALPQAALDYIKRIEDLTGVPIDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 VSTGPDRNETIIKVHPY 436


>gi|117919147|ref|YP_868339.1| adenylosuccinate synthetase [Shewanella sp. ANA-3]
 gi|117611479|gb|ABK46933.1| Adenylosuccinate synthetase [Shewanella sp. ANA-3]
          Length = 431

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVINGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI+ L  +GI V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEIKMLKERGIPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMAYHNFMLTEYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 DAVDYEQTLSDALALADYLKSMCVDVTELLDNARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIIKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQHPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW +ST G      LP  A NYI++IEE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVYETMPGWSESTFGATSLEQLPQAAINYIKRIEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ +PF
Sbjct: 420 RNETMILVSPF 430


>gi|332139995|ref|YP_004425733.1| adenylosuccinate synthetase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|229576691|sp|B4S195|PURA_ALTMD RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|327550017|gb|AEA96735.1| adenylosuccinate synthetase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 432

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 199/432 (46%), Positives = 276/432 (63%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDRAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + E+  L  +G+ V    L+I+    LIL  H  LD+ RE A
Sbjct: 63  DNVTCIIGNGVVLSPDALMKEMTMLEERGVPVR-ERLKISEACPLILPYHIALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K++++L  HN  L + +GE
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNAEDFAAKLKEVLDVHNFTLTQYYGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V ++  L   M   + +   +  +   L++  + G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDFEETLNGAMEVADILKAMVVDVTDELDKAHKAGLPIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P  L YVLG+VKAYTTRVG GPFPTEL  + G  L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLKLDYVLGIVKAYTTRVGSGPFPTELDCEVGQHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R+RR GW D  +++R+V IN + G  LTKLDVLDGL+ L+ICVGY+  DG   D  
Sbjct: 300 ATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLESLQICVGYKDADGNVKDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW  +T G+  F  LP  A+NYI+++EE+  VPV ++S GP+
Sbjct: 360 PMAADGYDKVTPVYEEMPGWTDNTFGVTEFEGLPQAAKNYIKRLEELTGVPVDIVSTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +P++
Sbjct: 420 RNETIVLRSPYD 431


>gi|86148229|ref|ZP_01066526.1| adenylosuccinate synthetase [Vibrio sp. MED222]
 gi|218708328|ref|YP_002415949.1| adenylosuccinate synthetase [Vibrio splendidus LGP32]
 gi|85833999|gb|EAQ52160.1| adenylosuccinate synthetase [Vibrio sp. MED222]
 gi|218321347|emb|CAV17297.1| Adenylosuccinate synthetase [Vibrio splendidus LGP32]
          Length = 438

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 196/437 (44%), Positives = 275/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  NNVKCVIGNGVVLSPDALLKEMKPLEERGIPVR-ERLFISEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEAFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y+ +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYEEVLEQAMSYADMLTAMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      E ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLEKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLSGMCLTKLDVLDGLEELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IE++  VP+ +
Sbjct: 360 SILEVSPMAAESFEEATPIYETMPGWSENTFGAKSIDALPQAALDYIKRIEDLTGVPIDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 VSTGPDRNETIIKVHPY 436


>gi|54310425|ref|YP_131445.1| adenylosuccinate synthetase [Photobacterium profundum SS9]
 gi|81828663|sp|Q6LM35|PURA_PHOPR RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|46914866|emb|CAG21643.1| putative adenylosuccinate synthetase [Photobacterium profundum SS9]
          Length = 432

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 198/433 (45%), Positives = 273/433 (63%), Gaps = 6/433 (1%)

Query: 1   MTN-VVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M N VVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG+
Sbjct: 1   MANNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +   IIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE
Sbjct: 61  LRNNVKCIIGNGVVLSPDALMKEMGPLEARGIPVR-ERLFLSEACPLILPYHIALDQARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSF 178
            A       IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN  L   +
Sbjct: 120 IARGK--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEAFAEKLKEVMAYHNFQLEHYY 177

Query: 179 GEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
             + V Y  +L  +M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP
Sbjct: 178 NAEPVSYDEVLASVMAQADVLTAMVIDVTQELDDARKRGDKIMFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           +VTSSNT +   + GSG  P  LGY+LG+ KAY TRVG GPFPTEL +  G+ L   G E
Sbjct: 238 YVTSSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELDDAVGEHLGVKGNE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVD 357
           FG  T R+RRCGW D  ++RR+V IN + G  LTKLDV+DGL E+KIC GY+  DG+ + 
Sbjct: 298 FGATTGRKRRCGWFDAVAMRRAVQINSISGFCLTKLDVMDGLKEIKICTGYKTQDGKTLS 357

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P  +  +   E +Y  + GW ++T G +    LP  A +YI +IEE+  VP+ ++S G
Sbjct: 358 VSPMAADAYENLELIYETMPGWSENTFGAKTLDALPQAALDYIARIEELTGVPIDIVSTG 417

Query: 418 PERENTLIMSNPF 430
           P+R  T+I  +P+
Sbjct: 418 PDRNETIIKVHPY 430


>gi|270291664|ref|ZP_06197880.1| adenylosuccinate synthase [Streptococcus sp. M143]
 gi|270279749|gb|EFA25590.1| adenylosuccinate synthase [Streptococcus sp. M143]
          Length = 442

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 STPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|330814386|ref|YP_004358625.1| adenylosuccinate synthetase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487481|gb|AEA81886.1| adenylosuccinate synthetase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 227/430 (52%), Positives = 311/430 (72%), Gaps = 2/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL ++  VYKL LLPSG+V
Sbjct: 1   MKNVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVIDGKVYKLKLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R DK+S+IG+ VVVDP A + EIE +  QG+ V+  NL +A  ASLI+  HR++D +RE 
Sbjct: 61  RSDKISVIGNGVVVDPWALLDEIEQITKQGVIVSEKNLILAETASLIMPFHREMDEIRED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           +       IGTT+RGIGPAYED+VGRR+IRVMDL    ++S ++E +L HHNA+R+   +
Sbjct: 121 SAGKG--KIGTTRRGIGPAYEDKVGRRSIRVMDLKSESNLSNRLEIVLEHHNAIRKGLKK 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           KE     ++++L+    +IL F   +W  +++   +   ILFEGAQG LLD DHGTYP+V
Sbjct: 179 KEFKKDDLMKDLLTIAPEILKFSQPVWRKMDQFRNEAKRILFEGAQGILLDVDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++  A+ G+G  P  + YVLG+ KAYTTRVG GPFPTEL ++ G+ L + G EFG
Sbjct: 239 TSSNTVAGAAATGTGCGPNLIDYVLGITKAYTTRVGEGPFPTELNDEMGELLGKRGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V ++G+ GIALTKLDVLD   E+K+C+ Y +DG+++D+LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTVKVSGISGIALTKLDVLDACPEIKMCIEYELDGKKLDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R +PVY    GW +ST G R + +LP +A+ Y+ ++E+ +E  ++ +S  PER
Sbjct: 359 AAAEDQARIKPVYKTFPGWMKSTVGTRNYEELPQEAKIYLSELEDFIETKISSISTSPER 418

Query: 421 ENTLIMSNPF 430
           E+T+++ NPF
Sbjct: 419 EDTILVENPF 428


>gi|326795790|ref|YP_004313610.1| adenylosuccinate synthetase [Marinomonas mediterranea MMB-1]
 gi|326546554|gb|ADZ91774.1| Adenylosuccinate synthetase [Marinomonas mediterranea MMB-1]
          Length = 432

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 273/432 (63%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVV++G QWGDEGKGK+VD L+E+   +VRFQGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVILGTQWGDEGKGKVVDLLTEDVAAVVRFQGGHNAGHTLVIDGKKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                IIG+ VV+ P A   E++ L  QGI      L+++    LIL  H  LD  RE A
Sbjct: 63  DGVQCIIGNGVVLSPAALKKEVDELLEQGIP-AVERLKVSAACPLILPYHIALDQAREVA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RRAIRV DL D E    K+++ L ++N +  ++ + 
Sbjct: 122 --KGEKKIGTTGRGIGPAYEDKVARRAIRVGDLLDRERFESKLKENLDYYNFILENYHQA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + Y  +  E +   E + P +     LL    + GA+I+FEGAQG LLD DHGTYP+V
Sbjct: 180 SPISYDEVFAEGLEMAEFLRPMVADTIGLLHDLRKSGANIMFEGAQGSLLDVDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +  A  GSG  P  L YVLG+ KAYTTRVG GPFPTEL    G  L E G EFG
Sbjct: 240 TSSNTTAGGAPAGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFCDNGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVDFL 359
             T R RRCGW D  ++R +V IN V G+ LTKLDVLDG + +K+C+GY  ++G+ V   
Sbjct: 300 ATTGRSRRCGWFDAVALRHAVQINSVSGMCLTKLDVLDGFETIKVCIGYTDLEGKPVAGS 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
             DS  + + +PVY+ L GW +ST G   F  LP  A++YI+ +EE + VPV ++S GP+
Sbjct: 360 LVDSEGYEQAKPVYVELPGWTESTVGAESFDVLPKNAQDYIKYLEEQVGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T++M +PF+
Sbjct: 420 RNETIVMRDPFK 431


>gi|317049751|ref|YP_004117399.1| adenylosuccinate synthetase [Pantoea sp. At-9b]
 gi|316951368|gb|ADU70843.1| adenylosuccinate synthetase [Pantoea sp. At-9b]
          Length = 432

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 289/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G+ V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVTSIIGNGVVLSPEALMKEMKGLEDRGVPVR-ERLLLSEACPLILQYHVAMDKARETA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ ++N     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAAKLKEVVDYYNFQLVHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLNDVMAVADILTSMVVDVSELLDTARQRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++    LP  AR+YI+++EEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYESMPGWSENTFGVKTLEGLPQAARDYIKRVEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRHPFD 431


>gi|332702996|ref|ZP_08423084.1| Adenylosuccinate synthetase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332553145|gb|EGJ50189.1| Adenylosuccinate synthetase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 424

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 198/424 (46%), Positives = 276/424 (65%), Gaps = 2/424 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+N+V++G QWGDEGKGK+VD L+   D IVRFQGGNNAGHTL V D    L L+PSG++
Sbjct: 1   MSNIVIIGAQWGDEGKGKVVDLLTHEVDAIVRFQGGNNAGHTLVVKDRKLVLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K+ +IG+ VV+DP  F +E+++LA QG+ V P  L+++    +I+  H+ LD  RE 
Sbjct: 61  HSGKICLIGNGVVLDPEVFCNELDTLAKQGVDVAPYRLKVSRKTHVIMPYHKLLDSAREA 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGP YED+  R  IR  DLTD + + +KIE  L+  NAL   +G 
Sbjct: 121 A--KKDGKIGTTGRGIGPCYEDKAARTGIRAADLTDPQLLRRKIEAALVEKNALFSLYGA 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    + E++    E++  ++  + S +++    G  +LFEGAQG  LD DHGTYPFV
Sbjct: 179 QPMDADEVFEQVRPYAERVAGYLADVSSEIQQRLESGKGVLFEGAQGTHLDIDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS  ++  AS GSG SP  L  ++ +VKAYTTRVG GPFPTEL ++TG+FL+  G EFG
Sbjct: 239 TSSICVAGNASAGSGCSPRVLDRIVAIVKAYTTRVGSGPFPTELNDETGEFLQSRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGWLD+  +R S  +NG   I +TKLDVLDGL  LK+CV YR  G E  + P
Sbjct: 299 ATTGRKRRCGWLDICILRESARLNGPTDICVTKLDVLDGLKTLKLCVKYRYQGNEYAYPP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EP+Y ++ GW + T+ +R + +LP  AR Y+ ++EE+L VPV ++S+GP+R
Sbjct: 359 QAENALAEVEPIYEVMPGWDEDTSAVRAWEELPENARRYLLRMEELLGVPVTMISVGPDR 418

Query: 421 ENTL 424
           +  +
Sbjct: 419 DQII 422


>gi|213868269|gb|ACJ54181.1| adenylosuccinate synthetase [Edwardsiella tarda]
          Length = 432

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 215/432 (49%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIANGVVLAPDALLREMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++   
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLKEIMEYHNFQLVNYYHV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+E+M   + +   +  +  LL +  R G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL +  G+FL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPTELFDSVGEFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGLDE+KICVGYR+ DGREVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y +L GWK+ST G++    LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+++ +PF+
Sbjct: 420 REETIVLRDPFD 431


>gi|269137716|ref|YP_003294416.1| adenylosuccinate synthase [Edwardsiella tarda EIB202]
 gi|267983376|gb|ACY83205.1| adenylosuccinate synthase [Edwardsiella tarda EIB202]
 gi|304557772|gb|ADM40436.1| Adenylosuccinate synthetase [Edwardsiella tarda FL6-60]
          Length = 432

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 215/432 (49%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIANGVVLAPDALLREMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++   
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLKEIMEYHNFQLVNYYHV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L+E+M   + +   +  +  LL +  R G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL +  G+FL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPTELFDSVGEFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGLDE+KICVGYR+ DGREVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y +L GWK+ST G++    LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+++ +PF+
Sbjct: 420 REETIVLRHPFD 431


>gi|253752618|ref|YP_003025759.1| adenylosuccinate synthetase [Streptococcus suis SC84]
 gi|253754444|ref|YP_003027585.1| adenylosuccinate synthetase [Streptococcus suis P1/7]
 gi|253756377|ref|YP_003029517.1| adenylosuccinate synthetase [Streptococcus suis BM407]
 gi|172045632|sp|A4W440|PURA_STRS2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|251816907|emb|CAZ52556.1| adenylosuccinate synthetase [Streptococcus suis SC84]
 gi|251818841|emb|CAZ56684.1| adenylosuccinate synthetase [Streptococcus suis BM407]
 gi|251820690|emb|CAR47452.1| adenylosuccinate synthetase [Streptococcus suis P1/7]
 gi|319759033|gb|ADV70975.1| adenylosuccinate synthase [Streptococcus suis JS14]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 273/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGTKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + EI  L   G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKEINYLHDSGV--TTDNLRISDRAHVILPYHIKLDQLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGENKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRTNLAEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPIEFDEIFEEYYAYGQEIKKYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+GKE+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELHDEIGDRIREIGKEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GL  LKICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLGTLKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  + GW +   G+R   +LP  ARNY+R+I E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEEMPGWSEDITGVRSLDELPEAARNYVRRISELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|220934082|ref|YP_002512981.1| Adenylosuccinate synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254788725|sp|B8GND3|PURA_THISH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|219995392|gb|ACL71994.1| Adenylosuccinate synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 200/428 (46%), Positives = 282/428 (65%), Gaps = 4/428 (0%)

Query: 5   VVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDK 64
           VV+G QWGDEGKGK+VD L+ENA  +VRFQGG+NAGHTL ++     L L+PSG++R   
Sbjct: 6   VVLGSQWGDEGKGKVVDLLTENAAAVVRFQGGHNAGHTLVIDGKKTVLHLIPSGILREGV 65

Query: 65  MSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSP 124
             +IG+ VV+ P A + E+  L  +G+ V  + LR++ +  LIL  H  LD+ RE A   
Sbjct: 66  ECMIGNGVVLSPEALMKEMAQLEAEGVPVR-DRLRLSESCQLILPYHVSLDLAREQARGK 124

Query: 125 CGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKE-V 183
             A IGTT RGIGPAYED+V RR +R+ DL   E  + K+ ++L +HN + + + + E V
Sbjct: 125 --AAIGTTGRGIGPAYEDKVSRRGLRLGDLFHRERFAAKLGEVLDYHNFVLQHYFKSEAV 182

Query: 184 LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSS 243
            ++ +L++ +   E + P +  +   L     +GA+++FEGAQG LLD DHGTYPFVTSS
Sbjct: 183 DFQQVLDQSLALAETLQPLVMDVPERLRELRAQGANVMFEGAQGTLLDIDHGTYPFVTSS 242

Query: 244 NTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVT 303
           NT +  A  GSG+ P  L YVLG+ KAYTTRVG GPFPTEL +  G+ L   G EFG+ T
Sbjct: 243 NTTAGGACTGSGVGPLDLDYVLGITKAYTTRVGAGPFPTELFDAMGEHLARRGHEFGSTT 302

Query: 304 NRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDS 363
            R RRCGW D  ++RR+V IN + G+ +TKLDVLDGL+ L++CVGYR    E    P  +
Sbjct: 303 GRARRCGWFDAVALRRAVAINSISGLCVTKLDVLDGLETLQLCVGYRCGDAEFSVPPAGA 362

Query: 364 IYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENT 423
                 EP+Y  + GW++ST G+    DLP+ A  Y+ +I+E++ VPV ++S GP+R+ T
Sbjct: 363 DAFATCEPIYEEMPGWQESTLGVTRREDLPVNALRYLERIQEIIGVPVDMISTGPDRDQT 422

Query: 424 LIMSNPFE 431
           +++ +PFE
Sbjct: 423 IVLRHPFE 430


>gi|332522635|ref|ZP_08398887.1| adenylosuccinate synthase [Streptococcus porcinus str. Jelinkova
           176]
 gi|332313899|gb|EGJ26884.1| adenylosuccinate synthase [Streptococcus porcinus str. Jelinkova
           176]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWEEDITGVRSLEELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|251781598|ref|YP_002995899.1| adenylosuccinate synthetase [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390226|dbj|BAH80685.1| adenylosuccinate synthetase [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|323126391|gb|ADX23688.1| adenylosuccinate synthetase [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|330807236|ref|YP_004351698.1| adenylosuccinate synthetase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375344|gb|AEA66694.1| Adenylosuccinate synthetase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 430

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 205/430 (47%), Positives = 278/430 (64%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGVPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 R--GELKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   E + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYAELLKPMMLDVTAELHELRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ +N + G+ LTKLDVLDGL+ + ICVGY+     V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIDVNSISGLCLTKLDVLDGLETINICVGYKNQDGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   EPVY  + GW +ST G +   +LP+ ARNYI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYIGLEPVYEQMPGWTESTVGAKTLEELPLAARNYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|293393208|ref|ZP_06637523.1| adenylosuccinate synthase [Serratia odorifera DSM 4582]
 gi|291424354|gb|EFE97568.1| adenylosuccinate synthase [Serratia odorifera DSM 4582]
          Length = 445

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 16  KNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 75

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD+ RE A
Sbjct: 76  ENVTSIIGNGVVLAPDALMKEMGELEARGIPVR-ERLLLSEACPLILPYHVALDIAREKA 134

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 135 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAIKLKEIIDYHNFQLVNYYKV 192

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+ +M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 193 DAVDYQATLDYVMSIADILTSMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYV 252

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL + TG+FL + G EFG
Sbjct: 253 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDDTGEFLCKQGNEFG 312

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGRE+   
Sbjct: 313 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREMTTT 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++    LP  A NYI++IEE+  VPV ++S GP+
Sbjct: 373 PLAAEGWEGIEPIYETMPGWSETTFGVKEHHQLPQAALNYIKRIEELTGVPVDIISTGPD 432

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 433 RSETMVLRDPFD 444


>gi|332160027|ref|YP_004296604.1| adenylosuccinate synthetase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607415|emb|CBY28913.1| adenylosuccinate synthetase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664257|gb|ADZ40901.1| adenylosuccinate synthetase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862090|emb|CBX72256.1| adenylosuccinate synthetase [Yersinia enterocolitica W22703]
          Length = 432

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 206/432 (47%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMTDLEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L+E++   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDEVLAIADILTAMVVDVSELLDSARKRGDFMMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREV   
Sbjct: 300 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +       P+Y  + GW + T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIAPIYETMPGWSEVTFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|289829976|ref|ZP_06547427.1| adenylosuccinate synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 431

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 290/432 (67%), Gaps = 6/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPSALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++  GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDII-TGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|30249260|ref|NP_841330.1| adenylosuccinate synthetase [Nitrosomonas europaea ATCC 19718]
 gi|46396844|sp|Q82V29|PURA_NITEU RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|30180579|emb|CAD85192.1| Adenylosuccinate synthetase [Nitrosomonas europaea ATCC 19718]
          Length = 432

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 213/434 (49%), Positives = 286/434 (65%), Gaps = 7/434 (1%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M  NVVV+G QWGDEGKGKIVDWL++ A  +VRFQGG+NAGHTL V      L L+PSG+
Sbjct: 1   MARNVVVIGTQWGDEGKGKIVDWLTDRATGVVRFQGGHNAGHTLVVGGEKTVLHLIPSGI 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R +    IG+ VV+ P A + E++ L   G+ V+   LRI+    LIL  H  +D  RE
Sbjct: 61  LRENVTCYIGNGVVLSPGALLEEVDMLEQAGVDVS-GRLRISETCPLILPYHIAVDGARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RRAIR+ DL   E ++ K++++L +HN L +++ 
Sbjct: 120 LA--KGMEKIGTTGRGIGPAYEDKVARRAIRLQDLFRPERLACKLKEVLDYHNFLLKNYY 177

Query: 180 EKEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
                 Y  +L++     E+I P +  +  LL   S+   ++LFEGAQG LLD DHGTYP
Sbjct: 178 HAATVDYHQVLDDCQIKAERIRPMVADVPKLLFEASQADNNLLFEGAQGALLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKE 298
           FVTSSN ++  AS+GSG+ P  L YVLG+ KAYTTRVG GPFPTEL + TG+ L + G E
Sbjct: 238 FVTSSNCIAGAASVGSGVGPQMLNYVLGITKAYTTRVGSGPFPTELSDATGEHLAQRGNE 297

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMD--GREV 356
           FG+ T R RRCGW D  + RRS+ INGV G+ +TKLDVLDGL+ L+I VGY+    G   
Sbjct: 298 FGSTTGRPRRCGWFDAVAARRSIQINGVSGLCITKLDVLDGLETLRIGVGYKSKQSGEMY 357

Query: 357 DFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSI 416
           D LP  +      EPVY  L GW++ TAG+R F  LP  A+NY++++EEV + P++++S 
Sbjct: 358 DALPFGADDLAAAEPVYEELPGWQERTAGIRNFDQLPQAAQNYLKRMEEVCQTPISMIST 417

Query: 417 GPERENTLIMSNPF 430
           GP+R  T++  +PF
Sbjct: 418 GPDRTETIVFHHPF 431


>gi|84393181|ref|ZP_00991945.1| adenylosuccinate synthetase [Vibrio splendidus 12B01]
 gi|84376233|gb|EAP93117.1| adenylosuccinate synthetase [Vibrio splendidus 12B01]
          Length = 438

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 197/437 (45%), Positives = 275/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +D  RE A
Sbjct: 63  NNVKCVIGNGVVLSPDALLKEMKPLEERGIPVR-ERLFISEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEAFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y+ +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYEEVLEQAMSYADMLTAMVIDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      E ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLEKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + GI LTKLDVLDGL+ELKIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLSGICLTKLDVLDGLEELKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IE++  VP+ +
Sbjct: 360 SILEVSPMAAESFEEATPIYETMPGWSENTFGAKSIDALPQAALDYIKRIEDLTGVPIDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 VSTGPDRNETIIKVHPY 436


>gi|291613893|ref|YP_003524050.1| adenylosuccinate synthetase [Sideroxydans lithotrophicus ES-1]
 gi|291584005|gb|ADE11663.1| adenylosuccinate synthetase [Sideroxydans lithotrophicus ES-1]
          Length = 437

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/439 (47%), Positives = 293/439 (66%), Gaps = 11/439 (2%)

Query: 1   MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGV 59
           M+ NVVV+G QWGDEGKGK+VDWL+++A  +VRFQGG+NAGHTL +      L L+PSGV
Sbjct: 1   MSRNVVVIGTQWGDEGKGKVVDWLTDHAQGVVRFQGGHNAGHTLVIGGEKTVLHLIPSGV 60

Query: 60  VRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLRE 119
           +R + +  IG+ VVV P A + E++ L   G+    + LRI+    LIL  H  LD  RE
Sbjct: 61  LRENVVCYIGNGVVVSPAALLKEMDKLTEAGV-QVYDRLRISEACPLILPYHEALDKARE 119

Query: 120 GALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFG 179
            A       IGTT RGIGPAYED+V RRAIR+ DL   +  + K+ ++L +HN + +++ 
Sbjct: 120 IA--KGAGKIGTTGRGIGPAYEDKVARRAIRLQDLFHRKRFAAKLGEVLDYHNFVLKNYF 177

Query: 180 EKEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP 238
             E   ++  +++ +   E++ P +  +   L   ++ G ++LFEGAQG LLD DHGTYP
Sbjct: 178 HAETVDFQKTMDDALALAERLKPLVLDVPRALYEANKAGQNLLFEGAQGTLLDIDHGTYP 237

Query: 239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE------LKNQTGDFL 292
           FVTSSN +S  A  GSGI P SL YVLG+ KAYTTRVG GPFPTE       ++  G  L
Sbjct: 238 FVTSSNCISGAACAGSGIGPQSLHYVLGITKAYTTRVGSGPFPTELYDAESKQDPIGKML 297

Query: 293 KEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMD 352
            E G EFG+ T R RRCGW D A+++RS+ INGV G+ +TKLDV+D +++++I VGY++D
Sbjct: 298 AEKGHEFGSTTGRARRCGWFDAAALKRSIQINGVSGLCVTKLDVMDSMEKVRIGVGYKID 357

Query: 353 GREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVA 412
           G+  D LP  +      EPVY  + GW  ST G++ + DLP++ARNY+++I E+ EVPV 
Sbjct: 358 GQFSDILPVGAESLVGCEPVYEDMPGWSGSTVGVKRYEDLPVEARNYLQRIAEICEVPVD 417

Query: 413 LLSIGPERENTLIMSNPFE 431
           ++S GP+R+ T+++ +PF+
Sbjct: 418 MVSTGPDRDETIVLRHPFK 436


>gi|157963406|ref|YP_001503440.1| adenylosuccinate synthetase [Shewanella pealeana ATCC 700345]
 gi|189038345|sp|A8H8L8|PURA_SHEPA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|157848406|gb|ABV88905.1| Adenylosuccinate synthase [Shewanella pealeana ATCC 700345]
          Length = 431

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 281/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMTEINMLKERGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN +   + + 
Sbjct: 122 R--GNNAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFAVKLKEVMAYHNFMLTEYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEETLKDALAIADYLKSMCTDVSELLDQARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTELKN+ GD+L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELKNEIGDYLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN V G  LTKLDVLDGL+E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDIVAMKRAVQINSVSGFCLTKLDVLDGLEEVKICVGYQYPDGTVATTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW +ST G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEKVTPVLETMPGWSESTFGATSVEQLPQAALNYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|209558713|ref|YP_002285185.1| adenylosuccinate synthetase [Streptococcus pyogenes NZ131]
 gi|306828167|ref|ZP_07461430.1| adenylosuccinate synthase [Streptococcus pyogenes ATCC 10782]
 gi|238058292|sp|B5XJH8|PURA_STRPZ RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|209539914|gb|ACI60490.1| Adenylosuccinate synthetase [Streptococcus pyogenes NZ131]
 gi|304429704|gb|EFM32750.1| adenylosuccinate synthase [Streptococcus pyogenes ATCC 10782]
          Length = 430

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 273/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|160873857|ref|YP_001553173.1| adenylosuccinate synthetase [Shewanella baltica OS195]
 gi|160859379|gb|ABX47913.1| Adenylosuccinate synthase [Shewanella baltica OS195]
 gi|315266084|gb|ADT92937.1| adenylosuccinate synthetase [Shewanella baltica OS678]
          Length = 431

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGSGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQNPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +ST G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYELVTPVYETMPGWSESTFGATSIEQLPPAAINYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|125718967|ref|YP_001036100.1| adenylosuccinate synthetase [Streptococcus sanguinis SK36]
 gi|166232504|sp|A3CQU5|PURA_STRSV RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|125498884|gb|ABN45550.1| Adenylosuccinate synthetase, putative [Streptococcus sanguinis
           SK36]
          Length = 430

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLTEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGNRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWPEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|270265004|ref|ZP_06193267.1| adenylosuccinate synthetase [Serratia odorifera 4Rx13]
 gi|270040938|gb|EFA14039.1| adenylosuccinate synthetase [Serratia odorifera 4Rx13]
          Length = 432

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  DNVTSIIGNGVVLAPDALMKEMGELEARGIPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAVKLKEIIDYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L+ ++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQATLDYVLSIADILTAMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG++L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEYLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DGRE+D  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREMDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW  +T G++  + LP  A +YI++IEE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYETLPGWSDTTFGVKEHSKLPQAALDYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|192359362|ref|YP_001983527.1| adenylosuccinate synthetase [Cellvibrio japonicus Ueda107]
 gi|190685527|gb|ACE83205.1| adenylosuccinate synthetase [Cellvibrio japonicus Ueda107]
          Length = 445

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 201/432 (46%), Positives = 271/432 (62%), Gaps = 4/432 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L++   ++ RFQGG+NAGHTL ++     L L+PSG++R
Sbjct: 17  KNVVVLGTQWGDEGKGKIVDLLTDQVSLVTRFQGGHNAGHTLVIDGKKTVLHLIPSGILR 76

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VV+ P A + EI  L   G+ V    LR++    LILS H  LD  RE A
Sbjct: 77  EGVTCMIGNGVVLSPEALLKEINELEATGVPVR-QRLRLSPACPLILSYHVALDQAREAA 135

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                A IGTT RGIGPAYED+V RR +R+ DL D+   + K++++L  HN +  ++ + 
Sbjct: 136 R--GDAKIGTTGRGIGPAYEDKVARRGLRLGDLADMGRFAVKLKEILKFHNFVLANYFKA 193

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            EV Y   L +     +++LP M  +   L      G  ILFEGAQG LLD DHGTYPFV
Sbjct: 194 PEVDYDKTLADCAAWAKELLPMMADVTEQLHAARESGQSILFEGAQGSLLDIDHGTYPFV 253

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG+ KAYTTRVG GPFPTEL  + G +L E G EFG
Sbjct: 254 TSSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELDCEVGAYLGEKGHEFG 313

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D  +VR +  IN V G+ LTKLDVLDGL  +KIC+GY+        +P
Sbjct: 314 ATTGRKRRCGWFDAVAVRHANRINSVTGLCLTKLDVLDGLKTVKICIGYQDGQGNPVGIP 373

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+      +P+Y  + GW +ST G +   DLP  AR YI +++E+++ P+ ++S GP+R
Sbjct: 374 YDAEGWADVQPIYEEMPGWSESTVGAKSLDDLPANARAYIERLQELIKTPIDIISTGPDR 433

Query: 421 ENTLIMSNPFED 432
             T+++ +PF +
Sbjct: 434 VETIVLRHPFAE 445


>gi|225857829|ref|YP_002739339.1| adenylosuccinate synthetase [Streptococcus pneumoniae 70585]
 gi|225721834|gb|ACO17688.1| adenylosuccinate synthetase [Streptococcus pneumoniae 70585]
          Length = 442

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 190

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            K +++  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +D + +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDSQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 371 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 430

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 431 REQTNILESVW 441


>gi|330873780|gb|EGH07929.1| adenylosuccinate synthetase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 430

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 274/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL   G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLARRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEEMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|319946111|ref|ZP_08020359.1| adenylosuccinate synthase [Streptococcus australis ATCC 700641]
 gi|319747757|gb|EFW00003.1| adenylosuccinate synthase [Streptococcus australis ATCC 700641]
          Length = 430

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  + ++LRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--STDSLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N       +
Sbjct: 119 --SKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDVFAERLRINLEEKNRQFTKLYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E   +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 AEALSFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD++KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDKVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R+I E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRHLDELPENARNYVRRIGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|322388495|ref|ZP_08062097.1| adenylosuccinate synthase [Streptococcus infantis ATCC 700779]
 gi|321140613|gb|EFX36116.1| adenylosuccinate synthase [Streptococcus infantis ATCC 700779]
          Length = 428

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELSYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
           A       IGTT +GIGPAY D+  R  IR+ DL D E   +++E+ L   N    + + 
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFRERLERNLAEKNRQFVKLYD 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SEPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|294634459|ref|ZP_06712995.1| adenylosuccinate synthase [Edwardsiella tarda ATCC 23685]
 gi|291092169|gb|EFE24730.1| adenylosuccinate synthase [Edwardsiella tarda ATCC 23685]
          Length = 432

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 214/432 (49%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIANGVVLAPDALLREMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++   
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLKEIMEYHNFQLVNYYHV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L+E+M   + +   +  +  LL +  R G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQTVLDEVMAVADLLTSMVVDVADLLNKAHRNGDYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++ GDFL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRCVDYVLGIVKAYSTRVGAGPFPTELFDEVGDFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGLDE+KICVGYR+ DGREVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y ++ GWK+ST G++    LP  A +YI++IE+V  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVMPGWKESTFGVKSRDGLPQAALDYIKRIEDVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 420 RAETIVLRHPFD 431


>gi|238786349|ref|ZP_04630284.1| Adenylosuccinate synthetase [Yersinia bercovieri ATCC 43970]
 gi|238712748|gb|EEQ04825.1| Adenylosuccinate synthetase [Yersinia bercovieri ATCC 43970]
          Length = 436

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 67  ENVTSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + + 
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKV 183

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L++++   + +   +  +  LL+   ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 184 DAVDYQTVLDDVLAIADILTAMVVDVSELLDSARKRGDFMMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G E+G
Sbjct: 244 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +VRR+V IN + G  +TKLDVLDGL E+K+CVGYRM DGREVD  
Sbjct: 304 ATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++  + LP  A NYI ++E +  VPV ++S GP+
Sbjct: 364 PLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIARVEALTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 424 RDETMILRDPFD 435


>gi|302382387|ref|YP_003818210.1| adenylosuccinate synthetase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193015|gb|ADL00587.1| adenylosuccinate synthetase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 431

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 244/430 (56%), Positives = 304/430 (70%), Gaps = 1/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV VVG QWGDEGKGKIVDWLS  AD++VRFQGG+NAGHTL V+  VYKL+LLPSGVV
Sbjct: 1   MANVAVVGAQWGDEGKGKIVDWLSNRADMVVRFQGGHNAGHTLVVDGKVYKLALLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K SIIG+ VVVDP   + EIE +  QG+ + P+ L IA+NA LIL IH  LD+ RE 
Sbjct: 61  -QGKPSIIGNGVVVDPWHLVGEIEKIEAQGVSINPDILTIADNACLILPIHPALDVAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A +  GA IGTT RGIGPAYED+VGRRAIRV DL + + +  KI++L  HH+ LR   G 
Sbjct: 120 AANAVGARIGTTGRGIGPAYEDKVGRRAIRVCDLANADDLRVKIDRLRSHHDPLRAGLGL 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +  + +L +L+    KILP++   W +L++  + G  +LFEGAQG  LD DHGTYP+V
Sbjct: 180 DPIDPEALLAQLLEIAPKILPYVKPAWRVLDQAQKAGKRVLFEGAQGAFLDVDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSGI P  +GYVLG+VKAYTTRVG GPF  EL ++ G  L  VG+E G
Sbjct: 240 TSSNTVAGQAAAGSGIGPRGVGYVLGIVKAYTTRVGEGPFACELSDEVGVHLATVGREVG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   VR+SV ING+ GIALTKLDVLDGL  LKICVGYR+    +D+LP
Sbjct: 300 VNTGRARRCGWFDAVLVRQSVAINGIDGIALTKLDVLDGLKTLKICVGYRVGDEVLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    EPV+  LEGW ++TAG R F DL   A  Y+R+IEE++  PVALLS  PER
Sbjct: 360 SSLHAQAAAEPVFEELEGWSETTAGARSFKDLNANAIKYVRRIEELIGAPVALLSTSPER 419

Query: 421 ENTLIMSNPF 430
           ++T+++ +PF
Sbjct: 420 DDTIMIRDPF 429


>gi|152980326|ref|YP_001353807.1| adenylosuccinate synthetase [Janthinobacterium sp. Marseille]
 gi|151280403|gb|ABR88813.1| adenylosuccinate synthase [Janthinobacterium sp. Marseille]
          Length = 437

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 210/433 (48%), Positives = 283/433 (65%), Gaps = 6/433 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVVVG QWGDEGKGKIVDWL+++A  +VRFQGG+NAGHTL +      L L+PSG++R
Sbjct: 8   KNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLVIGGHKTALQLIPSGIMR 67

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                 IG+ VV+     + EI+ LA  G+ V P+ L+I+    +IL  H  LD+ RE A
Sbjct: 68  EGVACYIGNGVVLSVPDVLREIDKLAAIGVEV-PSRLKISEACPIILPYHTALDVAREVA 126

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-GE 180
                A IGTT +GIGPAYED+V RRAIR  DL + +  ++K+ + L +HN +   +   
Sbjct: 127 R--GDAKIGTTGKGIGPAYEDKVARRAIRAADLLNEKRFAEKLLENLDYHNFVLSHYLKV 184

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L++ +    ++ P +  + S L      GA+ILFEGAQG LLD DHGTYP+V
Sbjct: 185 PAVDYQKTLDDALADVPRLKPMVGDVSSALYAAHNAGANILFEGAQGSLLDVDHGTYPYV 244

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTE--LKNQTGDFLKEVGKE 298
           TSSN ++  AS GSG+ PG L Y+LG+ KAYTTRVG GPFP+E       G  L  VG E
Sbjct: 245 TSSNCVAGNASTGSGVGPGMLHYILGITKAYTTRVGSGPFPSELPTDAGVGKHLATVGHE 304

Query: 299 FGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDF 358
           FGTVT R RRCGW D A ++RSV INGV G+  TKLDVLDGL+ L+IC GY+++G+ VD 
Sbjct: 305 FGTVTGRARRCGWFDAALLKRSVQINGVTGMCFTKLDVLDGLESLRICTGYKLNGKTVDI 364

Query: 359 LPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGP 418
            P  +      EP+Y  + GWK+ST G +    LP  AR YI +IE+++ VP+ ++S GP
Sbjct: 365 FPVGAEDAAACEPIYEEMPGWKESTVGAKTLEALPANARAYIDRIEKLVGVPIDMISTGP 424

Query: 419 ERENTLIMSNPFE 431
           +RE T+++ +PF+
Sbjct: 425 DREETIVLRHPFK 437


>gi|308188264|ref|YP_003932395.1| adenylosuccinate synthetase [Pantoea vagans C9-1]
 gi|308058774|gb|ADO10946.1| adenylosuccinate synthetase [Pantoea vagans C9-1]
          Length = 432

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A+ +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERANYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +DM RE A
Sbjct: 63  DNVTSIIGNGVVLSPEALMKEMKGLEARGIPVR-ERLLISEACPLILQYHVAMDMARERA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RRA+RV DL + E  + K+++++  +N     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRALRVSDLFNKETFAAKLKEVVDFYNFQLVEYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V +  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDFDKVLSDVMEVADILTGMVVDVSELLDSARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL   G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCAQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VP+ ++S GP+
Sbjct: 360 PLAAENWEGIEPIYETLPGWSETTFGVKTLEGLPQAARDYIKRVEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|294676309|ref|YP_003576924.1| adenylosuccinate synthetase [Rhodobacter capsulatus SB 1003]
 gi|294475129|gb|ADE84517.1| adenylosuccinate synthetase [Rhodobacter capsulatus SB 1003]
          Length = 430

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 233/432 (53%), Positives = 303/432 (70%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL +   VYKL+ LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIGGKVYKLNALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   + E+ ++  QG+ + P+NL IA N  LI+  H +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVKEVAAIREQGVEINPDNLMIAENTPLIMPFHGELDRARE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGP YED+VGRR IRV DL D E +  ++++ L+HHNALR   G 
Sbjct: 120 -AHAAVAKIGTTGRGIGPCYEDKVGRRVIRVADLADDETLQLRVDRALVHHNALRAGLGL 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    +L +L     +IL +   +W +L    + G  ILFEGAQG LLD D GTYPFV
Sbjct: 179 GPIDRDAVLADLRAIAPEILQYAKPVWKVLTELRKAGKRILFEGAQGSLLDIDFGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G G+ P ++ Y LG+VKAYTTRVG GPFPTELK+  G+ L   G EFG
Sbjct: 239 TSSNVIAGQAATGVGLGPNAVDYSLGIVKAYTTRVGEGPFPTELKDDDGERLGTRGHEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++  I+G+KGIALTKLDVLDG ++LKICV Y +DG   D+LP
Sbjct: 299 TVTGRKRRCGWFDAVLVRQTCAISGMKGIALTKLDVLDGFEKLKICVAYDVDGVRYDYLP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    + +P+Y  ++GW +ST G R + DLP  A  Y+R+IEE+++ PVA+LS  PER
Sbjct: 359 TQAALQAKAKPIYEEMDGWSESTQGARSWNDLPGAAVKYVRRIEELIQCPVAMLSTSPER 418

Query: 421 ENTLIMSNPFED 432
           ++T+++++PFED
Sbjct: 419 DDTILVTDPFED 430


>gi|120600220|ref|YP_964794.1| adenylosuccinate synthetase [Shewanella sp. W3-18-1]
 gi|146291852|ref|YP_001182276.1| adenylosuccinate synthetase [Shewanella putrefaciens CN-32]
 gi|120560313|gb|ABM26240.1| Adenylosuccinate synthetase [Shewanella sp. W3-18-1]
 gi|145563542|gb|ABP74477.1| Adenylosuccinate synthetase [Shewanella putrefaciens CN-32]
          Length = 431

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQHPDGTIAKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW +ST G      LP  A NYI+++E +LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVYETMPGWSESTFGATSIDQLPQAAINYIKRLEALLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|304396950|ref|ZP_07378830.1| adenylosuccinate synthetase [Pantoea sp. aB]
 gi|304355746|gb|EFM20113.1| adenylosuccinate synthetase [Pantoea sp. aB]
          Length = 432

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A+ +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERANYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +DM RE A
Sbjct: 63  DNVTSIIGNGVVLSPEALMKEMKGLEARGIPVR-ERLLISEACPLILQYHVAMDMARERA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RRA+RV DL + E  + K+++++  +N     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRALRVSDLFNKETFAAKLKEVVDFYNFQLVEYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V +  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDFDKVLSDVMEVADILTGMVVDVSELLDVARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL   G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCAQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  L GW ++T G++    LP  AR+YI+++EEV  VP+ ++S GP+
Sbjct: 360 PLAAENWEGIEPVYETLPGWSETTFGVKTLEGLPQAARDYIKRVEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|294085875|ref|YP_003552635.1| adenylosuccinate synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665450|gb|ADE40551.1| Adenylosuccinate synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 435

 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 226/435 (51%), Positives = 299/435 (68%), Gaps = 7/435 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL ++ + YKLSLLPSG+V
Sbjct: 1   MSNVAVIGAQWGDEGKGKIVDWLSSRADVVVRFQGGHNAGHTLVIDGVEYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DP   +SEI+ L  QG  ++P +L ++ NA+LIL +H+ +D  RE 
Sbjct: 61  RPGKLSVIGNGVVIDPAHLLSEIDLLRSQGAEISPESLIVSENAALILPVHKAIDAAREA 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT RGIGPAYED++ RRA+R+ DL   E + +K+  L  HHN    + G 
Sbjct: 121 MR--GDAKIGTTGRGIGPAYEDKIARRAVRLGDLASEETLLEKLTALAAHHNVWLAAGGH 178

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V    + ++L+  R+ I+ +    W  LE+   +G  +LFEGAQG +LD DHGTYPFV
Sbjct: 179 DLVDASQMKDDLLAMRDAIMVYAGQSWRALEQARDQGQKVLFEGAQGVMLDIDHGTYPFV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ G+G  P S+G+VLG+ KAYTTRVG GPFPTE     G  + E G+EFG
Sbjct: 239 TSSNTVAGQAATGAGTGPTSIGFVLGITKAYTTRVGSGPFPTEDFGDDGTRMGERGREFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM---DGR--E 355
           TVT R+RRCGW D   VR++  + G+ G+ALTKLDVLDG D LKICVGYR+   DG   E
Sbjct: 299 TVTGRKRRCGWFDAVMVRQANAVAGITGMALTKLDVLDGFDVLKICVGYRLEQADGSVIE 358

Query: 356 VDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLS 415
           +D  P D+       P+Y  + GW +ST G R +A LP  A  YIR++EE+   PV L+S
Sbjct: 359 LDHFPADARAQAACTPIYEEMPGWHESTQGARDWASLPANAVKYIRRLEELTRTPVTLVS 418

Query: 416 IGPERENTLIMSNPF 430
             PER++T++M +PF
Sbjct: 419 TSPERDDTILMRDPF 433


>gi|15804766|ref|NP_290807.1| adenylosuccinate synthetase [Escherichia coli O157:H7 EDL933]
 gi|25293752|pir||A86114 adenylosuccinate synthetase [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12519165|gb|AAG59373.1|AE005651_2 adenylosuccinate synthetase [Escherichia coli O157:H7 str. EDL933]
          Length = 432

 Score =  494 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 207/430 (48%), Positives = 288/430 (66%), Gaps = 5/430 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NV V+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   NNVXVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 419

Query: 420 RENTLIMSNP 429
           R  T+I+ +P
Sbjct: 420 RTETMILRDP 429


>gi|227326194|ref|ZP_03830218.1| adenylosuccinate synthetase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/432 (47%), Positives = 285/432 (65%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLKEIVEYHNFQLVNYYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVLAIADILTAMVVDVSDLLYKAHLRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL    G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFEDVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYR+ +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEIKICVGYRLPNGSEVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGLEPIYETMPGWSESTFGVKDHSKLPQAALNYIKRIEEITGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 420 RSETMVLRDPFD 431


>gi|319425086|gb|ADV53160.1| adenylosuccinate synthetase [Shewanella putrefaciens 200]
          Length = 431

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  NNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQHPDGTIAKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW +ST G      LP  A NYI+++E +LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVYETMPGWSESTFGATSIDQLPQAAINYIKRLEALLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|65317448|ref|ZP_00390407.1| COG0104: Adenylosuccinate synthase [Bacillus anthracis str. A2012]
 gi|118480495|ref|YP_897646.1| adenylosuccinate synthetase [Bacillus thuringiensis str. Al Hakam]
 gi|118419720|gb|ABK88139.1| Adenylosuccinate synthetase [Bacillus thuringiensis str. Al Hakam]
          Length = 459

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 188/432 (43%), Positives = 272/432 (62%), Gaps = 5/432 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSE+A+V+ R+QGGNNAGHT+    + YKL L+PSG+ 
Sbjct: 31  MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFGGVKYKLHLIPSGIF 90

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ +IG+ +VVDP A + E++ L  +G+  + +NLR++N A +IL  H   D L E 
Sbjct: 91  YKEKICVIGNGLVVDPKALLEELKYLHDRGV--STDNLRVSNRAHVILPYHLKQDELEE- 147

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT++GIGPAY D+  R  IR+ DL D E   +K+EQ L   N L     +
Sbjct: 148 -ASKGDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLEQNLAQKNRLFEKMYD 206

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E      I EE     ++I  ++     +L         +LFEGAQG +LD DHGTYPF
Sbjct: 207 TEGFSVDEIFEEYFEYGQQIAQYVCDTSVVLNDALDNNHRVLFEGAQGVMLDIDHGTYPF 266

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   ++G+G+ P  +  V+GV KAYT+RVG GPFPTEL ++ G  ++EVG+E+
Sbjct: 267 VTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREY 326

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G+  LKICV Y+ DG+ +D +
Sbjct: 327 GTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAYKCDGKVIDEV 386

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW +   G+R   +LP  AR Y+ ++ E+  + +++ S+GP+
Sbjct: 387 PANLNILAKCEPVYEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPD 446

Query: 420 RENTLIMSNPFE 431
           R  T I+ N +E
Sbjct: 447 RNQTNIVRNVYE 458


>gi|127514219|ref|YP_001095416.1| adenylosuccinate synthetase [Shewanella loihica PV-4]
 gi|166232497|sp|A3QI59|PURA_SHELP RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|126639514|gb|ABO25157.1| Adenylosuccinate synthetase [Shewanella loihica PV-4]
          Length = 431

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 205/431 (47%), Positives = 281/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKERGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFGE 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +    +G 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMAYHNFMLTEYYGC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+T L++ +   + +      +  LL++  + G +ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYETTLKDALAIADYLKSMCTDVTELLDQARKNGDNILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YV G++KAYTTRVG GPFPTEL+++ GD L   G+EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVCGIIKAYTTRVGAGPFPTELRDEIGDHLGTKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN + G  LTKLDVLDGL E+K+CVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDIVAMKRAVQINSISGFCLTKLDVLDGLKEVKLCVGYQYPDGSISTVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW +ST G      LP  A +YI++IEE+LE PV ++S GP+
Sbjct: 360 PLAAEGYEQVTPVLETMPGWSESTFGATSIDQLPQAALDYIKRIEELLETPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|83648036|ref|YP_436471.1| adenylosuccinate synthetase [Hahella chejuensis KCTC 2396]
 gi|123531246|sp|Q2SBC8|PURA_HAHCH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|83636079|gb|ABC32046.1| adenylosuccinate synthetase [Hahella chejuensis KCTC 2396]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 201/431 (46%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVV++G QWGDEGKGKIVD L+E    + RFQGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVILGTQWGDEGKGKIVDLLTEEVAAVARFQGGHNAGHTLVIDGQKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A +SEI++L  +G+ V    L ++    LIL  H+ LD+ RE  
Sbjct: 63  SNVACLIGNGVVLAPDALLSEIKTLEDKGVPVR-QRLFLSPACPLILPYHKALDLAREER 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
           L    A IGTT RGIGPAYED+V RR +R+ DL   E  ++K+++++ + N +   + + 
Sbjct: 122 L--GSAKIGTTGRGIGPAYEDKVARRGVRLGDLAKPERFAEKLKEIMQYQNFVLEHYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + Y+  L+E +   E++LP M  +  +L    ++  ++LFEGAQG LLD D GTYP+V
Sbjct: 180 APIDYQKTLDETLKMAEELLPMMADVTDMLHEFRKRDENVLFEGAQGSLLDIDLGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG+ KAY TRVG GPFPTEL +  G +L + G EFG
Sbjct: 240 TSSNTTAGGTATGSGFGPMYLDYVLGITKAYATRVGSGPFPTELFDDVGAYLAKKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RRCGW D  ++R ++ IN V GI LTKLDVLDGLD +K+CVGYR  DG E+   
Sbjct: 300 ATTGRPRRCGWFDAVALRHAIQINSVSGICLTKLDVLDGLDVVKVCVGYRTADGAEITRP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D       EPVY  L GWK+ST G++   DLP  A++YI  +E+ +E P+ ++S GP+
Sbjct: 360 PIDCEAFGEVEPVYEELPGWKESTFGVKRVEDLPKNAQDYIAFLEKQIEAPIDVISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+ + +PF
Sbjct: 420 RNETITLRHPF 430


>gi|271502148|ref|YP_003335174.1| adenylosuccinate synthetase [Dickeya dadantii Ech586]
 gi|270345703|gb|ACZ78468.1| adenylosuccinate synthetase [Dickeya dadantii Ech586]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 210/432 (48%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+ +L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVISIIGNGVVLAPDALLKEMTALEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN     + + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDQESFAIKLKEIMEYHNFQLVHYYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L++++   + +   +  +  LL +  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DPVDYQKTLDDVLAVADILTGMVVDVSDLLFKAHQRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL +  G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFDDVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYRM DG  VD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLSEVKICVGYRMPDGSNVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW +ST G++  + LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAADGWEGIEPIYESLPGWSESTFGVKERSKLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|253690077|ref|YP_003019267.1| adenylosuccinate synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259547066|sp|C6DFJ2|PURA_PECCP RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|251756655|gb|ACT14731.1| adenylosuccinate synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLKEIVEYHNFQLVNYYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVLAIADILTAMVVDVSDLLYKAHLRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL  + G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFEEVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYR+ +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEIKICVGYRLPNGTEVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEEV  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGLEPIYETMPGWSESTFGVKDHSKLPQAALNYIKRIEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 420 RSETMVLRDPFD 431


>gi|331005103|ref|ZP_08328506.1| Adenylosuccinate synthetase [gamma proteobacterium IMCC1989]
 gi|330421072|gb|EGG95335.1| Adenylosuccinate synthetase [gamma proteobacterium IMCC1989]
          Length = 431

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 271/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L++   ++ RFQGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTDQVSLVARFQGGHNAGHTLVIDGKKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VV+ P A + E+  L   G+ V    LR++    LIL  H  LD  RE  
Sbjct: 63  DGVQCMIGNGVVLAPDALLKEMAGLEASGVPVR-ERLRLSPACPLILPYHVALDQAREIK 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +R+ D+ + E  ++K+++++ +HN AL   +G 
Sbjct: 122 R--GNDKIGTTGRGIGPAYEDKVARRGLRLGDIFNPESFAEKLKEVMEYHNFALVNYYGV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y T+L E +   E++ P +  I + L      G  ILFEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDTVLAESLVWAEELKPMVLDITNKLHAARESGESILFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+ KAYTTRVG GPFPTEL  + G+ L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGMGPMYIDYVLGITKAYTTRVGSGPFPTELSCEVGNHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D  +V+ ++ IN + G+ LTKLDVLDGL+ + IC GY+    E   +P
Sbjct: 300 ATTGRERRCGWFDAVAVKHAIRINSISGLCLTKLDVLDGLESINICTGYKNAEGESISVP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            DS    +  PVY  + GW +ST G +   +LP  A  YI+++EE++  P  ++S GP+R
Sbjct: 360 FDSAGWDKIVPVYETMPGWSESTFGAQTMEELPANAIAYIKRLEELVGAPADIVSTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 VETIVLRHPF 429


>gi|227115175|ref|ZP_03828831.1| adenylosuccinate synthetase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/432 (47%), Positives = 285/432 (65%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLKEIVEYHNFQLVNYYKA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVLAIADILTGMVVDVSDLLYKAHLRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL    G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFEDVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYR+ +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEIKICVGYRLPNGTEVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGLEPIYETMPGWSESTFGVKDHSKLPQAALNYIKRIEEITGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 420 RSETMVLRDPFD 431


>gi|58039889|ref|YP_191853.1| adenylosuccinate synthetase [Gluconobacter oxydans 621H]
 gi|81819072|sp|Q5FQZ9|PURA_GLUOX RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|58002303|gb|AAW61197.1| Adenylosuccinate synthetase [Gluconobacter oxydans 621H]
          Length = 429

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 248/432 (57%), Positives = 313/432 (72%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWL+  AD++VRFQGG+NAGHTL V D +YKLSLLPSG+V
Sbjct: 1   MSNVTVIGTQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGDQIYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+ +IG+ VVVDP A ++EI+ +  QG+ VTP  L IA NA LIL +H  LD  RE 
Sbjct: 61  R-GKIGVIGNGVVVDPKALMTEIDRVTAQGLVVTPETLWIAENAPLILPVHGALDRAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+V RRAIR+ DL + E +  K+++LLLHHN L    G 
Sbjct: 120 ARGDH--KIGTTGRGIGPAYEDKVARRAIRICDLAEPETLDWKLDELLLHHNTLLAGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +    + + + L     ++LPF   +W  L+   R G  ILFEGAQ  +LD DHGTYPFV
Sbjct: 178 ETFTKEQLKDFLAEITPRLLPFSCQVWDRLDEARRAGRRILFEGAQAVMLDVDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+SP S+G+VLG+ KAYTTRVG GPFPTEL +QTG  L E G EFG
Sbjct: 238 TSSNTVAAVAASGSGVSPSSVGFVLGIAKAYTTRVGEGPFPTELHDQTGRTLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   +RR+V + GV GIALTKLDVLDGLDE+ ICVGY +DG++++  P
Sbjct: 298 TVTGRPRRCGWFDAVLIRRAVRVGGVSGIALTKLDVLDGLDEISICVGYELDGQKIETFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 TR +PVY  + GWK++TAG R +A+LP QA  Y+R+IEE++E PV LLS  PER
Sbjct: 358 SAPGAQTRVKPVYETMPGWKETTAGARSWAELPAQAIKYVRRIEELIEAPVTLLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 418 DDTILMRDPFED 429


>gi|330960084|gb|EGH60344.1| adenylosuccinate synthetase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 430

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|322410973|gb|EFY01881.1| adenylosuccinate synthetase [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 430

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKVSVIGNGVVVNPKSLVKELAYLHEEGV--TTHNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFAERLSINLAEKNRLFEKMYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
             V  +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 SAVLDFDDIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDDLPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|322376102|ref|ZP_08050612.1| adenylosuccinate synthase [Streptococcus sp. C300]
 gi|321279052|gb|EFX56095.1| adenylosuccinate synthase [Streptococcus sp. C300]
          Length = 444

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 275/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 17  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 76

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  + +  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 77  FPEKISVIGNGMVVNPKSLVKELTYLHEEDV--TTDNLRISDRAHVILPYHIELDRLQEE 134

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 135 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 192

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 193 STPISVDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 252

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 253 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGNRIREVGHEY 312

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 313 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 372

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 373 PASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPG 432

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 433 REQTNILESVW 443


>gi|312112894|ref|YP_004010490.1| adenylosuccinate synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218023|gb|ADP69391.1| adenylosuccinate synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 429

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 252/432 (58%), Positives = 321/432 (74%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE AD++VRFQGG+NAGHTL ++D  YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVIDDKTYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDP A   EI  +A  G+ VT +NLRIA NA+LIL +HR+LD LRE 
Sbjct: 61  R-GKLSVIGNGVVVDPWALEREIAEVAKLGVKVTRDNLRIAENATLILPLHRELDALREN 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRRAI  +DL D++ +  KI++ L+HHNALRR  G+
Sbjct: 120 AAGEGA--IGTTKRGIGPAYEDKVGRRAIHAVDLLDLKTLPAKIDRALVHHNALRRGLGQ 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    +L EL      I P+++ +W LL+R  R+G  ILFEGAQG LLD DHGTYP+V
Sbjct: 178 PEIDRDALLAELSAIAPMIAPYVEPVWQLLDRYKREGKRILFEGAQGSLLDVDHGTYPYV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ P S+ YVLG+ KAYTTRVG GPFPTEL  + G  L E G EFG
Sbjct: 238 TSSNTVAASAATGSGLGPSSINYVLGITKAYTTRVGQGPFPTELTCEAGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VR+++ ++G+ GIALTKLDVLDG DE+K+ VGYR+   E+D LP
Sbjct: 298 TVTGRARRCGWFDATLVRQTIKVSGMNGIALTKLDVLDGFDEIKVAVGYRLGHHEIDRLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                    +P+Y ++ GW++ST G R +ADLP QA  Y++++EE++E PVALLS  PER
Sbjct: 358 ASQEAQASVQPIYEVMPGWQESTQGARSWADLPAQAIKYVKRLEELIEAPVALLSTSPER 417

Query: 421 ENTLIMSNPFED 432
            +T+++ +PF+D
Sbjct: 418 ADTILVHDPFQD 429


>gi|159045282|ref|YP_001534076.1| adenylosuccinate synthetase [Dinoroseobacter shibae DFL 12]
 gi|189038301|sp|A8LIN4|PURA_DINSH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|157913042|gb|ABV94475.1| adenylosuccinate synthetase [Dinoroseobacter shibae DFL 12]
          Length = 431

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 242/432 (56%), Positives = 308/432 (71%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADVI RFQGG+NAGHTL ++  VYKL  LPSGVV
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGTVYKLHALPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV+DP   ++EIE++  QG+ +TP  L IA N  LIL IH +LD  RE 
Sbjct: 61  RGGKLSVIGNGVVLDPWHLVAEIETVRAQGVEITPETLMIAENTPLILPIHGELDRAREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRR++RV DL D   +  ++++ L HH+ LRR  G 
Sbjct: 121 AASK-GTKIGTTGRGIGPAYEDKVGRRSVRVADLADDATLEARVDRALQHHDPLRRGLGI 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    ++ +L      IL +   +W +L  + + G  ILFEGAQG LLD D GTYPFV
Sbjct: 180 EAVDRDGLIAQLKEIAPAILTYAAPVWKVLNEKRKAGHRILFEGAQGALLDIDFGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++ QA+ G GI PG++ YVLG+VKAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNVIAGQAATGVGIGPGAIDYVLGIVKAYTTRVGEGPFPTELDDADGQRLGERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D A VR++   +GV GIALTKLDVLDG + LKICVGY +DG+ +D+LP
Sbjct: 300 TTTGRKRRCGWFDAALVRQTCATSGVNGIALTKLDVLDGFETLKICVGYDLDGKVLDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R  P+Y  ++GW +ST G R +ADLP  A  Y+R+IEE+++ PVALLS  PER
Sbjct: 360 TAADQQGRCAPIYEEMDGWSESTEGARSWADLPGNAVKYVRRIEELIQCPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++++PF D
Sbjct: 420 DDTILVTDPFAD 431


>gi|37528396|ref|NP_931741.1| adenylosuccinate synthetase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|46396770|sp|Q7MAX9|PURA2_PHOLL RecName: Full=Adenylosuccinate synthetase 2; Short=AMPSase 2;
           Short=AdSS 2; AltName: Full=IMP--aspartate ligase 2
 gi|36787834|emb|CAE16949.1| adenylosuccinate synthetase (IMP--aspartate ligase) (ADSS)
           (AMPSASE) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 289/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+ +L  +GI V    L I+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIANGVVLAPDALMKEMNALESRGIPVR-ERLLISEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEAFAVKLKEIIEYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+E+M   + +   +  +  LL + ++KG  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDYQKTLDEIMAVADILTDMVVDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG +L+E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPCYVDYVLGIIKAYSTRVGAGPFPTELFDETGGYLREKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ ++RR+V IN + G  +TKLDVLDGL E+KIC GYRM DG  ++  
Sbjct: 300 ATTGRSRRTGWLDIIAIRRAVQINSLSGFCMTKLDVLDGLKEVKICTGYRMPDGSVIETT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  + GW +ST G++    LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 360 PLAADDWEGIEPVYETMPGWNESTFGVKEHRKLPQAALNYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETIILRDPFD 431


>gi|300715045|ref|YP_003739848.1| adenylosuccinate synthetase (IMP-aspartate ligase) [Erwinia
           billingiae Eb661]
 gi|299060881|emb|CAX57988.1| Adenylosuccinate synthetase (IMP-aspartate ligase) [Erwinia
           billingiae Eb661]
          Length = 432

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +G  V    L I+    LIL  H  LD+ RE A
Sbjct: 63  ENVTSIIGNGVVLSPAALMKEMKGLEDRGFPVR-ERLFISEACPLILEYHVALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL + E  + K++ ++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAAKLKDVMEYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y  +L + +   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYDKVLSDTLAIADILTGMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DGREV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGREVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW ++T G++    LP  A +YI+++EEV  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYESMPGWSETTFGVKTLDGLPQAALDYIKRVEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|167625586|ref|YP_001675880.1| adenylosuccinate synthetase [Shewanella halifaxensis HAW-EB4]
 gi|189038346|sp|B0TUV4|PURA_SHEHH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|167355608|gb|ABZ78221.1| Adenylosuccinate synthase [Shewanella halifaxensis HAW-EB4]
          Length = 431

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/431 (48%), Positives = 281/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMTEINMLKERGVPV-EERLLISEACPLILPFHCALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN +   + + 
Sbjct: 122 R--GNNAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFATKLKEVMAYHNFMLTEYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEETLKDALAIADYLKSMCTDVSELLDQARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTELKN+ GD+L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELKNEIGDYLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN V G  LTKLDVLDGL+E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDVVAMKRAVQINSVSGFCLTKLDVLDGLEEVKICVGYQYPDGTVATTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW ++T G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEKVTPVLETMPGWSETTFGATSVEQLPQAALNYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|296284460|ref|ZP_06862458.1| adenylosuccinate synthetase [Citromicrobium bathyomarinum JL354]
          Length = 429

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 241/432 (55%), Positives = 312/432 (72%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWL+  AD +VRFQGG+NAGHTL V+   YK+SL+PSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLASRADAVVRFQGGHNAGHTLVVDGTTYKISLVPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
               +S+IG+ VV+DP A  SEIE L  QG+ +T +N  +A+N  LIL +HRDLD LRE 
Sbjct: 61  T-GTLSLIGNGVVLDPWALKSEIEKLEGQGVKITADNFAVADNCPLILPLHRDLDGLRET 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+VGRRAIRV DL  ++ I  ++++L  HH+ALR  F E
Sbjct: 120 AA--GQGKIGTTGRGIGPAYEDKVGRRAIRVCDLAHLDEIEPQLDRLCAHHDALRAGFDE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +  + ++ EL      +L F   +W  L++  + GA ILFEGAQG LLD DHGTYPFV
Sbjct: 178 PPIDREQLISELREIAPFVLQFAQPVWKRLKKVRKAGARILFEGAQGVLLDVDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+S  A+ GSG+ P + G+VLG+ KAYTTRVG GPFPTEL+++ G  L E G EFG
Sbjct: 238 TSSNTVSGTAASGSGLGPNATGFVLGITKAYTTRVGSGPFPTELEDEIGQGLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
            VT R+RR GW D   VR++  I+GV GIALTK+DVLDG+D++KIC GYR+DG+  D+LP
Sbjct: 298 VVTGRKRRVGWFDAVLVRQTCAISGVTGIALTKIDVLDGMDKVKICTGYRIDGKIYDYLP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +    R EP+Y  +EGW++STAG R +ADLP  A  YI +I+E++E PVAL+S  PER
Sbjct: 358 SHAASQARCEPIYEEMEGWQESTAGARSWADLPANAIKYISRIQELIECPVALVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PFED
Sbjct: 418 EDTILVRDPFED 429


>gi|66043844|ref|YP_233685.1| adenylosuccinate synthetase [Pseudomonas syringae pv. syringae
           B728a]
 gi|302189784|ref|ZP_07266457.1| adenylosuccinate synthetase [Pseudomonas syringae pv. syringae 642]
 gi|81308572|sp|Q4ZYX5|PURA_PSEU2 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|63254551|gb|AAY35647.1| Adenylosuccinate synthetase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330951479|gb|EGH51739.1| adenylosuccinate synthetase [Pseudomonas syringae Cit 7]
 gi|330971560|gb|EGH71626.1| adenylosuccinate synthetase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 430

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIVKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + ICVGY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICVGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|238918374|ref|YP_002931888.1| adenylosuccinate synthetase [Edwardsiella ictaluri 93-146]
 gi|257051087|sp|O31047|PURA_EDWI9 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|238867942|gb|ACR67653.1| adenylosuccinate synthetase, putative [Edwardsiella ictaluri
           93-146]
          Length = 432

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 215/432 (49%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIANGVVLAPDALLREMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    ++   
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKASFAVKLKEIMEYHNFQLVNYYHV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+++L+E+M   + +   +  +  LL +  R G +++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQSVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL +  G+FL E G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRCVDYVLGIVKAYSTRVGAGPFPTELFDSVGEFLCEKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGLDE+KICVGYR+ DGREVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y +L GWK+ST G+++   LP  A NYI++IEEV  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVLPGWKESTFGVKLRDGLPQAALNYIKRIEEVTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+++ +PF+
Sbjct: 420 REETIVLRHPFD 431


>gi|330978944|gb|EGH78003.1| adenylosuccinate synthetase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 430

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 273/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTPGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
               R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATPGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEEMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|78355223|ref|YP_386672.1| adenylosuccinate synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|90101584|sp|Q317B9|PURA_DESDG RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|78217628|gb|ABB36977.1| Adenylosuccinate synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 427

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/428 (48%), Positives = 279/428 (65%), Gaps = 2/428 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NVV++G QWGDEGKGKIVD LS   DVIVRFQGGNNAGHT+ V D  Y L L+PSG++
Sbjct: 1   MSNVVIMGAQWGDEGKGKIVDLLSREIDVIVRFQGGNNAGHTVIVGDKSYILHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
              K  +IG+ VV+DP  F  E+E+LA +GI V P  L I+  A +I+  H+ LD+ RE 
Sbjct: 61  HEGKTCLIGNGVVLDPVVFWKEVEALAERGIDVGPQRLMISRKAHVIMPYHKALDVARED 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
             +   + IGTT RGIGP YED++ R  +R  DL D   +  KIE  L+  NAL  + +G
Sbjct: 121 FKNK-ESRIGTTGRGIGPCYEDKMSRIGVRAGDLADPALLRSKIEAALVEKNALFTALYG 179

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + +    + +E+M    +++P++  + S++E      + ++FEGAQG  LD DHGTYPF
Sbjct: 180 REAMSVDAVFDEVMAVGGRLVPYLTDVSSVIEDAWANDSGVMFEGAQGTHLDIDHGTYPF 239

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT++  A+ GSGI    L  V+ +VKAYTTRVG GPFPTEL ++ G+ ++ VG EF
Sbjct: 240 VTSSNTVAGNAAAGSGIPASRLDRVVAIVKAYTTRVGAGPFPTELDDEAGNHMQSVGHEF 299

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R+RRCGWLD A +R SV +NG   IALTKLDV+ GL ELKICV Y  +G+ +   
Sbjct: 300 GATTGRKRRCGWLDCALLRESVRLNGPTDIALTKLDVMSGLKELKICVAYEYNGQRLQHP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +        PVY  + GW       + + DLP  ARNYI +IEE+L VPV+++S+GPE
Sbjct: 360 PQEQNGLAHVTPVYETMPGWDDDITAAKTWEDLPEAARNYICRIEELLGVPVSMISVGPE 419

Query: 420 RENTLIMS 427
           R+ TL   
Sbjct: 420 RDQTLNRK 427


>gi|325697329|gb|EGD39215.1| adenylosuccinate synthase [Streptococcus sanguinis SK160]
          Length = 430

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G  +T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEG--MTTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDNIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELSGWSEDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|139473012|ref|YP_001127727.1| adenylosuccinate synthetase [Streptococcus pyogenes str. Manfredo]
 gi|166232503|sp|A2RCA2|PURA_STRPG RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|134271258|emb|CAM29474.1| adenylosuccinate synthetase [Streptococcus pyogenes str. Manfredo]
          Length = 430

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 188/431 (43%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPQKISVIGNGVVVNPKSLVKELAYLHDEGV--TTDNLRISDRAHVILPYHIQLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +D + +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDRKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW++   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|315222392|ref|ZP_07864297.1| adenylosuccinate synthetase [Streptococcus anginosus F0211]
 gi|315188553|gb|EFU22263.1| adenylosuccinate synthetase [Streptococcus anginosus F0211]
          Length = 430

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 277/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + ++E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVNELAYLHGEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDHKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAIQFDDIFEEYYAYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGNRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLTGLDIVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRSLEELPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPF 430
           RE T I+ + +
Sbjct: 417 REQTNILESVW 427


>gi|300721494|ref|YP_003710769.1| adenylosuccinate synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|297627986|emb|CBJ88535.1| adenylosuccinate synthetase [Xenorhabdus nematophila ATCC 19061]
          Length = 432

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+  L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIANGVVLAPDALMKEMRELESRGVPV-HERLLISEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAAKLKEIIEYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L++++   + +   +  +  LL + ++KG  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDYQQTLDDILAVADILTGMVVDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG++L+E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEYLREKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R RR GWLD+ ++RR++ IN + G  +TKLDVLDGL E+KICVGYR  DG  +D  
Sbjct: 300 ATTGRSRRTGWLDIVAIRRAIQINSLSGFCMTKLDVLDGLKEVKICVGYRQADGSVIDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      E VY  L GW +ST G +  + LP  A +YI+++EE+  VPV ++S GP+
Sbjct: 360 PLAAENWEGIEAVYETLPGWDESTFGAKEHSQLPQAALDYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RAETMILRDPFD 431


>gi|149186561|ref|ZP_01864873.1| adenylosuccinate synthetase [Erythrobacter sp. SD-21]
 gi|148829788|gb|EDL48227.1| adenylosuccinate synthetase [Erythrobacter sp. SD-21]
          Length = 429

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 245/432 (56%), Positives = 311/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWL+  AD +VRFQGG+NAGHTL ++   YKLSLLPSG+V
Sbjct: 1   MANVTVIGAQWGDEGKGKIVDWLASRADAVVRFQGGHNAGHTLVIDGTTYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
               +SIIG+ VV+DP A  +E+E L  QG+ +  +NL +A+N  LIL IHRDLD LRE 
Sbjct: 61  -SGTLSIIGNGVVLDPWALKAEVEKLEGQGVTINADNLAVADNCPLILPIHRDLDGLRET 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+VGRRAIRV DL  ++ +  ++++L  HH+ALR  F +
Sbjct: 120 AA--GSGKIGTTGRGIGPAYEDKVGRRAIRVCDLAHLDALEPQLDRLCAHHDALRAGFDQ 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V  + +LEEL    + +L +   +W  L++  + GA ILFEGAQG LLD DHGTYPFV
Sbjct: 178 PPVDREALLEELRGIADFVLQYAQPVWKRLKKVRKAGAKILFEGAQGVLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+S  A+ GSG+ P + GYVLG+VKAYTTRVG GPFPTEL+++ G  L E G EFG
Sbjct: 238 TSSNTVSGTAASGSGLGPNATGYVLGIVKAYTTRVGSGPFPTELEDEIGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT RQRR GW D   VR+S  I+GV GIALTK+DVLDGLDE+KIC GYR+     D+ P
Sbjct: 298 TVTGRQRRVGWFDAVIVRQSCAISGVTGIALTKIDVLDGLDEVKICTGYRLRNNVYDYFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +      EP+Y  +EGWK+STAG R FADLP  A  Y+++I+E++E PVAL+S  PER
Sbjct: 358 SHAADQAAVEPIYETMEGWKESTAGARSFADLPANAVKYVQRIQELIETPVALVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           ++T++M +PF D
Sbjct: 418 DDTILMRDPFMD 429


>gi|296114955|ref|ZP_06833601.1| adenylosuccinate synthetase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978513|gb|EFG85245.1| adenylosuccinate synthetase [Gluconacetobacter hansenii ATCC 23769]
          Length = 429

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 243/432 (56%), Positives = 307/432 (71%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+NV V+G QWGDEGKGKIVDWL+  AD++VRFQGG+NAGHTL V D  YKLSLLPSG+V
Sbjct: 1   MSNVTVIGTQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGDQTYKLSLLPSGLV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K  +IG+ VVVDP A + EI+ +  QG+ VTP+ L+IA NA LIL +H  LD  RE 
Sbjct: 61  R-GKTGVIGNGVVVDPEALLKEIDRVTAQGLKVTPDTLKIAENAPLILPVHGALDRAREA 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+V RRAIR+ DL + E +  K+++LLLHHN L R  G 
Sbjct: 120 AR--GERKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDELLLHHNTLLRGLGA 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
                + ++  L     ++LPFM  +W LL+   R G+ ILFEGAQ  +LD DHGTYP+V
Sbjct: 178 ATFTKEELMAFLTGIAPRVLPFMAPVWDLLDDSRRAGSRILFEGAQAVMLDVDHGTYPYV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A  GSG+SP S+G+VLG+ KAYTTRVG GPFP+EL ++ G  L + G EFG
Sbjct: 238 TSSNTVAANAGTGSGVSPTSIGFVLGIAKAYTTRVGEGPFPSELHDEMGRTLGQRGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R RRCGW D   VRR+V + GV G+ALTKLDVLDGL E+ ICVGY +DG +    P
Sbjct: 298 TVTGRPRRCGWFDAVLVRRAVRVGGVNGLALTKLDVLDGLKEISICVGYELDGVKTTHFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                 +R  PV+  +EGW+ +T G R +ADLP QA  Y+R+IEE++E PV LLS  PER
Sbjct: 358 SAPGAQSRIRPVFETMEGWEGTTHGARSWADLPAQAIKYVRRIEELVEAPVTLLSTSPER 417

Query: 421 ENTLIMSNPFED 432
           ++T++M +PFED
Sbjct: 418 DDTILMRDPFED 429


>gi|329117027|ref|ZP_08245744.1| adenylosuccinate synthase [Streptococcus parauberis NCFD 2020]
 gi|326907432|gb|EGE54346.1| adenylosuccinate synthase [Streptococcus parauberis NCFD 2020]
          Length = 430

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 271/433 (62%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKFSVIGNGVVVNPKSLVKELAYLHEEGV--TTDNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  + ++   L   N L     +
Sbjct: 119 --SKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFADRLMANLAEKNRLFEKMYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
                +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STALDFDEIFEEYYAYGQEIKKYVTDTSVILNDALDGGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++E+G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGNRIREIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R  P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEKLKRCTPIYEELPGWSEDITGVRSLEDLPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWAN 429


>gi|296875654|ref|ZP_06899723.1| adenylosuccinate synthase [Streptococcus parasanguinis ATCC 15912]
 gi|296433338|gb|EFH19116.1| adenylosuccinate synthase [Streptococcus parasanguinis ATCC 15912]
          Length = 430

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 188/431 (43%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + + E+  L  +G+  + ++LRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVKELAYLHEEGV--STDSLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D +  ++++   L   N       +
Sbjct: 119 --SKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDVFAERLRINLEEKNRQFTKLYD 176

Query: 181 KEV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E   +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 AEALSFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++EVG E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG  +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   +LP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGVRHLDELPENARNYVRRVGELVGVRISTFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 417 RDQTNILESVW 427


>gi|296446631|ref|ZP_06888572.1| adenylosuccinate synthetase [Methylosinus trichosporium OB3b]
 gi|296255859|gb|EFH02945.1| adenylosuccinate synthetase [Methylosinus trichosporium OB3b]
          Length = 431

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 259/432 (59%), Positives = 319/432 (73%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS  ADV+VRFQGG+NAGHTL +N   YKL+LLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSLEADVVVRFQGGHNAGHTLVINGKTYKLALLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VVVDPH  + EIE L  QG+ + P+N +IA NA LILS+HR+LD  RE 
Sbjct: 61  RPGKLSVIGNGVVVDPHFLVGEIERLREQGVAIGPDNFKIAENAPLILSLHRELDAHREE 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGPAYED+VGRR+IRVMDL + + +  KI +LL HHN LRR  G 
Sbjct: 121 AAGNGV-KIGTTKRGIGPAYEDKVGRRSIRVMDLAEPDTLDDKITRLLAHHNPLRRGLGL 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    + EEL+    KILPFMD +W LL  E R G  ILFEGAQG LLD DHGTYP+V
Sbjct: 180 PEIEAAALREELLSVAPKILPFMDAVWELLAEERRAGKRILFEGAQGVLLDVDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ PG++GYVLG+ KAYTTRVGGGPFPTEL +  G+ + + G EFG
Sbjct: 240 TSSNTVAAAAASGSGLGPGAIGYVLGIAKAYTTRVGGGPFPTELTDAIGELIGDRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D    R+ V  +G+ GIALTKLD+LDGL+E+K+C  Y +DG  +D LP
Sbjct: 300 TNTGRRRRCGWFDAVLTRQVVKTSGINGIALTKLDILDGLEEIKVCTHYLLDGVRIDRLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  PVY  +EGWK +T G R +ADLP QA  Y+R+IEE++  PVALLS  PER
Sbjct: 360 ASQAAQARVVPVYETIEGWKGTTGGARSWADLPAQAIKYVRRIEELIGAPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++ NPFED
Sbjct: 420 DDTILVQNPFED 431


>gi|330984555|gb|EGH82658.1| adenylosuccinate synthetase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 430

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADLLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + ICVGY  +   V   P
Sbjct: 300 ATTGRARRCGWFDSVILRRAIEINSISGLCLTKLDVLDGLETINICVGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|325686684|gb|EGD28710.1| adenylosuccinate synthase [Streptococcus sanguinis SK72]
          Length = 430

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 189/433 (43%), Positives = 278/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + + E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 61  FPEKISVIGNGMVVNPKSLVKELNYLHEEGV--TTDNLRISDRAHVILPYHIELDRLQEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D +   +++E+ L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLTEKNRLFEKLYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STAISFDDIFEEYYEYGQQIKQYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G+ ++++G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGNRIRDIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRINHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSKDITGVRSLEDLPENARNYVRRVSELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|71735890|ref|YP_272872.1| adenylosuccinate synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257482404|ref|ZP_05636445.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623761|ref|ZP_06456715.1| adenylosuccinate synthetase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648622|ref|ZP_06479965.1| adenylosuccinate synthetase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298484910|ref|ZP_07003009.1| Adenylosuccinate synthetase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|110826518|sp|Q48NZ7|PURA_PSE14 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|71556443|gb|AAZ35654.1| adenylosuccinate synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298160597|gb|EFI01619.1| Adenylosuccinate synthetase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330865899|gb|EGH00608.1| adenylosuccinate synthetase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330886605|gb|EGH20266.1| adenylosuccinate synthetase [Pseudomonas syringae pv. mori str.
           301020]
 gi|331009769|gb|EGH89825.1| adenylosuccinate synthetase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 430

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADLLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + ICVGY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICVGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +    PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|77456756|ref|YP_346261.1| adenylosuccinate synthetase [Pseudomonas fluorescens Pf0-1]
 gi|92081599|sp|Q3KIY4|PURA_PSEPF RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|77380759|gb|ABA72272.1| adenylosuccinate synthetase [Pseudomonas fluorescens Pf0-1]
          Length = 429

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 274/430 (63%), Gaps = 5/430 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREITKLEEKGVPVR-ERLRISPSCPLILSFHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL ++     K+ +L+ +HN +   + ++
Sbjct: 122 R--GELKIGTTGRGIGPAYEDKVARRGLRVGDLLNMPRFEDKLRELVDYHNFMLVGYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L E     E + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIEFEKTLAECKEYAELLKPLMLDVTAELHDLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++ G  L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGVGPMFLDYILGITKAYTTRVGSGPFPTELFDEVGAHLAKQGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + IC GY+ D +     P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICTGYK-DAQGNAVAP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   +PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 359 TDADSYVGLQPVYEEVPGWSESTVGAKTLEELPANARAYIKRVEELIGAPIDIISTGPDR 418

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 419 NETIVLRHPF 428


>gi|254284116|ref|ZP_04959084.1| adenylosuccinate synthetase [gamma proteobacterium NOR51-B]
 gi|219680319|gb|EED36668.1| adenylosuccinate synthetase [gamma proteobacterium NOR51-B]
          Length = 430

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 272/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E AD +VRFQGG+NAGHTL ++     L ++PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQADAVVRFQGGHNAGHTLVIDGEKTVLHVIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                 IG+ VV+ P A + EI  L  +G+ V    L+I+    LIL  H  LD  RE  
Sbjct: 63  EGVSCFIGNGVVLSPEALLKEIAELEARGVPVR-ERLKISAACPLILPYHVALDKAREVR 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +R+ D+ D+      + ++L +HN AL   +G 
Sbjct: 122 R--GAQKIGTTGRGIGPAYEDKVARRGLRLGDMRDLSRFESILREVLDYHNHALVHYYGA 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +  + +L + +   E++LP M  + SLL    + G  +LFEGAQG LLD DHGTYP+V
Sbjct: 180 PALDAEQVLAQSISEAEQLLPMMADVTSLLHDYRKNGGRLLFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG+ KAYTTRVG GPFPTEL +  G  L E G EFG
Sbjct: 240 TSSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFDAIGQRLAERGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D  ++R +V IN V G+ LTKLDVLDGL+E+ ICVGY+ +       P
Sbjct: 300 ATTGRARRCGWFDAVALRTAVNINSVSGLCLTKLDVLDGLEEISICVGYQGEDGNAVQNP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  + R  P+Y  + GW +ST G++  A LP  AR YI ++E ++  P+ ++S GP+R
Sbjct: 360 VDASDYERLTPIYESVAGWSESTYGLKELAQLPANARAYIERLETLVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
           E T+++ +PF
Sbjct: 420 EETIVLRHPF 429


>gi|308048243|ref|YP_003911809.1| adenylosuccinate synthetase [Ferrimonas balearica DSM 9799]
 gi|307630433|gb|ADN74735.1| Adenylosuccinate synthetase [Ferrimonas balearica DSM 9799]
          Length = 431

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/431 (48%), Positives = 281/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDQAHYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E+  L  +G+ V    L I+    LIL  H  +D  RE A
Sbjct: 63  SNVKCLIGNGVVLSPEALLKELTMLKERGVPV-EERLMISEACPLILPYHVAVDQAREAA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RRA+RV DL D E  + K++ +L +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVARRALRVGDLLDAERFATKLKDVLAYHNFMLTEYHKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y T+L++ +   E + P +  +   L++  + G +I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYDTVLKDALELAEILRPMIVDVTDTLDKARKAGEYIMFEGAQGTLLDVDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   S GSG  P  + YVLG+VKAYTTRVGGGPFPTEL  + G+ L   G EFG
Sbjct: 240 TSSNTTAGGVSTGSGFGPNHIDYVLGIVKAYTTRVGGGPFPTELDCEVGEHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GW D  ++RR+V ING+ G  LTKLDVLDGL+ELKIC GY+M DG   D  
Sbjct: 300 ATTGRKRRTGWFDAVAMRRAVQINGITGFCLTKLDVLDGLNELKICTGYQMPDGTVRDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P D+  +    PVY  + GW  +T G+     LP +A +YI +IE++LEVPV ++S GP+
Sbjct: 360 PMDAEGYEVAVPVYESMPGWDANTFGVTERDQLPKEALDYIARIEQLLEVPVDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ +PF
Sbjct: 420 RNETMILRHPF 430


>gi|291619085|ref|YP_003521827.1| PurA [Pantoea ananatis LMG 20103]
 gi|291154115|gb|ADD78699.1| PurA [Pantoea ananatis LMG 20103]
 gi|327395417|dbj|BAK12839.1| adenylosuccinate synthetase PurA [Pantoea ananatis AJ13355]
          Length = 432

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 212/431 (49%), Positives = 288/431 (66%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A+ +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERANYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L I+    LIL  H  +DM RE A
Sbjct: 63  DNVTSIIGNGVVLSPEALMKEMKGLEERGIPVR-ERLLISEACPLILQYHVAMDMAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RRA+RV DL + E  + K+++++  +N     + ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRALRVSDLFNKETFAAKLKEVIDLYNFQLVHYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y  +L ++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYDKVLSDVMAVADILTSMVVDVSELLDVARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRFVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICV YRM DG EV   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVAYRMPDGSEVTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW ++T G++    LP  AR+YI+++EEV  VP+ ++S GP+
Sbjct: 360 PLAAENWEGIEPIYETLPGWSETTFGVKTLEGLPQAARDYIKRVEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ +PF
Sbjct: 420 RSETMILRDPF 430


>gi|126175844|ref|YP_001051993.1| adenylosuccinate synthetase [Shewanella baltica OS155]
 gi|304411192|ref|ZP_07392807.1| adenylosuccinate synthetase [Shewanella baltica OS183]
 gi|307306487|ref|ZP_07586230.1| adenylosuccinate synthetase [Shewanella baltica BA175]
 gi|125999049|gb|ABN63124.1| Adenylosuccinate synthetase [Shewanella baltica OS155]
 gi|304350385|gb|EFM14788.1| adenylosuccinate synthetase [Shewanella baltica OS183]
 gi|306910778|gb|EFN41206.1| adenylosuccinate synthetase [Shewanella baltica BA175]
          Length = 431

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQNPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +ST G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYELVTPVYETMPGWSESTFGATSIEQLPPAAINYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|238750076|ref|ZP_04611579.1| Adenylosuccinate synthetase [Yersinia rohdei ATCC 43380]
 gi|238711620|gb|EEQ03835.1| Adenylosuccinate synthetase [Yersinia rohdei ATCC 43380]
          Length = 432

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 212/432 (49%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN  L   + E
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+T+L+ ++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQTVLDGVLAVADILTAMVVDVSELLDNARKQGEFIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD  +VRR+V IN + G  +TKLDVLDGL E+KICVGYRM DGREVD  
Sbjct: 300 ATTGRSRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLKEVKICVGYRMPDGREVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y ++ GW   T G++  + LP  A NYI+++EE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEVMPGWSDVTFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           RE T+I+ +PF+
Sbjct: 420 REETMILRDPFD 431


>gi|114330970|ref|YP_747192.1| adenylosuccinate synthetase [Nitrosomonas eutropha C91]
 gi|122314121|sp|Q0AHF5|PURA_NITEC RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|114307984|gb|ABI59227.1| Adenylosuccinate synthetase [Nitrosomonas eutropha C91]
          Length = 432

 Score =  492 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 216/431 (50%), Positives = 289/431 (67%), Gaps = 6/431 (1%)

Query: 3   NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRP 62
           NVVV+G QWGDEGKGKIVDWL++ A  ++RFQGG+NAGHTL VN     L L+PSG++R 
Sbjct: 4   NVVVIGTQWGDEGKGKIVDWLTDRAAGVIRFQGGHNAGHTLVVNGEKTVLHLIPSGILRK 63

Query: 63  DKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGAL 122
           D +  IG+ VV+ P A + E+  L   G+ V+   LRI+    LIL  H  +D  RE A 
Sbjct: 64  DVICYIGNGVVLSPGALLDEMSMLEQAGVDVS-GRLRISEACPLILPYHIAVDGARELA- 121

Query: 123 SPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKE 182
                 IGTT RGIGPAYED++ RRAIR+ DL   E  + K++++L +HN L +++    
Sbjct: 122 -KGPEKIGTTGRGIGPAYEDKIARRAIRLQDLFYPERFASKLKEVLDYHNFLLKNYYHTA 180

Query: 183 V-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
              Y  IL+E +   E+I P +  +  LL   ++ G ++LFEGAQG LLD DHGTYPFVT
Sbjct: 181 TVDYDQILDECLKKAERIQPMVADVPKLLFEANKAGNNLLFEGAQGALLDIDHGTYPFVT 240

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSN ++  AS+GSG+ P  LGYVLG+ KAYTTRVG GPFPTEL + TG++L + G EFG+
Sbjct: 241 SSNCIAGAASVGSGVGPQLLGYVLGITKAYTTRVGSGPFPTELADTTGEYLAQRGNEFGS 300

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMD--GREVDFL 359
            T R RRCGW D  + RRS+ INGV G+ +TKLDVLDGL++LKIC GY+     R  D L
Sbjct: 301 TTGRPRRCGWFDAVATRRSIQINGVSGLCITKLDVLDGLEKLKICTGYKSKQSDRLYDAL 360

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  L GW+  TAG++ F  LP  A+NY+++IEEV + P++++S GP+
Sbjct: 361 PFGADDLADIEPVYEELPGWQACTAGIKDFDQLPKTAQNYLKRIEEVCQTPISMISTGPD 420

Query: 420 RENTLIMSNPF 430
           R  T++  +PF
Sbjct: 421 RIETIVFHHPF 431


>gi|212709957|ref|ZP_03318085.1| hypothetical protein PROVALCAL_01008 [Providencia alcalifaciens DSM
           30120]
 gi|212687366|gb|EEB46894.1| hypothetical protein PROVALCAL_01008 [Providencia alcalifaciens DSM
           30120]
          Length = 433

 Score =  492 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/432 (47%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL VN     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVVNGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E++ L  +G+ V    LRI+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIANGVVLAPDALMKEMKELEDRGVPVR-ERLRISEACPLILPYHIALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    + K+++++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAVKLKEIIDYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+ +M   + +   +  +  LL +  +K   ++FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDYQQTLDYIMSVADLLTSMVIDVSDLLYKAHQKNELVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL+E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVNYVLGIIKAYSTRVGAGPFPTELFDETGEFLREKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVDFL 359
             T R+RR GWLD+ ++ R+V IN + G  LTKLDVLDGL E+KICVGY R DG  ++  
Sbjct: 300 ATTGRKRRTGWLDIVAINRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRRKDGTVLETT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  + GW ++T G++  A LP  A +YI++IEE+  +PV ++S GP+
Sbjct: 360 PLAADEWEGLEPVYETMPGWSETTFGVKERALLPQAALDYIKRIEELTGIPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|226315502|ref|YP_002775398.1| adenylosuccinate synthetase [Brevibacillus brevis NBRC 100599]
 gi|254784036|sp|C0ZA40|PURA_BREBN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|226098452|dbj|BAH46894.1| adenylosuccinate synthetase [Brevibacillus brevis NBRC 100599]
          Length = 428

 Score =  492 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 272/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+ VVVVG QWGDEGKGKI D+L+E+A+V+ R+QGGNNAGHT+  +   YKL L+PSG+ 
Sbjct: 1   MSTVVVVGTQWGDEGKGKITDYLAESAEVVARYQGGNNAGHTIIFDGNKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK  +IG+ +V+DP A + E+E +   G   + +NL+I++ A +IL  H  LD + E 
Sbjct: 61  YSDKTCVIGNGMVIDPKALVKELEYIHSFG--FSTSNLKISDRAHVILPYHIKLDGVEED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           +       IGTT++GIGPAY D+  R  IR+ DL D +  ++K+E+ L   N L      
Sbjct: 119 SR--GANKIGTTRKGIGPAYMDKAARIGIRIADLLDRDEFARKLERNLAEKNMLLEKLYN 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
                 K IL+E +   E I P++     +L      G  +LFEGAQG LLD D GTYP+
Sbjct: 177 TTGFELKEILDEYLALAEIIRPYVTDTSVVLNDSIDSGNRVLFEGAQGVLLDIDQGTYPY 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYTTRVG GPF TEL + TGD ++EVG E+
Sbjct: 237 VTSSNPIAGGVTIGSGVGPTKIHQVIGVAKAYTTRVGDGPFLTELNDATGDHIREVGFEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+ G+A+TKLD L G++ L+IC  Y+ +G  ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGITGLAITKLDTLSGIETLRICTAYKYNGEIIESF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW +   G+R   DLP  AR+YI +I ++  +P+++ S+GP+
Sbjct: 357 PANLNLLAKCEPVYEELPGWTEDITGIRNLNDLPENARHYIERITQLTGIPMSIFSVGPD 416

Query: 420 RENTLIMSNPF 430
           RE T+++   +
Sbjct: 417 REQTVVVRGIY 427


>gi|322831161|ref|YP_004211188.1| adenylosuccinate synthetase [Rahnella sp. Y9602]
 gi|321166362|gb|ADW72061.1| adenylosuccinate synthetase [Rahnella sp. Y9602]
          Length = 432

 Score =  492 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 214/432 (49%), Positives = 294/432 (68%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LDM RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMGELEARGIPVR-ERLLLSEACPLILPYHVALDMAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GDKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIIEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V ++  L+++M   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDFQKTLDDVMAIADILTAMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL++ G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLRKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RRCGWLD+ +VRRSV IN + G  LTKLDVLDGL E+K+CVGYRM DGRE+   
Sbjct: 300 ATTGRSRRCGWLDIVAVRRSVQINSLSGFCLTKLDVLDGLKEVKLCVGYRMPDGREMTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y I+ GW ++T G++   +LP  A NYI++IEE+ EVPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYEIMPGWTETTFGVKEVENLPQAALNYIKRIEELTEVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|152999244|ref|YP_001364925.1| adenylosuccinate synthetase [Shewanella baltica OS185]
 gi|151363862|gb|ABS06862.1| Adenylosuccinate synthase [Shewanella baltica OS185]
          Length = 431

 Score =  492 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + +  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAQLFTEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQNPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +ST G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYELVTPVYETMPGWSESTFGATSIEQLPPAAINYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|312958657|ref|ZP_07773177.1| adenylosuccinate synthetase [Pseudomonas fluorescens WH6]
 gi|311287200|gb|EFQ65761.1| adenylosuccinate synthetase [Pseudomonas fluorescens WH6]
          Length = 429

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 272/430 (63%), Gaps = 5/430 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREITKLEEKGVPVR-ERLRISPSCPLILSFHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL ++     K+ +L+ +HN +   + ++
Sbjct: 122 R--GELKIGTTGRGIGPAYEDKVARRGLRVGDLLNMPRFEDKLRELVDYHNFMLVGYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + +   L E     E + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIEFDKTLAECKEYAELLKPLMLDVTAELHDLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL +  G  L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGVGPMFLDYILGITKAYTTRVGSGPFPTELFDDVGAHLAKQGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ +N + GI LTKLDVLDGL+ + IC GY+ D +     P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLEAINICTGYK-DAQGNAVAP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   +PVY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 359 TDADSYVGLQPVYEEVPGWTESTVGAKTLEELPANARAYIKRVEELIGAPIDIISTGPDR 418

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 419 NETIVLRHPF 428


>gi|308275013|emb|CBX31612.1| Adenylosuccinate synthetase [uncultured Desulfobacterium sp.]
          Length = 431

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 192/432 (44%), Positives = 294/432 (68%), Gaps = 4/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M N+V++G QWGDEGKGK+VD L+E AD++VRFQGGNNAGHT+ VN   +   ++PSG++
Sbjct: 1   MANIVIIGTQWGDEGKGKVVDLLAEYADLVVRFQGGNNAGHTMVVNGKQFISHIVPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ IIG+ VV+DP   + EIESL  +G+ ++P NL I+ NA +I+  H+++D+  E 
Sbjct: 61  -QNKICIIGNGVVIDPKVLLEEIESLKSKGVSISPENLMISENAHIIMPYHKNIDLASES 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
             +     IGTT RGIGP YED+  R+ IR +D  D E   +K+  +L   N +  +   
Sbjct: 120 --TKGENKIGTTGRGIGPCYEDKASRKGIRFVDFIDPEVFKEKVCSVLPEKNFILEKYLS 177

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +K +   +I++E  +  +++ PF   +  ++    + G  ILFEGAQG  LD DHGTYPF
Sbjct: 178 DKALDADSIIKEYSFYAKQLAPFTKNVSVIIFNALKSGKQILFEGAQGTHLDIDHGTYPF 237

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT+S  A+ GSGI P ++  V+G+VKAYTTRVG GPFPTEL ++TGD++++ G EF
Sbjct: 238 VTSSNTVSGNAACGSGIGPKAITGVIGIVKAYTTRVGAGPFPTELFDETGDYMQKKGAEF 297

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R+RRCGWLD+  +R +  +N + G+A+TKLDVL G+  LKIC GY  +G+ ++ +
Sbjct: 298 GATTGRKRRCGWLDMVILRNAARLNSLTGLAITKLDVLGGIKTLKICTGYEYNGKIIEDM 357

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P      +  +PVY  + GW +  +G+R++ +LP   + Y+++IEE++E P+ ++S+GP 
Sbjct: 358 PASIKLLSACKPVYEEMPGWDEDISGIRIYENLPETTKQYLKRIEELIETPINIVSVGPG 417

Query: 420 RENTLIMSNPFE 431
           R+ T++++NP +
Sbjct: 418 RDETIVINNPLK 429


>gi|30265485|ref|NP_847862.1| adenylosuccinate synthetase [Bacillus anthracis str. Ames]
 gi|47531053|ref|YP_022402.1| adenylosuccinate synthetase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49188304|ref|YP_031557.1| adenylosuccinate synthetase [Bacillus anthracis str. Sterne]
 gi|49481206|ref|YP_039457.1| adenylosuccinate synthetase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|196036101|ref|ZP_03103501.1| adenylosuccinate synthetase [Bacillus cereus W]
 gi|196041961|ref|ZP_03109248.1| adenylosuccinate synthase [Bacillus cereus NVH0597-99]
 gi|196045487|ref|ZP_03112718.1| adenylosuccinate synthetase [Bacillus cereus 03BB108]
 gi|218906659|ref|YP_002454493.1| adenylosuccinate synthetase [Bacillus cereus AH820]
 gi|225867448|ref|YP_002752826.1| adenylosuccinate synthetase [Bacillus cereus 03BB102]
 gi|227818236|ref|YP_002818245.1| adenylosuccinate synthetase [Bacillus anthracis str. CDC 684]
 gi|228918079|ref|ZP_04081607.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228930473|ref|ZP_04093473.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228949189|ref|ZP_04111457.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229094578|ref|ZP_04225645.1| Adenylosuccinate synthetase [Bacillus cereus Rock3-42]
 gi|229124970|ref|ZP_04254144.1| Adenylosuccinate synthetase [Bacillus cereus 95/8201]
 gi|229187696|ref|ZP_04314832.1| Adenylosuccinate synthetase [Bacillus cereus BGSC 6E1]
 gi|229601179|ref|YP_002869676.1| adenylosuccinate synthase [Bacillus anthracis str. A0248]
 gi|254687092|ref|ZP_05150950.1| adenylosuccinate synthetase [Bacillus anthracis str. CNEVA-9066]
 gi|254724125|ref|ZP_05185910.1| adenylosuccinate synthetase [Bacillus anthracis str. A1055]
 gi|254735142|ref|ZP_05192852.1| adenylosuccinate synthetase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254742149|ref|ZP_05199836.1| adenylosuccinate synthetase [Bacillus anthracis str. Kruger B]
 gi|254755941|ref|ZP_05207973.1| adenylosuccinate synthetase [Bacillus anthracis str. Vollum]
 gi|300118832|ref|ZP_07056552.1| adenylosuccinate synthetase [Bacillus cereus SJ1]
 gi|301056941|ref|YP_003795152.1| adenylosuccinate synthetase [Bacillus anthracis CI]
 gi|33301483|sp|Q81JI9|PURA_BACAN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|81828115|sp|Q6HAG9|PURA_BACHK RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|171473042|sp|A0RLP6|PURA_BACAH RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|30260163|gb|AAP29348.1| adenylosuccinate synthase [Bacillus anthracis str. Ames]
 gi|47506201|gb|AAT34877.1| adenylosuccinate synthetase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49182231|gb|AAT57607.1| adenylosuccinate synthetase [Bacillus anthracis str. Sterne]
 gi|49332762|gb|AAT63408.1| adenylosuccinate synthase (IMP--aspartate ligase) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|195991268|gb|EDX55236.1| adenylosuccinate synthetase [Bacillus cereus W]
 gi|196023694|gb|EDX62370.1| adenylosuccinate synthetase [Bacillus cereus 03BB108]
 gi|196027216|gb|EDX65836.1| adenylosuccinate synthase [Bacillus cereus NVH0597-99]
 gi|218539605|gb|ACK92003.1| adenylosuccinate synthetase [Bacillus cereus AH820]
 gi|225787802|gb|ACO28019.1| adenylosuccinate synthase [Bacillus cereus 03BB102]
 gi|227006088|gb|ACP15831.1| adenylosuccinate synthase [Bacillus anthracis str. CDC 684]
 gi|228595764|gb|EEK53448.1| Adenylosuccinate synthetase [Bacillus cereus BGSC 6E1]
 gi|228658471|gb|EEL14137.1| Adenylosuccinate synthetase [Bacillus cereus 95/8201]
 gi|228688825|gb|EEL42656.1| Adenylosuccinate synthetase [Bacillus cereus Rock3-42]
 gi|228810472|gb|EEM56825.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228829192|gb|EEM74829.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228841559|gb|EEM86675.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229265587|gb|ACQ47224.1| adenylosuccinate synthase [Bacillus anthracis str. A0248]
 gi|298723800|gb|EFI64522.1| adenylosuccinate synthetase [Bacillus cereus SJ1]
 gi|300379110|gb|ADK08014.1| adenylosuccinate synthetase [Bacillus cereus biovar anthracis str.
           CI]
          Length = 429

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 188/432 (43%), Positives = 272/432 (62%), Gaps = 5/432 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSE+A+V+ R+QGGNNAGHT+    + YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFGGVKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ +IG+ +VVDP A + E++ L  +G+  + +NLR++N A +IL  H   D L E 
Sbjct: 61  YKEKICVIGNGLVVDPKALLEELKYLHDRGV--STDNLRVSNRAHVILPYHLKQDELEE- 117

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT++GIGPAY D+  R  IR+ DL D E   +K+EQ L   N L     +
Sbjct: 118 -ASKGDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLEQNLAQKNRLFEKMYD 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E      I EE     ++I  ++     +L         +LFEGAQG +LD DHGTYPF
Sbjct: 177 TEGFSVDEIFEEYFEYGQQIAQYVCDTSVVLNDALDNNHRVLFEGAQGVMLDIDHGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   ++G+G+ P  +  V+GV KAYT+RVG GPFPTEL ++ G  ++EVG+E+
Sbjct: 237 VTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G+  LKICV Y+ DG+ +D +
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAYKCDGKVIDEV 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW +   G+R   +LP  AR Y+ ++ E+  + +++ S+GP+
Sbjct: 357 PANLNILAKCEPVYEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPD 416

Query: 420 RENTLIMSNPFE 431
           R  T I+ N +E
Sbjct: 417 RNQTNIVRNVYE 428


>gi|261345211|ref|ZP_05972855.1| adenylosuccinate synthase [Providencia rustigianii DSM 4541]
 gi|282566904|gb|EFB72439.1| adenylosuccinate synthase [Providencia rustigianii DSM 4541]
          Length = 433

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 205/432 (47%), Positives = 290/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL VN     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVVNGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E++ L  +G+ V    LRI+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIANGVVLAPDALMKEMKELEDRGVPVR-ERLRISEACPLILPYHIALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEIIEYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+ +M   + +   +  +  LL +  +K   ++FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDYQKTLDYVMSVADLLTSMVIDVSDLLYKAHQKNELVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++ G+FL+E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVNYVLGIIKAYSTRVGAGPFPTELFDEIGEFLREKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVDFL 359
             T R+RR GWLD+ ++ R+V IN + G  LTKLDVLDGL+E+KICVGY R DG+ ++  
Sbjct: 300 ATTGRKRRTGWLDIVAINRAVQINSLSGFCLTKLDVLDGLEEVKICVGYRRPDGKVLETT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  + GW ++T G++  A LP  A +YI++IEE+  +PV ++S GP+
Sbjct: 360 PLAADEWVGLEPVYESMPGWSETTFGVKERALLPQAALDYIQRIEELTGIPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|163749295|ref|ZP_02156544.1| adenylosuccinate synthetase [Shewanella benthica KT99]
 gi|161331014|gb|EDQ01940.1| adenylosuccinate synthetase [Shewanella benthica KT99]
          Length = 431

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A I+EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLSPEALITEINMLKERGVPV-EERLLISEACPLILPFHCALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K++ ++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFAEKLKDVMSYHNFMLTQYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEKTLKDALAIADYLKSMCTDVTELLDQARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTELK + GD+L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELKCEIGDYLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDIVAMKRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQYPDGTVATVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW ++T G      LP  A NYI+++E++LE P+ ++S GP+
Sbjct: 360 PLAAEGYEKVTPVLETMPGWSETTFGATSLEQLPQAALNYIKRLEDLLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|20809040|ref|NP_624211.1| adenylosuccinate synthetase [Thermoanaerobacter tengcongensis MB4]
 gi|24212120|sp|Q8R6T8|PURA_THETN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|20517712|gb|AAM25815.1| Adenylosuccinate synthase [Thermoanaerobacter tengcongensis MB4]
          Length = 428

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 292/429 (68%), Gaps = 3/429 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  V+VG QWGDEGKGKI D+L+E ++V+VR+QGGNNAGHT++ + + YKL L+PSG++
Sbjct: 1   MSVTVIVGAQWGDEGKGKITDYLAERSEVVVRYQGGNNAGHTVEKDGVQYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            PDK+ +IG+ VVVDP A + EIE L  +G+ V  +NL+I++ A ++   H   D L E 
Sbjct: 61  YPDKICVIGNGVVVDPSALLKEIEDLKAKGVEVKEDNLKISDRAHVVFPYHIKEDELEE- 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRS-FG 179
                   +GTT++GIGP Y D+  R  IR+ DL + E   +K+++ L   N + +  +G
Sbjct: 120 -KGKGDEDLGTTKKGIGPCYRDKTERIGIRMCDLMNAEVFREKLKKNLERKNKIFKDIYG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           E    ++ I E      E++ P++     LL   +++G  ILFEGAQG LLD D GTYP+
Sbjct: 179 EDGFDFEQIFETYREYAERLRPYVTDTSVLLYNLAKEGKKILFEGAQGTLLDLDFGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VT+S+ ++  A+IG+GI P  +  V+GVVKAYTTRVG GPFPTELK++ GDFL+E G E+
Sbjct: 239 VTASHPVAGGATIGAGIGPTMIDNVIGVVKAYTTRVGKGPFPTELKDEIGDFLREKGYEY 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGW+D+  +R +V ++G+  +ALTKLD L GL+++KIC GY+++G+ ++  
Sbjct: 299 GTTTGRPRRCGWIDIVMLRYAVRVSGITSLALTKLDTLTGLEKIKICTGYKINGKIIEDF 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EP+Y  +EGW ++   +R F DLP+ A+ Y++++EE++ V  +++S+GPE
Sbjct: 359 PASLEELKMCEPIYEEMEGWSENIQDVRSFEDLPLNAKKYVKRLEELVGVEFSIISVGPE 418

Query: 420 RENTLIMSN 428
           RE T+++ N
Sbjct: 419 REETIVLRN 427


>gi|212633583|ref|YP_002310108.1| adenylosuccinate synthetase [Shewanella piezotolerans WP3]
 gi|226724593|sp|B8CIP5|PURA_SHEPW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|212555067|gb|ACJ27521.1| Adenylosuccinate synthetase [Shewanella piezotolerans WP3]
          Length = 431

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 282/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++EI  L  +G+ V    L I+    LIL  H  LDM RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMTEINMLKERGVPV-EERLLISEACPLILPFHCALDMAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKVSRRGLRVGDLFNAELFAEKLKEVMAYHNFMLTEYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEETLKDALAIADYLKSMCTDVSELLDQARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL+N+ GD+L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELENEIGDYLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN V G  LTKLDVLDGL+E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDIVAMKRAVQINSVSGFCLTKLDVLDGLEEVKICVGYQYPDGTVATTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW ++T G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVLETMPGWSETTFGATSVEQLPQAAMNYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|83591130|ref|YP_431139.1| adenylosuccinate synthetase [Moorella thermoacetica ATCC 39073]
 gi|123523836|sp|Q2RG43|PURA_MOOTA RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|83574044|gb|ABC20596.1| Adenylosuccinate synthetase [Moorella thermoacetica ATCC 39073]
          Length = 427

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/431 (47%), Positives = 270/431 (62%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M  VV+VG QWGDEGKGKI D+L+E ADV++R+QGG+NAGHT+ V    +KL L+PSG++
Sbjct: 1   MAAVVLVGAQWGDEGKGKITDYLAERADVVIRYQGGSNAGHTVMVGHEEFKLHLVPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P K+ IIG+ VV+DP   + E++ LA +G+    + L+I+N A LIL  H+ LD   E 
Sbjct: 61  YPGKLCIIGNGVVLDPAVLVEELDGLAARGVD--TSGLKISNRAHLILPYHKGLDAAEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                 A IGTT+RGIGPAY D+  R  IRV DL D E  S K+   L   N L     +
Sbjct: 119 HR--GAAMIGTTKRGIGPAYVDKAARTGIRVGDLLDWEEFSAKVAHNLAATNELLAKIYD 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
           +     + ILEE      ++ P +     L+ R  ++G  +LFEGAQG LLD D GTYPF
Sbjct: 177 RPGYDLQAILEEYAGYARRLRPLIADSVRLVNRALQEGRKVLFEGAQGTLLDLDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSS  ++  A IG+G+ P  +  V+GVVKAYTTRVG GPFPTE+    GD L++ G EF
Sbjct: 237 VTSSYPVAGGACIGAGVGPTRIDKVIGVVKAYTTRVGSGPFPTEITGPAGDALRQQGMEF 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RRCGWLD   +R +  +NG+ GIALTKLDVL GLD L+IC  YR  G   +  
Sbjct: 297 GTTTGRPRRCGWLDTVILRHAAEVNGLTGIALTKLDVLTGLDPLRICTSYRYRGTVGEDF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EPVY  L GW +   G R   DLP   R YIR++EE+  VPV L+++GP 
Sbjct: 357 PASLKALEECEPVYEELPGWHEDITGARSLDDLPANCRRYIRRLEELTGVPVHLIAVGPR 416

Query: 420 RENTLIMSNPF 430
           R+ T+++ +PF
Sbjct: 417 RDQTIVLESPF 427


>gi|103486003|ref|YP_615564.1| adenylosuccinate synthetase [Sphingopyxis alaskensis RB2256]
 gi|122985231|sp|Q1GVU1|PURA_SPHAL RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|98976080|gb|ABF52231.1| Adenylosuccinate synthetase [Sphingopyxis alaskensis RB2256]
          Length = 429

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 240/432 (55%), Positives = 313/432 (72%), Gaps = 3/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NV V+G QWGDEGKGKIVDWL+  AD +VRFQGG+NAGHTL V + VYKLSLLPSG+V
Sbjct: 1   MANVTVIGSQWGDEGKGKIVDWLASRADAVVRFQGGHNAGHTLVVGEQVYKLSLLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
               +SIIG+ VV+DP A   EI  L  QG+ +  +N  IA+N +LIL  HRDLD LRE 
Sbjct: 61  T-GTLSIIGNGVVLDPWALRDEITKLRGQGVEINADNFAIADNCALILPFHRDLDALRET 119

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT RGIGPAYED+VGRRAIRV DL  ++H+  ++++L  HH+ALR  FGE
Sbjct: 120 AA--GAGKIGTTGRGIGPAYEDKVGRRAIRVCDLAHLDHLEPQLDRLTAHHDALRAGFGE 177

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             +    ++ +L    + +L +   +W  L++  + GA ILFEGAQG LLD DHGTYPFV
Sbjct: 178 PPIDRDKLVADLREIADYVLEYAQPVWKRLKKVRKAGARILFEGAQGVLLDIDHGTYPFV 237

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+S  A+ GSG+ PG++G+VLG+ KAYTTRVG GPFPTEL+++TG  L E G EFG
Sbjct: 238 TSSNTVSGTAASGSGLGPGAVGFVLGIAKAYTTRVGSGPFPTELEDETGQRLGERGHEFG 297

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR+S  ++GV GIALTKLDVLDG D ++IC GYR+ G+ +D+ P
Sbjct: 298 TVTGRKRRCGWFDAVLVRQSCAVSGVTGIALTKLDVLDGFDTIRICTGYRLRGKILDYFP 357

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +      EP+Y  ++GW +STAG R +ADLP QA  YI++++E++E P+AL+S  PER
Sbjct: 358 AHAADQAAVEPIYEEMDGWHESTAGARSYADLPAQAIKYIQRVQELIETPIALVSTSPER 417

Query: 421 ENTLIMSNPFED 432
           E+T+++ +PF D
Sbjct: 418 EDTILIRDPFSD 429


>gi|322391140|ref|ZP_08064612.1| adenylosuccinate synthase [Streptococcus peroris ATCC 700780]
 gi|321145893|gb|EFX41282.1| adenylosuccinate synthase [Streptococcus peroris ATCC 700780]
          Length = 442

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 278/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS NA+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 15  MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 74

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ +VV+P + ++E+  L  +G+  T +NLRI++ A +IL  H +LD L+E 
Sbjct: 75  FPEKISVIGNGMVVNPKSLVNELAYLHAEGV--TTDNLRISDRAHVILPYHIELDRLQEE 132

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
           A       IGTT +GIGPAY D+  R  IR+ DL D E   +++E+ L   N    + + 
Sbjct: 133 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFRERLERNLAEKNRQFVKLYD 190

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + +    I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 191 SEPISIDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPF 250

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G  ++EVG E+
Sbjct: 251 VTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGHRIREVGHEY 310

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 311 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYY 370

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G+R   DLP  ARNY+R++ E++ V ++  S+GP+
Sbjct: 371 PASLEQLKRCKPIYEELPGWSKDITGVRTLEDLPENARNYVRRVSELVGVRISTFSVGPD 430

Query: 420 RENTLIMSNPF 430
           R+ T I+ + +
Sbjct: 431 RDQTNILESVW 441


>gi|332994615|gb|AEF04670.1| adenylosuccinate synthetase [Alteromonas sp. SN2]
          Length = 432

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 199/432 (46%), Positives = 279/432 (64%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L++ A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTDRAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++E+  L  +G+ V    L+I+    LIL  H  LD+ RE A
Sbjct: 63  DNVTCIIGNGVVLSPDALMTEMTMLEERGVPVR-ERLKISEACPLILPYHIALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNA-LRRSFGE 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K++++L  HN  L + +GE
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNAEDFAAKLKEVLDVHNFTLTKYYGE 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V +   L+  M   + +   +  +   L++  + G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDFDETLKGAMAVADILKAMVVDVTDELDKAHKAGLPIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT     + G+G  P  L YVLG+VKAYTTRVG GPFPTEL  + G+ L   G EFG
Sbjct: 240 TSSNTTVGGVATGAGFGPLKLDYVLGIVKAYTTRVGSGPFPTELDCEVGNHLGVKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYR-MDGREVDFL 359
             T R+RR GW D  +++R+V IN + G  LTKLDVLDGL+ L+IC+GY+  DG+  D  
Sbjct: 300 ATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLETLQICIGYKDADGKVKDVP 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW  +T G+  FA LP  A+NYI+++E +  VPV ++S GP+
Sbjct: 360 PMAADGYDKVTPVYEEMPGWSDNTYGVTTFAGLPQAAKNYIQRLEHLTGVPVDIVSTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ NP++
Sbjct: 420 RNETIVLRNPYD 431


>gi|164686468|ref|ZP_02210496.1| hypothetical protein CLOBAR_00033 [Clostridium bartlettii DSM
           16795]
 gi|164604479|gb|EDQ97944.1| hypothetical protein CLOBAR_00033 [Clostridium bartlettii DSM
           16795]
          Length = 431

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 184/435 (42%), Positives = 262/435 (60%), Gaps = 7/435 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M  V +VG QWGDEGKGK++D+L+  ADV++R QGGNNAGHT+ V+   + L L+PSG++
Sbjct: 1   MKTVAIVGSQWGDEGKGKVIDFLATQADVVIRAQGGNNAGHTIVVDGKKFALRLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+ +++IG+ +V DP  F  E+E L   GI     N++I++ A +I   H++LD L E 
Sbjct: 61  NPNTINVIGNGIVFDPKGFFEELEMLQSNGID--TKNIKISDRAHIIFPYHKELDGLAEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT+RGIGP Y D+  R  IR+ DL D +  +KK++  +   N L +   +
Sbjct: 119 AR--GDNKIGTTKRGIGPCYMDKTERSGIRICDLMDKDVFAKKLKGQVEAKNKLVKGVYD 176

Query: 181 K---EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTY 237
           K      +  I  E M   EK+ PF+     ++    + G  +LFEGAQG LLD D GTY
Sbjct: 177 KKEDMFNFDEIYSEFMTYAEKLRPFVADTTVIVYDAIKAGKKVLFEGAQGTLLDLDLGTY 236

Query: 238 PFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGK 297
           P+VTSS+  S   ++G+GI P  +  V+G+VKAYTTRVG GPF TE  N+ GD ++  G 
Sbjct: 237 PYVTSSHPTSGGFAVGAGIGPNMIKDVVGIVKAYTTRVGEGPFVTEQLNEIGDQIRIKGH 296

Query: 298 EFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVD 357
           EFGTVT R RRCGW D   V+ +   NG+  IA   LDVL G +E++IC  Y+     ++
Sbjct: 297 EFGTVTGRSRRCGWFDAVVVKYAARTNGLTSIAFMLLDVLTGFEEIQICTAYKCGDEILE 356

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
             P       + EPVY  + GW +    +  + DLP  A+ YI +IEE++ V V L+S+G
Sbjct: 357 NFPASLEQLAKCEPVYETMPGWTEDITKVEKYEDLPENAKKYITRIEELIGVNVDLVSVG 416

Query: 418 PERENTLIMSNPFED 432
           P R  T+I  N F++
Sbjct: 417 PNRAQTIIRKNVFDN 431


>gi|238755907|ref|ZP_04617235.1| Adenylosuccinate synthetase [Yersinia ruckeri ATCC 29473]
 gi|238705866|gb|EEP98255.1| Adenylosuccinate synthetase [Yersinia ruckeri ATCC 29473]
          Length = 432

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 203/432 (46%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMREMTGLEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN     + + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFATKLKEIVDYHNFQLVHYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+ +L+ +M   + +   +  +  LL+   +KG  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQEVLDGVMAVADILTGMVVDVSELLDSARKKGELIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL++  G FL+  G E+G
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIMKAYSTRVGAGPFPTELEDDIGKFLRTQGNEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ +V+R+V IN + G  +TKLDVLDGL E+KICVGYRM DGR +D  
Sbjct: 300 ATTGRDRRTGWLDIVAVKRAVQINSLSGFCMTKLDVLDGLKEVKICVGYRMPDGRVMDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y ++ GW ++T G++ +  LP  A NYI+++E +  VPV ++S GP+
Sbjct: 360 PLAADDWEGIEPIYEVMPGWSETTFGVKEYDKLPQAAVNYIKRVEALTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R+ T+I+ +PF+
Sbjct: 420 RDETMILRDPFD 431


>gi|228936747|ref|ZP_04099538.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228822956|gb|EEM68797.1| Adenylosuccinate synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 429

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 187/432 (43%), Positives = 271/432 (62%), Gaps = 5/432 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSE+A+V+ R+QGGNNAGHT+    + YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFGGVKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ +IG+ +VVDP A + E++ L  +G+  + +NLR++N   +IL  H   D L E 
Sbjct: 61  YKEKICVIGNGLVVDPKALLEELKYLHDRGV--STDNLRVSNRVHVILPYHLKQDELEE- 117

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT++GIGPAY D+  R  IR+ DL D E   +K+EQ L   N L     +
Sbjct: 118 -ASKGDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLEQNLAQKNRLFEKMYD 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E      I EE     ++I  ++     +L         +LFEGAQG +LD DHGTYPF
Sbjct: 177 TEGFSVDEIFEEYFEYGQQIAQYVCDTSVVLNDALDNNHRVLFEGAQGVMLDIDHGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   ++G+G+ P  +  V+GV KAYT+RVG GPFPTEL ++ G  ++EVG+E+
Sbjct: 237 VTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G+  LKICV Y+ DG+ +D +
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAYKCDGKVIDEV 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW +   G+R   +LP  AR Y+ ++ E+  + +++ S+GP+
Sbjct: 357 PANLNILAKCEPVYEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPD 416

Query: 420 RENTLIMSNPFE 431
           R  T I+ N +E
Sbjct: 417 RNQTNIVRNVYE 428


>gi|212640659|ref|YP_002317179.1| adenylosuccinate synthetase [Anoxybacillus flavithermus WK1]
 gi|212562139|gb|ACJ35194.1| Adenylosuccinate synthetase [Anoxybacillus flavithermus WK1]
          Length = 439

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 189/431 (43%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LS++A+VI R+QGGNNAGHT+  N   YKL L+PSG+ 
Sbjct: 12  MSSVVVVGTQWGDEGKGKITDFLSQHAEVIARYQGGNNAGHTIVFNGEKYKLHLIPSGIF 71

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+ +IG+ +VVDP A + E+  L  +G+  + +NLRI+N A +IL  H  LD + E 
Sbjct: 72  YKDKICVIGNGMVVDPKALVQELAYLHERGV--STDNLRISNRAHVILPYHLKLDEVEEE 129

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT++GIGPAY D+  R  IR+ DL D E   +K+ + L   N L  + +G
Sbjct: 130 R--KGANKIGTTKKGIGPAYMDKAARVGIRIADLLDREVFEEKLARNLAEKNVLFEKVYG 187

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +    + IL+E     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 188 VEGFQLEHILDEYYEYGQQIAKYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPF 247

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IG+G+ P  + +V+GV KAYTTRVG GPFPTEL N+ GD ++EVG+E+
Sbjct: 248 VTSSNPVAGGVTIGAGVGPTKIKHVVGVAKAYTTRVGDGPFPTELNNEIGDRIREVGREY 307

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G++ LKICV YR  G+ ++  
Sbjct: 308 GTTTGRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGQIIEEF 367

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EPVY  L GW +   G++   +LP  AR Y+ +I ++  +P+++ S+GP+
Sbjct: 368 PASLKVLAECEPVYEELPGWTEDITGVKSLDELPANARRYVERISQLTGIPLSIFSVGPD 427

Query: 420 RENTLIMSNPF 430
           R  T ++ N +
Sbjct: 428 RSQTNVVRNVY 438


>gi|284006630|emb|CBA71891.1| adenylosuccinate synthetase [Arsenophonus nasoniae]
          Length = 436

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 201/432 (46%), Positives = 288/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL VN     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVVNGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +S+IG+ VV+ P A + E++ L  +G+ V    L+I+    LIL  H  LD  RE A
Sbjct: 67  ENVISVIGNGVVLAPDALMDEMKKLEARGVPVR-ERLKISAACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR IRV DL + +    K+++++ +HN    ++ + 
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGIRVGDLFNKKTFPVKLKEIVDYHNFQLVNYYKA 183

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + Y+  L+++M   + +      +  LL +  +KG  +++EGAQG LLD DHGTYP+V
Sbjct: 184 PAIDYQKTLDDIMVIADILTAMTVDVADLLYKAHQKGELVMYEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVGGGPFPTEL ++TG++L+E G+EFG
Sbjct: 244 TSSNTTAGGVATGSGLGPCYIDYVLGILKAYSTRVGGGPFPTELSDETGEYLREKGQEFG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVDFL 359
             T R RR GWLD+ ++ R+V IN + G  LTKLDVLDGLDE+K+C+ Y + DG E+   
Sbjct: 304 ATTGRCRRTGWLDIVAINRAVQINSLSGFCLTKLDVLDGLDEVKLCIAYRKPDGTELTIT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  L GW +ST G++    LP  A +YI++IEE+  +P+ ++S GP+
Sbjct: 364 PLAAEEWEGLEPIYETLPGWSESTFGVKEHNQLPKAAIDYIKRIEELTGIPIDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 424 RAETMILQDPFD 435


>gi|22537957|ref|NP_688808.1| adenylosuccinate synthetase [Streptococcus agalactiae 2603V/R]
 gi|25011898|ref|NP_736293.1| adenylosuccinate synthetase [Streptococcus agalactiae NEM316]
 gi|76798369|ref|ZP_00780612.1| adenylosuccinate synthetase [Streptococcus agalactiae 18RS21]
 gi|77408417|ref|ZP_00785156.1| adenylosuccinate synthetase [Streptococcus agalactiae COH1]
 gi|77414264|ref|ZP_00790424.1| adenylosuccinate synthetase [Streptococcus agalactiae 515]
 gi|54038933|sp|P65886|PURA_STRA5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|54041749|sp|P65885|PURA_STRA3 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|22534857|gb|AAN00681.1|AE014274_11 adenylosuccinate synthetase [Streptococcus agalactiae 2603V/R]
 gi|24413440|emb|CAD47518.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76586283|gb|EAO62798.1| adenylosuccinate synthetase [Streptococcus agalactiae 18RS21]
 gi|77159680|gb|EAO70831.1| adenylosuccinate synthetase [Streptococcus agalactiae 515]
 gi|77172940|gb|EAO76070.1| adenylosuccinate synthetase [Streptococcus agalactiae COH1]
          Length = 430

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 276/433 (63%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ +++  +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FKEKISVIGNGVVVNPKSLVKELAYLHGEGV--TTDNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  +++++  L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDREVFAERLKINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLEFDDIFEEYYEYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+GKE+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREIGKEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +     R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITACRSLDDLPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|261250424|ref|ZP_05942999.1| adenylosuccinate synthetase [Vibrio orientalis CIP 102891]
 gi|260938993|gb|EEX94980.1| adenylosuccinate synthetase [Vibrio orientalis CIP 102891]
          Length = 438

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 195/437 (44%), Positives = 273/437 (62%), Gaps = 11/437 (2%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   NNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   +IG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  +D  RE A
Sbjct: 63  DNVKCVIGNGVVLSPEALLKEMKPLEERGIPVR-ERLFVSEACPLILPYHIAIDNAREIA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++  HN     F + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEMFAEKLKEVMEFHNFQLEHFYKA 179

Query: 182 EV-LYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E   Y  +LE+ M   + +   +  +   L+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 ETVSYDEVLEQCMGYADLLTSMVMDVTDELDAARKRGDKIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPT------ELKNQTGDFLKE 294
           TSSNT +   + GSG  P  +GY+LG+ KAY TRVG GPFPT      + ++  G  L +
Sbjct: 240 TSSNTTAGGVAAGSGFGPRHIGYILGITKAYCTRVGSGPFPTELYDGLDKQDPVGKHLGD 299

Query: 295 VGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DG 353
           VG EFG  T R RR GW D  ++RR++ IN + G+ LTKLDVLDGL E+KIC GY+M DG
Sbjct: 300 VGHEFGATTGRLRRTGWFDAVAMRRAIQINSLTGMCLTKLDVLDGLKEIKICTGYKMKDG 359

Query: 354 REVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAL 413
             ++  P  +       P+Y  + GW ++T G +    LP  A +YI++IEE+  VPV +
Sbjct: 360 AILEVSPMAAESFEEATPIYETMLGWSETTFGAKSIDALPQAALDYIKRIEELTGVPVDI 419

Query: 414 LSIGPERENTLIMSNPF 430
           +S GP+R  T+I  +P+
Sbjct: 420 ISTGPDRNETIIKVHPY 436


>gi|217971917|ref|YP_002356668.1| adenylosuccinate synthetase [Shewanella baltica OS223]
 gi|217497052|gb|ACK45245.1| Adenylosuccinate synthase [Shewanella baltica OS223]
          Length = 431

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKDRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMKYHNFMLTEYYQV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEQTLADALAMADYLKSMCVDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPCHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQNPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    PVY  + GW +ST G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYELVTPVYETMPGWSESTFGATSIEQLPPAAINYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|315498784|ref|YP_004087588.1| adenylosuccinate synthetase [Asticcacaulis excentricus CB 48]
 gi|315416796|gb|ADU13437.1| adenylosuccinate synthetase [Asticcacaulis excentricus CB 48]
          Length = 449

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 253/431 (58%), Positives = 313/431 (72%), Gaps = 3/431 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NV VVG QWGDEGKGK+VDWLS  ADV+VRFQGG+NAGHTL V+  VYKLSLLPSGVV 
Sbjct: 22  ANVTVVGAQWGDEGKGKLVDWLSNRADVVVRFQGGHNAGHTLVVDGKVYKLSLLPSGVV- 80

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
             K+S+IG+ VVVDP A   EI  +  QG+ +TP+ L +A+NA LIL IHR+LD  RE A
Sbjct: 81  QGKLSVIGNGVVVDPWALFDEIGRVEAQGLSITPDLLVLADNACLILPIHRELDTAREAA 140

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+VGRRAIRV DL D + +  KIE+LL HHNALR+  G  
Sbjct: 141 A--GAGKIGTTGRGIGPAYEDKVGRRAIRVADLEDFDGLDAKIERLLTHHNALRKGLGLA 198

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
           EV   +++ EL     ++L F   +W +L++   +G  ILFEGAQG LLD DHGTYPFVT
Sbjct: 199 EVNTASLIAELKAIAPRLLAFAKPVWYVLDKAKSEGKRILFEGAQGALLDIDHGTYPFVT 258

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSNT++ QA+ GSG+ P S+GYVLG++KAYTTRVG GPFPTEL +  G+ +  VG EFGT
Sbjct: 259 SSNTVAGQAAAGSGMGPRSVGYVLGILKAYTTRVGSGPFPTELFDDIGERISRVGHEFGT 318

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPD 361
           VT R RRCGWLD    R+S+ ING+ G+ALTKLDVLDG++ LKICVGY++  + +D+LP 
Sbjct: 319 VTGRARRCGWLDAVLARQSIAINGIDGVALTKLDVLDGIETLKICVGYKVGDKVLDYLPA 378

Query: 362 DSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERE 421
                   EPVY  LEGW +ST G R + DLP  A  Y+R+IEE++  PVALLS  PERE
Sbjct: 379 GFKAQAGIEPVYEELEGWTESTQGARSWKDLPGNAVKYVRRIEELIGAPVALLSTSPERE 438

Query: 422 NTLIMSNPFED 432
           +T++M +PF D
Sbjct: 439 DTILMRDPFAD 449


>gi|170728544|ref|YP_001762570.1| adenylosuccinate synthetase [Shewanella woodyi ATCC 51908]
 gi|229576747|sp|B1KIH9|PURA_SHEWM RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|169813891|gb|ACA88475.1| Adenylosuccinate synthase [Shewanella woodyi ATCC 51908]
          Length = 431

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 281/431 (65%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E +  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQSKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++EI+ L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMTEIKMLKERGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNNAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFAEKLKEVMAYHNFMLTEYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYEETLKDALAIADYLKSMCVDVTELLDQARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL+ + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELQCEIGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD+ +++R+V IN + G  LTKLDVLDGL+E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDVVAMKRAVQINSISGFCLTKLDVLDGLEEVKICVGYQYPDGSVATVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PV   + GW ++T G      LP  A NYI+++EE+L+ P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVLETMPGWSENTFGATSVEQLPQAALNYIKRLEELLDTPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ NPF
Sbjct: 420 RNETMILVNPF 430


>gi|261823146|ref|YP_003261252.1| adenylosuccinate synthetase [Pectobacterium wasabiae WPP163]
 gi|261607159|gb|ACX89645.1| adenylosuccinate synthetase [Pectobacterium wasabiae WPP163]
          Length = 432

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/432 (47%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLKEIIEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVLAIADILTAMVVDVSDLLHKAHLRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL  + G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFEEVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYR+ +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEIKICVGYRLPNGTEVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEEV  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGLEPIYETVPGWSESTFGVKDHSKLPQAALNYIKRIEEVTGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|239828689|ref|YP_002951313.1| adenylosuccinate synthetase [Geobacillus sp. WCH70]
 gi|259547044|sp|C5D9W9|PURA_GEOSW RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|239808982|gb|ACS26047.1| adenylosuccinate synthetase [Geobacillus sp. WCH70]
          Length = 428

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 279/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSENA+VI R+QGGNNAGHT+  N   YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIVFNGEKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+ +IG+ +VVDP A ++E++ L  +GI  + +NLRI+N A +IL  H  LD L E 
Sbjct: 61  YKDKICVIGNGMVVDPKALVAELKYLHDRGI--STDNLRISNRAHVILPYHLKLDELEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT++GIGPAY D+  R  IR++DL D E   +K+ + L   N L  + +G
Sbjct: 119 R--KGANKIGTTKKGIGPAYMDKAARVGIRIVDLLDREVFEEKLARNLQEKNVLFEKVYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +    + IL+E     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 VEGFKLEDILDEYYEYGQQIAKYVCDTSVVLNNALDEGRRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IG+G+ P  + +V+GV KAYTTRVG GPFPTEL ++ GD ++EVG+E+
Sbjct: 237 VTSSNPVAGGVTIGAGVGPTKIKHVVGVAKAYTTRVGDGPFPTELHDEIGDRIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G++ LKICV YR  G+ ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGKVIEEF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EP+Y  L GW +   G++   +LP+ AR+Y+ +I ++  +P+++ S+GP+
Sbjct: 357 PASLKVLAECEPIYEELPGWSEDITGVKSLDELPVNARHYVERISQLTGIPLSIFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R  T ++ + +
Sbjct: 417 RSQTNVVRSVY 427


>gi|217977191|ref|YP_002361338.1| Adenylosuccinate synthase [Methylocella silvestris BL2]
 gi|254788713|sp|B8EK29|PURA_METSB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|217502567|gb|ACK49976.1| Adenylosuccinate synthase [Methylocella silvestris BL2]
          Length = 431

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 254/432 (58%), Positives = 326/432 (75%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS  AD++VRFQGG+NAGHTL + + VYKL+LLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSIEADIVVRFQGGHNAGHTLVIGNQVYKLALLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RP K+S+IG+ VV+DPH  + EI  ++ QG+ VTP+NL+IA+N +LIL++HR+LD  RE 
Sbjct: 61  RPGKLSVIGNGVVLDPHHLVDEIAKISAQGVTVTPDNLKIADNVTLILALHRELDAHRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT+RGIGPAYED+VGRRAIR+MDL + + + +KI++LL HH+ LRR  G 
Sbjct: 121 A-SVAGVKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPDSLDEKIDRLLAHHDPLRRGLGL 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V    I  EL     K+LP+MD +W LLE   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EPVPRAAIRAELEDVAPKVLPYMDAVWDLLETARRDGKRILFEGAQGALLDVDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ P ++GYVLG+ KAYTTRVGGGPFPTEL ++TG  L + G EFG
Sbjct: 240 TSSNTVAANAATGSGLGPKAIGYVLGIAKAYTTRVGGGPFPTELHDETGQRLGDRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           T T R+RRCGW D   VR++V  +G+ GIALTKLD+LDG +E+K+CVGY +DG  ++  P
Sbjct: 300 TNTGRRRRCGWFDAVLVRQTVKTSGIDGIALTKLDILDGFEEIKVCVGYLLDGERINRFP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R  P+Y  +EGW  +TAG R +A+LP QA  Y+R+IEE++E PVALLS  P+R
Sbjct: 360 ASQAAQARVTPIYETMEGWAGTTAGARSWAELPAQAIKYVRRIEELIEAPVALLSTSPQR 419

Query: 421 ENTLIMSNPFED 432
            +T+++ NPF D
Sbjct: 420 ADTILVHNPFRD 431


>gi|114564518|ref|YP_752032.1| adenylosuccinate synthetase [Shewanella frigidimarina NCIMB 400]
 gi|122298727|sp|Q07XS1|PURA_SHEFN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|114335811|gb|ABI73193.1| Adenylosuccinate synthetase [Shewanella frigidimarina NCIMB 400]
          Length = 431

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 206/432 (47%), Positives = 279/432 (64%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VVV P A + EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVVAPDALMKEINMLKGRGVPV-EERLLISEACPLILPFHCALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +R+ DL + E  + K+++++ +HN +   + + 
Sbjct: 122 R--GNQAIGTTGRGIGPAYEDKVSRRGLRIGDLFNAELFATKLQEVMKYHNFMLTEYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L++ +   + +      +  +L+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EAVDYQQTLDDALAIADYLKSMCTDVSEMLDVARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL N+ GD++ E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELANEIGDYIGEKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQYADGTVSKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  +    P+Y  + GW ++T G      LP  A NYI+++EE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYDLVTPIYETMPGWSETTFGATTIEQLPPAAINYIKRLEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ NPF+
Sbjct: 420 RNETMILVNPFK 431


>gi|50122849|ref|YP_052016.1| adenylosuccinate synthetase [Pectobacterium atrosepticum SCRI1043]
 gi|81827003|sp|Q6D072|PURA_ERWCT RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|49613375|emb|CAG76826.1| adenylosuccinate synthetase [Pectobacterium atrosepticum SCRI1043]
          Length = 432

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 204/432 (47%), Positives = 286/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SIIG+ VV+ P A + E+  L  +G+ V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVVSIIGNGVVLAPDALMKEMTELEARGVPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLKEIVEYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+ +L++++   + +   +  +  LL +   +G  ++FEGAQG LLD DHGTYP+V
Sbjct: 180 DAVDYQKVLDDVLAIADILTAMVVDVSDLLYKAHLRGDFVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG+VKAY+TRVG GPFPTEL  + G+ L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFEEVGEHLSQKGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V IN + G  LTKLDVLDGL E+KICVGYR+ +G EVD  
Sbjct: 300 ATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEIKICVGYRLPNGTEVDTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 360 PLAAEGWEGLEPIYETVPGWSESTFGVKDHSKLPQAALNYIKRIEEITGVPIDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++ +PF+
Sbjct: 420 RSETMVLRDPFD 431


>gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040290|gb|ACT57086.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 432

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 432/432 (100%), Positives = 432/432 (100%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV
Sbjct: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG
Sbjct: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE
Sbjct: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV
Sbjct: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG
Sbjct: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP
Sbjct: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
           DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER
Sbjct: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420

Query: 421 ENTLIMSNPFED 432
           ENTLIMSNPFED
Sbjct: 421 ENTLIMSNPFED 432


>gi|24375425|ref|NP_719468.1| adenylosuccinate synthetase [Shewanella oneidensis MR-1]
 gi|30173288|sp|Q8EAG5|PURA_SHEON RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|24350266|gb|AAN56912.1|AE015825_11 adenylosuccinate synthetase [Shewanella oneidensis MR-1]
          Length = 431

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 209/431 (48%), Positives = 274/431 (63%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVINGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A + EI  L  +GI V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMKEINMLKERGIPV-EERLLISEACPLILPFHSALDIAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED++ RR +RV DL + E  ++K+++++ +HN +   + + 
Sbjct: 122 R--GNKAIGTTGRGIGPAYEDKISRRGLRVGDLFNAELFAEKLKEVMAYHNFMLTEYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L + +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 DAVDYEQTLSDALALADYLKSMCVDVTELLDNARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L YVLG++KAYTTRVG GPFPTEL  + GD L   G EFG
Sbjct: 240 TSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPTELLCEVGDHLGTKGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  ++RR+V IN V G  LTKLDVLDGL E+KICVGY+  DG      
Sbjct: 300 ATTGRKRRPGWLDAVAMRRAVQINSVSGFCLTKLDVLDGLKEVKICVGYQHPDGTISKVT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +  + +  PVY  + GW +ST G      LP  A NYI++IEE+LE P+ ++S GP+
Sbjct: 360 PLAAEGYEQVTPVYETMPGWSESTFGATFLEQLPQAAINYIKRIEELLETPIDIISTGPD 419

Query: 420 RENTLIMSNPF 430
           R  T+I+ +PF
Sbjct: 420 RNETMILVSPF 430


>gi|182677261|ref|YP_001831407.1| adenylosuccinate synthase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|229470298|sp|B2ICM9|PURA_BEII9 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|182633144|gb|ACB93918.1| Adenylosuccinate synthase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 431

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 253/432 (58%), Positives = 317/432 (73%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLS  AD++VRFQGG+NAGHTL + + VYKL+LLPSG+V
Sbjct: 1   MANVVVVGAQWGDEGKGKIVDWLSIEADIVVRFQGGHNAGHTLVIGNQVYKLALLPSGIV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VVVDP   + EI  LA QGI +TP+NL+IA N  LIL +HR+LD  RE 
Sbjct: 61  RLGKLSVIGNGVVVDPQHLVEEIAKLAAQGIEITPDNLKIAENVPLILGLHRELDAHRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           +       IGTT+RGIGPAYED+VGRRAIR+MDL + + + +KI +LL HH  LRR  G 
Sbjct: 121 STVEGV-KIGTTKRGIGPAYEDKVGRRAIRLMDLAEPDTLDEKIVRLLAHHEPLRRGLGL 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + +    I  EL     KILPFMD  W LLE   R G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EPISAGAIRAELESLAPKILPFMDATWDLLENARRAGKRILFEGAQGALLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++A A+ GSG+ P ++GYVLG+ KAYTTRVGGGPFPTEL ++TG  + + G E+G
Sbjct: 240 TSSNTVAANAATGSGLGPKAIGYVLGIAKAYTTRVGGGPFPTELLDETGQLIGDRGHEYG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGW D   VR++V   G+ GIALTKLD+LDG  E+K+CVGY +DGR +D LP
Sbjct: 300 VNTGRRRRCGWFDAVLVRQTVKTCGIDGIALTKLDILDGFKEIKVCVGYDLDGRRIDRLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R +P+Y  ++GW+ +TAG R +ADLP QA  Y+R+IEE++E PVALLS  PER
Sbjct: 360 ASQSAQARVKPIYETIDGWEGTTAGARSWADLPAQAIKYVRRIEELIEAPVALLSTSPER 419

Query: 421 ENTLIMSNPFED 432
            +T+++ +PF D
Sbjct: 420 ADTILVHDPFRD 431


>gi|320547603|ref|ZP_08041888.1| adenylosuccinate synthase [Streptococcus equinus ATCC 9812]
 gi|320447678|gb|EFW88436.1| adenylosuccinate synthase [Streptococcus equinus ATCC 9812]
          Length = 430

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 187/433 (43%), Positives = 279/433 (64%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS++A+VI R+QGG+NAGHT+ ++   +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSQDAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
            P+K+S+IG+ VVV+P + ++E++ L  +G+    ++LRI++ A +IL  H  LD L+E 
Sbjct: 61  FPEKISVIGNGVVVNPKSLVTELKYLHDEGV--KTDSLRISDRAHVILPYHIKLDRLQES 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAY D+  R  IR+ DL D E  ++++   L   N L     E
Sbjct: 119 --SKGVNKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRVNLEEKNRLFEKMYE 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            + + ++ I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 CEPIKFEDIFEEYYEYGQQIKDYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+G E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELLDEVGDRIREIGHEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D  
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDHY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +   G R   +LP  AR+Y+R++ E++ V ++  S+GP+
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITGCRSLDELPENARHYVRRVGELVGVHISTFSVGPD 416

Query: 420 RENTLIMSNPFED 432
           R+ T I+ + + +
Sbjct: 417 RDQTNILESVWAN 429


>gi|157368683|ref|YP_001476672.1| adenylosuccinate synthetase [Serratia proteamaculans 568]
 gi|167011943|sp|A8G8V4|PURA_SERP5 RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|157320447|gb|ABV39544.1| Adenylosuccinate synthase [Serratia proteamaculans 568]
          Length = 432

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 211/432 (48%), Positives = 287/432 (66%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGK+VD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E+  L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 63  ENVTSIIGNGVVLAPDALMKEMGELEARGIPVR-ERLLLSEACPLILPYHVALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL + E  + K+++++ +HN    ++ + 
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAVKLKEIVDYHNFQLVNYYKV 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V Y+  L+ ++   + +   +  +  LL+   ++G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 EAVDYQATLDYVLSIADILTAMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSGI P  + YVLG+VKAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 240 TSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRRSV IN + G  LTKLDVLDGL E+KICVGYRM DGRE+   
Sbjct: 300 ATTGRRRRTGWLDAVAVRRSVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREMTTT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW  +T G++  + LP  A NYI++IEE+  VPV ++S GP+
Sbjct: 360 PLAAEGWEGIEPIYESMPGWSDTTFGVKEHSKLPQAALNYIKRIEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|253991549|ref|YP_003042905.1| adenylosuccinate synthetase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638427|emb|CAR67049.1| pura, subunit of adenylosuccinate synthase (ec 6.3.4.4)
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782999|emb|CAQ86164.1| PurA, subunit of adenylosuccinate synthase [Photorhabdus
           asymbiotica]
          Length = 436

 Score =  491 bits (1264), Expect = e-137,   Method: Composition-based stats.
 Identities = 208/432 (48%), Positives = 292/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 7   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 66

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E+ +L  +G+ V    L I+    LIL  H  LD  RE A
Sbjct: 67  ENVISIIANGVVLAPDALMKEMNALESRGVPVR-ERLLISEACPLILPYHVALDNAREKA 125

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  + K+++++ +HN    ++ ++
Sbjct: 126 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEVFAAKLKEIIEYHNFQLVNYYKE 183

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+E+M   + +   +  +  LL + ++KG  ++FEGAQG LLD DHGTYP+V
Sbjct: 184 PAVDYQKTLDEIMAVADILTDMVIDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYPYV 243

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG +L+E G+EFG
Sbjct: 244 TSSNTTAGGVATGSGLGPCYVDYVLGIIKAYSTRVGAGPFPTELFDETGSYLREKGQEFG 303

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R RR GWLD+ ++RR+V IN + G  +TKLDVLDGL E+KICVGYRM DG  ++  
Sbjct: 304 ATTGRSRRTGWLDIIAIRRAVQINSLSGFCMTKLDVLDGLKEVKICVGYRMPDGCVIETT 363

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY  + GW +ST G++  + LP+ A NYI+++EE+  VPV ++S GP+
Sbjct: 364 PLAADDWEGIEPVYETMPGWDESTFGVKEHSKLPLAALNYIKRVEELTGVPVDIISTGPD 423

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 424 RSETMILRDPFD 435


>gi|330965986|gb|EGH66246.1| adenylosuccinate synthetase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 430

 Score =  491 bits (1264), Expect = e-137,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 274/430 (63%), Gaps = 4/430 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +GI V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREIIKLEEKGIPVR-ERLRISPSCPLILSYHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +R+ DL   E  + K+ +LL +HN +  ++ ++
Sbjct: 122 RGEF--KIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L+E M   + + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG  P  L Y+LG+ KAYTTRVG GPFPTEL +  G FL + G EFG
Sbjct: 240 TSSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ IN + G+ LTKLDVLDGL+ + IC+GY  +   V   P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICIGYENEEGAVIDAP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +     VY  + GW +ST G +   +LP  AR YI+++EE++  P+ ++S GP+R
Sbjct: 360 TDADSYLGLRSVYEEMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDR 419

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 420 NETIVLRHPF 429


>gi|90418987|ref|ZP_01226898.1| adenylosuccinate synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337067|gb|EAS50772.1| adenylosuccinate synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 431

 Score =  491 bits (1264), Expect = e-137,   Method: Composition-based stats.
 Identities = 266/432 (61%), Positives = 333/432 (77%), Gaps = 1/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M NVVVVG QWGDEGKGKIVDWLSE ADV+VRFQGG+NAGHTL V+ + YKLSLLPSGVV
Sbjct: 1   MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVVDGVSYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           R  K+S+IG+ VV DPHAF++E   L  QG+ V+P  LRIA+NA+LILS+HR+LD  RE 
Sbjct: 61  RQGKLSVIGNGVVFDPHAFVAEKNRLQEQGVSVSPETLRIADNAALILSLHRELDATREN 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A S  G  IGTT RGIGPAYED+VGRRAIRVMDL + E +  +IE+LL HHNALRR  G+
Sbjct: 121 A-SAAGTKIGTTGRGIGPAYEDKVGRRAIRVMDLANPESLPGRIERLLAHHNALRRGLGQ 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E+    IL+EL    ++I P++D +W LL++  + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 SEIDPAAILDELTSVADEITPYIDRVWRLLDQRRKAGDRILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT++ QA+ GSG+ P SLG+VLG+ KAYTTRVG GPFP+E  N+ G FL E G+EFG
Sbjct: 240 TSSNTVAGQAAAGSGLGPSSLGFVLGITKAYTTRVGEGPFPSEQDNEIGQFLGEKGREFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVT R+RRCGW D   VR++V +NG+ G+ALTKLDVLDGLDE+KI V Y++DG+ +D+LP
Sbjct: 300 TVTGRKRRCGWFDAVLVRQAVALNGIHGLALTKLDVLDGLDEIKIVVAYKLDGKTIDYLP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
                  R EP++  LEGW+ +TAG R + DLP QA  Y+R IEE++E PV LLS  PER
Sbjct: 360 ASLAEQQRIEPIFETLEGWRDTTAGARRWTDLPAQAIKYVRHIEELVEAPVTLLSTSPER 419

Query: 421 ENTLIMSNPFED 432
           ++T+++ +PF+D
Sbjct: 420 DDTILVRDPFQD 431


>gi|229588080|ref|YP_002870199.1| adenylosuccinate synthetase [Pseudomonas fluorescens SBW25]
 gi|259547082|sp|C3KDW8|PURA_PSEFS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|229359946|emb|CAY46800.1| adenylosuccinate synthetase [Pseudomonas fluorescens SBW25]
          Length = 429

 Score =  491 bits (1264), Expect = e-137,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 273/430 (63%), Gaps = 5/430 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E+A  +VR+QGG+NAGHTL ++     L L+PSGV+R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGVLR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                +IG+ VVV P A + EI  L  +G+ V    LRI+ +  LILS H  LD  RE A
Sbjct: 63  EGVQCLIGNGVVVAPDALLREITKLEEKGVPVR-ERLRISPSCPLILSFHVALDQAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL ++     K+ +L+ +HN +   + ++
Sbjct: 122 R--GELKIGTTGRGIGPAYEDKVARRGLRVGDLLNMPRFEDKLRELVDYHNFMLVGYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             + ++  L E     E + P M  + + L    R G  I+FEGAQG LLD DHGTYP+V
Sbjct: 180 PAIEFEKTLAECKEYAELLKPLMLDVTAELHDLRRAGKDIMFEGAQGSLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  L Y+LG+ KAYTTRVG GPFPTEL ++ G  L + G EFG
Sbjct: 240 TSSNTTAGGVATGSGVGPMFLDYILGITKAYTTRVGSGPFPTELFDEVGAHLAKQGHEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R RRCGW D   +RR++ +N + GI  TKLDVLDGL+ + ICVGY+ D    D  P
Sbjct: 300 ATTGRARRCGWFDAVILRRAIDVNSISGICFTKLDVLDGLETINICVGYK-DADGNDVAP 358

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D+  +   +PVY  + GW +ST G +   +LP  AR YI+++E ++  P+ ++S GP+R
Sbjct: 359 TDADSYVGLQPVYEEVPGWTESTVGAKTLEELPANARAYIKRVEALIGAPIDIISTGPDR 418

Query: 421 ENTLIMSNPF 430
             T+++ +PF
Sbjct: 419 NETIVLRHPF 428


>gi|152977666|ref|YP_001377183.1| adenylosuccinate synthetase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189038292|sp|A7GVN0|PURA_BACCN RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|152026418|gb|ABS24188.1| Adenylosuccinate synthase [Bacillus cytotoxicus NVH 391-98]
          Length = 429

 Score =  491 bits (1264), Expect = e-137,   Method: Composition-based stats.
 Identities = 187/431 (43%), Positives = 273/431 (63%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSE+A+V+ R+QGGNNAGHT+  N + YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFNGVKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+ +IG+ +VVDP A + E++ L  +G+  + +NLRI+N A +IL  H   D L E 
Sbjct: 61  YKEKICVIGNGMVVDPKALLVELKYLHDRGV--STDNLRISNRAHVILPYHLKQDELEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                   IGTT++GIGPAY D+  R  IR+ DL D E   +K+E+ L   N L     +
Sbjct: 119 R--KGDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLERNLAEKNRLFEKMYD 176

Query: 181 KE-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            E      I EE     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 AEGFNVDEIFEEYYEYGQQIAQYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ G  ++EVG+E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKIKRVVGVCKAYTSRVGDGPFPTELHDEIGQQIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G+  +KICV Y+ +G  +D +
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTVKICVAYKYNGEVLDEV 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P +     + EPVY  L GW +   G++   +LP  AR+Y+ ++ ++  +P+A+ S+GP+
Sbjct: 357 PANLNILAKCEPVYEELPGWTEDITGVKSLEELPENARHYVERVSQLTGIPLAMFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R  T I+ N +
Sbjct: 417 RSQTNIVRNVY 427


>gi|295402147|ref|ZP_06812106.1| adenylosuccinate synthetase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294975830|gb|EFG51449.1| adenylosuccinate synthetase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 428

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 191/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKI D+LSENA+VI R+QGGNNAGHT+  N   YKL L+PSG+ 
Sbjct: 1   MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIVFNGEKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+ +IG+ +V+DP A +SE+  L   GI  + +NLRI+N A +IL  H  LD L E 
Sbjct: 61  YKDKICVIGNGMVIDPKALVSELNYLHDHGI--STDNLRISNRAHVILPYHLKLDELEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT++GIGPAY D+  R  IR++DL D E   +K+ + L   N L  + +G
Sbjct: 119 R--KGANKIGTTKKGIGPAYMDKAARVGIRIVDLLDREVFEEKLARNLQEKNILFEKVYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +    + IL+E     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 VEGFKLEDILDEYYEYGQQIAKYVCDTSVVLNNALDEGRRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  + +V+GV KAYTTRVG GPFPTEL ++ GD ++EVG+E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPTKIKHVVGVAKAYTTRVGDGPFPTELHDEIGDRIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G++ LKICV YR  G+ ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGKVLEEF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EP+Y  L GW +   G++   +LP  AR+Y+ +I ++  +P+++ S+GP+
Sbjct: 357 PASLKVLAECEPIYEELPGWSEDITGVKSLDELPANARHYVERISQLTGIPLSIFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R  T ++ + +
Sbjct: 417 RSQTNVVRSVY 427


>gi|254419439|ref|ZP_05033163.1| adenylosuccinate synthetase [Brevundimonas sp. BAL3]
 gi|196185616|gb|EDX80592.1| adenylosuccinate synthetase [Brevundimonas sp. BAL3]
          Length = 426

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 243/425 (57%), Positives = 305/425 (71%), Gaps = 1/425 (0%)

Query: 7   VGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMS 66
           VG QWGDEGKGKIVDWLS  AD++VRFQGG+NAGHTL V+  VYKL+LLPSGVV   K S
Sbjct: 2   VGAQWGDEGKGKIVDWLSNRADMVVRFQGGHNAGHTLVVDGKVYKLALLPSGVV-QGKPS 60

Query: 67  IIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCG 126
           IIG+ VVVDP   + EIE +  QG+ ++P+ L IA+NA LIL IH  LD+ RE A S  G
Sbjct: 61  IIGNGVVVDPWHLVGEIEKIEAQGVAISPDILTIADNACLILPIHPALDVAREAAASAPG 120

Query: 127 AHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYK 186
           A IGTT RGIGPAYED+VGRRAIRV DL + + +  KIE+L  HH+ LR   G + +  +
Sbjct: 121 AKIGTTGRGIGPAYEDKVGRRAIRVCDLANEDDLKVKIERLRSHHDPLRAGLGLEPIDPE 180

Query: 187 TILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTM 246
            +L  L+    KILP++   W +L++  + G  +LFEGAQG  LD DHGTYP+VTSSNT+
Sbjct: 181 ALLASLLEIAPKILPYVKPAWRVLDQAQKDGKRVLFEGAQGAFLDVDHGTYPYVTSSNTV 240

Query: 247 SAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQ 306
           + QA+ GSG+ P  +GYVLG+VKAYTTRVG GPF  EL ++ G  L  VG+E G  T R 
Sbjct: 241 AGQAAAGSGVGPRGVGYVLGIVKAYTTRVGEGPFACELDDEVGQHLATVGREVGVNTGRA 300

Query: 307 RRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYH 366
           RRCGW D   VR+SV ING+ GIALTKLDVLDGL  LKICVGY++DG  +D+LP      
Sbjct: 301 RRCGWFDAVLVRQSVAINGIDGIALTKLDVLDGLKTLKICVGYKVDGEVLDYLPSSLKAQ 360

Query: 367 TRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIM 426
              EPV+  LEGW +STAG+R F D+   A  Y+R+IEE++  PVALLS  PER++T++M
Sbjct: 361 AAAEPVFEELEGWSESTAGVRSFKDINANAIKYVRRIEELIGAPVALLSTSPERDDTILM 420

Query: 427 SNPFE 431
            +PF+
Sbjct: 421 RDPFQ 425


>gi|51245332|ref|YP_065216.1| adenylosuccinate synthetase [Desulfotalea psychrophila LSv54]
 gi|81826841|sp|Q6AN65|PURA_DESPS RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|50876369|emb|CAG36209.1| probable adenylosuccinate synthetase [Desulfotalea psychrophila
           LSv54]
          Length = 437

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 194/432 (44%), Positives = 276/432 (63%), Gaps = 2/432 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M++VVVVG QWGDEGKGKIVD L++ +D IVRFQGGNNAGHTL V+   +   ++PSG++
Sbjct: 1   MSSVVVVGAQWGDEGKGKIVDLLTKYSDYIVRFQGGNNAGHTLVVDGKKFVFHIIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K  +IG+ V++DP   + E+ SL  +G+ V PN L I++NA LI+  H  LD  +E 
Sbjct: 61  YEEKTCMIGNGVILDPGVLLEEMASLKERGLEVKPNRLMISDNAHLIMPYHSQLDQAKES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
           AL      IGTT RGIGP Y D+VGR  I+  DL D +   +K+   +   N +  + FG
Sbjct: 121 AL-SASNKIGTTGRGIGPCYMDKVGRVGIKAGDLLDEDLFREKLRCAIEEKNFILTKKFG 179

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              V + ++  + M   E++ P+   +   L+   R   +ILFEGAQG  LD DHGTYPF
Sbjct: 180 APAVDFDSVYRQFMDFAEQLSPYFGNVSVTLDEARRADKNILFEGAQGTQLDIDHGTYPF 239

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT++  A  GSG  P  +  V+G+VKAYTTRVG GPFPTEL ++ G+ L+  G EF
Sbjct: 240 VTSSNTVAGNACAGSGFGPSHIDAVVGIVKAYTTRVGSGPFPTELFDEKGEELQNKGSEF 299

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R+RRCGW D      +V +NG+ G ALTKLDVL G   +K+   Y ++G+++  +
Sbjct: 300 GATTGRRRRCGWFDGVVANDAVRLNGLTGWALTKLDVLSGQKSIKMASSYDLNGKKLHAM 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P++       +PVY  + GW     G+  + DLP +A++Y+R+IE+   VP  ++S+GP+
Sbjct: 360 PNNIKDAEALKPVYEEVPGWADEVDGICNYDDLPTEAKDYVRRIEDFTGVPANIVSVGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+++SNPFE
Sbjct: 420 RAQTMMLSNPFE 431


>gi|298368429|ref|ZP_06979747.1| adenylosuccinate synthase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282432|gb|EFI23919.1| adenylosuccinate synthase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 434

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 211/431 (48%), Positives = 289/431 (67%), Gaps = 4/431 (0%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVDWL+E    +VRFQGG+NAGHTL V      L L+PSG++ 
Sbjct: 5   KNVVVIGAQWGDEGKGKIVDWLAEETSGVVRFQGGHNAGHTLVVGGKKTVLRLIPSGILH 64

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
                 IGS VVV P A + EI+ L   G+      L+IA    LIL  H  LD  RE +
Sbjct: 65  ERLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIAPTCPLILPYHIALDQAREAS 124

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHN-ALRRSFGE 180
                + IGTT RGIGPAYED+V RRAIRV+DL   E +++K+E +L ++N  L+   G 
Sbjct: 125 RGK--SKIGTTGRGIGPAYEDKVARRAIRVVDLLRPEQLAEKLESVLAYYNVQLQHLHGA 182

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           + V  + ++  +     +I+P +  +  +L  ++RKG  +LFEGAQG LLD D+GTYPFV
Sbjct: 183 EPVKAEDVMAVIEKIAPRIVPMITDVSRVLTEKNRKGEQLLFEGAQGTLLDIDYGTYPFV 242

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN ++  AS G+G++P  L YVLG+VKAYTTRVG GPFPTEL ++ G  L E G EFG
Sbjct: 243 TSSNCLAGAASAGAGVAPQMLDYVLGIVKAYTTRVGSGPFPTELFDEVGAGLAERGNEFG 302

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
           +VT R RRCGW D A+++RS+ +NG+ G+ +TKLDV+DG++ + ICVGY + DG + D L
Sbjct: 303 SVTGRARRCGWFDAAALKRSIQVNGISGMCITKLDVMDGIENINICVGYELPDGSKTDIL 362

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      +PVY  + GWK+ST G++ +  LP  A+ Y+++IEEV   PVA++S GP+
Sbjct: 363 PFGADAVAGCKPVYETMPGWKESTFGVKSYDALPDNAKAYLKRIEEVCGAPVAIVSTGPD 422

Query: 420 RENTLIMSNPF 430
           RE T+++ +PF
Sbjct: 423 REETIVLHHPF 433


>gi|15896827|ref|NP_350176.1| adenylosuccinate synthetase [Clostridium acetobutylicum ATCC 824]
 gi|21263899|sp|Q97D87|PURA_CLOAB RecName: Full=Adenylosuccinate synthetase; Short=AMPSase;
           Short=AdSS; AltName: Full=IMP--aspartate ligase
 gi|15026690|gb|AAK81516.1|AE007855_8 Adenylosuccinate synthase [Clostridium acetobutylicum ATCC 824]
 gi|325511001|gb|ADZ22637.1| Adenylosuccinate synthase [Clostridium acetobutylicum EA 2018]
          Length = 428

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 187/430 (43%), Positives = 279/430 (64%), Gaps = 3/430 (0%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+  +V+G QWGDEGKGK+ D+L++ ADV+VRFQGGNNAGHT++V D  YKL L+PSG++
Sbjct: 1   MSAFIVLGAQWGDEGKGKMTDYLAQGADVVVRFQGGNNAGHTVEVEDKKYKLHLIPSGIL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+++IG+ VV+DP A   E+E L   G+ VTP NL +++ A LI+  HR LD   E 
Sbjct: 61  YKNKVNVIGNGVVLDPKAMFEEVEYLKGMGVEVTPENLIVSDRAHLIMPYHRALDGASEK 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT +GIGP Y D+  R  IRV DL   E   +K++  L   NA+  + +G
Sbjct: 121 HRGKND--IGTTGKGIGPCYTDKAERSGIRVCDLLHPEVFKEKLKSNLEIKNAIITKVYG 178

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
                Y  I EE +   EK+ PF+     ++  E + G  +LFEGAQG LLD D+GTYP+
Sbjct: 179 MDAFDYNEICEEYLAFGEKLKPFVKDTSVIVYNEIKNGKKVLFEGAQGNLLDIDYGTYPY 238

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSNT+      G+ I P  +   +G+ KAYTTRVG GPFPTEL ++ GD ++E G E+
Sbjct: 239 VTSSNTIGGGVCPGAAIGPTMITSAVGIAKAYTTRVGKGPFPTELLDEMGDRIREAGFEY 298

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           G  T R RRCGWLD   ++++  ++G+   A+TK+D L G+D++K+C+GY  +G+ +D++
Sbjct: 299 GVTTGRARRCGWLDTVILKQAARVSGLTSFAMTKIDTLAGIDKVKVCIGYDFNGKTIDYI 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         +P+Y   +GW +S A  R + +LP+ A+ Y+++IEE+ E  ++++S+GPE
Sbjct: 359 PASLEDLALCKPIYEEFDGWDESVADARSYDELPLNAKKYLKRIEELTETKISIVSVGPE 418

Query: 420 RENTLIMSNP 429
           R +T+ +S+ 
Sbjct: 419 RNHTIEVSDI 428


>gi|319745785|gb|EFV98080.1| adenylosuccinate synthase [Streptococcus agalactiae ATCC 13813]
          Length = 430

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 276/433 (63%), Gaps = 5/433 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LS +A+VI R+QGG+NAGHT+ +++  +KL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             +K+S+IG+ VVV+P + + E+  L  +G+  T +NLRI++ A +IL  H  LD L+E 
Sbjct: 61  FKEKISVIGNGVVVNPKSLVKELAYLHGEGV--TTDNLRISDRAHVILPYHIKLDQLQED 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           A       IGTT +GIGPAY D+  R  IR+ DL D E  +++++  L   N L     +
Sbjct: 119 A--KGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDREVFAERLKINLAEKNRLFEKMYD 176

Query: 181 -KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
              + +  I EE     ++I  ++     +L      G  +LFEGAQG +LD D GTYPF
Sbjct: 177 STPLEFNDIFEEYYEYGQQIKQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  +  V+GV KAYT+RVG GPFPTEL ++ GD ++E+GKE+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREIGKEY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   +R S  ++G+  ++L  +DVL GLD +KICV Y +DG+ +D+ 
Sbjct: 297 GTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGKRIDYY 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P       R +P+Y  L GW +     R   DLP  ARNY+R++ E++ V ++  S+GP 
Sbjct: 357 PASLEQLKRCKPIYEELPGWSEDITACRSLDDLPENARNYVRRVGELVGVRISTFSVGPG 416

Query: 420 RENTLIMSNPFED 432
           RE T I+ + + +
Sbjct: 417 REQTNILESVWSN 429


>gi|183600317|ref|ZP_02961810.1| hypothetical protein PROSTU_03879 [Providencia stuartii ATCC 25827]
 gi|188020107|gb|EDU58147.1| hypothetical protein PROSTU_03879 [Providencia stuartii ATCC 25827]
          Length = 433

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 207/432 (47%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL VN     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVVNGEKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            + +SII + VV+ P A + E++ L  +G+ V    LRI+    LIL  H  LD  RE A
Sbjct: 63  ENVISIIANGVVLAPDALMKEMKQLEDRGVPVR-ERLRISEACPLILPYHIALDNAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D    ++K+++++ +HN    ++ ++
Sbjct: 122 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAEKLKEIVEYHNFQLVNYYKE 179

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
             V Y+  L+++M   + +   +  +  LL +  +K   ++FEGAQG LLD DHGTYP+V
Sbjct: 180 PAVDYQKTLDDIMAVADILTGMVVDVSDLLYKAHQKNELVMFEGAQGTLLDIDHGTYPYV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TGDFL+E G+EFG
Sbjct: 240 TSSNTTAGGVATGSGLGPRYVSYVLGIIKAYSTRVGAGPFPTELFDETGDFLREKGQEFG 299

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY-RMDGREVDFL 359
             T R+RR GWLD+ ++ R+V IN + G  +TKLDVLDGL E+KICVGY R DG  ++  
Sbjct: 300 ATTGRKRRTGWLDIVAINRAVQINSLSGFCMTKLDVLDGLKEVKICVGYRRPDGTVLETT 359

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EPVY +L GW ++T G++  A LP  A +YI+++EE+  VPV ++S GP+
Sbjct: 360 PLAADEWEGLEPVYEVLPGWSETTFGVKDRALLPQAALDYIKRVEELTGVPVDIISTGPD 419

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 420 RSETMILRDPFD 431


>gi|312112733|ref|YP_003991049.1| adenylosuccinate synthetase [Geobacillus sp. Y4.1MC1]
 gi|311217834|gb|ADP76438.1| adenylosuccinate synthetase [Geobacillus sp. Y4.1MC1]
          Length = 428

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 276/431 (64%), Gaps = 5/431 (1%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MT+VVVVG QWGDEGKGKI D+LSENA+VI R+QGGNNAGHT+  N   YKL L+PSG+ 
Sbjct: 1   MTSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIVFNGEKYKLHLIPSGIF 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             DK+ +IG+ +V+DP A +SE+  L   GI  + +NLRI+N A +IL  H  LD L E 
Sbjct: 61  YKDKICVIGNGMVIDPKALVSELNYLHDHGI--STDNLRISNRAHVILPYHLKLDQLEEE 118

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALR-RSFG 179
                   IGTT++GIGPAY D+  R  IR++DL D E   +K+ + L   N L  + +G
Sbjct: 119 R--KGANKIGTTKKGIGPAYMDKAARVGIRIVDLLDREVFEEKLARNLQEKNILFEKVYG 176

Query: 180 EKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPF 239
            +    + IL+E     ++I  ++     +L     +G  +LFEGAQG +LD D GTYPF
Sbjct: 177 VEGFKLEDILDEYYEYGQQIAKYVCDTSVVLNNALDEGRRVLFEGAQGVMLDIDQGTYPF 236

Query: 240 VTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEF 299
           VTSSN ++   +IGSG+ P  + +V+GV KAYTTRVG GPFPTEL ++ GD ++EVG+E+
Sbjct: 237 VTSSNPVAGGVTIGSGVGPTKIKHVVGVAKAYTTRVGDGPFPTELHDEIGDRIREVGREY 296

Query: 300 GTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFL 359
           GT T R RR GW D   VR +  ++G+  ++L  +DVL G++ LKICV YR  G+ ++  
Sbjct: 297 GTTTGRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGKVLEEF 356

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P         EP+Y  L GW +   G++   +LP  AR+Y+ +I ++  +P+++ S+GP+
Sbjct: 357 PASLKVLAECEPIYEELPGWSEDITGVKSLDELPANARHYVERISQLTGIPLSIFSVGPD 416

Query: 420 RENTLIMSNPF 430
           R  T ++ + +
Sbjct: 417 RSQTNVVRSVY 427


>gi|157373889|ref|YP_001472489.1| adenylosuccinate synthetase [Shewanella sediminis HAW-EB3]
 gi|157316263|gb|ABV35361.1| Adenylosuccinate synthase [Shewanella sediminis HAW-EB3]
          Length = 431

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 207/431 (48%), Positives = 280/431 (64%), Gaps = 5/431 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL ++     L L+PSG++R
Sbjct: 3   KNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLVIDGDKTVLHLIPSGILR 62

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +   IIG+ VV+ P A ++EI  L  +G+ V    L I+    LIL  H  LD+ RE A
Sbjct: 63  DNVKCIIGNGVVLAPDALMTEINMLKGRGVPV-EERLLISEACPLILPFHCALDVAREKA 121

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE- 180
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K++ ++ +HN +   + + 
Sbjct: 122 R--GNNAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFAEKLKDVMSYHNFMLTEYYKC 179

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           +EV Y+  L++ +   + +      +  LL+   + G  ILFEGAQG LLD DHGTYPFV
Sbjct: 180 EEVSYEKTLKDALAIADYLKSMCTDVTELLDTARKAGEPILFEGAQGTLLDIDHGTYPFV 239

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVV