RPSBLAST alignment for GI: 254780613 and conserved domain: PRK13784

>gnl|CDD|172322 PRK13784, PRK13784, adenylosuccinate synthetase; Provisional. Length = 428
 Score =  338 bits (869), Expect = 1e-93
 Identities = 177/442 (40%), Positives = 262/442 (59%), Gaps = 27/442 (6%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           M+N+V+VG QWGDEGKGKI D L+E AD++VR+QGGNNAGHTL VN     L L+PSGV+
Sbjct: 1   MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVL 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
                 +IG  VV+DP A   EI  L  +GI ++  NL ++ + ++I S H+ LD +RE 
Sbjct: 61  HQHTKCVIGHGVVLDPVALDEEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRES 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
             S     IGTT +GIGPAYED+V R+ I+   L D + +  +          L  S  E
Sbjct: 121 NTS---EKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR----------LAISLAE 167

Query: 181 KEVLYKTI-----------LEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFL 229
           KE L++ +            ++L    +K+  +    +S++++    G ++++EGAQG L
Sbjct: 168 KETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVL 227

Query: 230 LDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTG 289
           LD D+GTYPFVTSSNT  A    G+  +   L +V+G+ KAYTTRVG GPFPTEL +  G
Sbjct: 228 LDVDYGTYPFVTSSNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVG 287

Query: 290 DFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGY 349
            F++  G E G  T R RRCGWLDL  ++ S   + +  IALTK+DVL  +D LK+C+GY
Sbjct: 288 KFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAKCSNLTSIALTKVDVLSDMDTLKVCIGY 347

Query: 350 RMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEV 409
           + +G+E+ +     I   + EP+ + +E +       +   ++P   + Y++ IE  + +
Sbjct: 348 KYEGKEI-YCAYPGIDLYKVEPILVEMEPFSIDETVTK--DNMPAALKTYLKTIENHVGI 404

Query: 410 PVALLSIGPERENTLIMSNPFE 431
           P++ L+ GP RE  L   + F+
Sbjct: 405 PISSLAYGPSREQILFFEDYFK 426