RPSBLAST alignment of GI: 254780613 and MMDB domain: 1dj2_A_

>1dj2_A (A:) Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A {Arabidopsis thaliana}Length = 443
 Score =  519 bits (1338), Expect = e-148
 Identities = 167/425 (39%), Positives = 248/425 (58%), Gaps = 5/425 (1%)

Query: 3   NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVND-IVYKLSLLPSGVVR 61
              V+G QWGDEGKGK+VD L+++ D++ R QGG NAGHT+  ++   + L L+PSG++ 
Sbjct: 21  VSGVLGCQWGDEGKGKLVDILAQHFDIVARCQGGANAGHTIYNSEGKKFALHLVPSGILN 80

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            D   +IG+ VVV       EI+ L   G+      + +++ A L+   H+++D LRE  
Sbjct: 81  EDTTCVIGNGVVVHLPGLFKEIDGLESNGVSCKGR-ILVSDRAHLLFDFHQEVDGLRESE 139

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
           L+   + IGTT+RGIGPAY  +V R  IRV DL  ++ + +K++ LL    A  + F   
Sbjct: 140 LA--KSFIGTTKRGIGPAYSSKVIRNGIRVGDLRHMDTLPQKLDLLLSDAAARFQGFKYT 197

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
             + +  +E      +++ P++      +     +   +L EG Q  +LD D GTYPFVT
Sbjct: 198 PEMLREEVEAYKRYADRLEPYITDTVHFINDSISQKKKVLVEGGQATMLDIDFGTYPFVT 257

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SS+  +     G GI+P  +G ++GVVKAYTTRVG GPFPTE     GD L+  G+EFGT
Sbjct: 258 SSSPSAGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPTENLGTGGDLLRLAGQEFGT 317

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFLP 360
            T R RRCGWLD+ +++ S  ING   + LTKLDVL  L+E+++ V Y+  DG  V   P
Sbjct: 318 TTGRPRRCGWLDIVALKFSCQINGFASLNLTKLDVLSDLNEIQLGVAYKRSDGTPVKSFP 377

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            D          Y +L GWK   + +R ++DLP  A+ Y+ +IEE++ VP+  + IGP R
Sbjct: 378 GDLRLLEELHVEYEVLPGWKSDISSVRNYSDLPKAAQQYVERIEELVGVPIHYIGIGPGR 437

Query: 421 ENTLI 425
           +  + 
Sbjct: 438 DALIY 442