RPSBLAST alignment of GI: 254780613 and MMDB domain: 2v40_A_

>2v40_A (A:) Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A*Length = 459
 Score =  524 bits (1350), Expect = e-149
 Identities = 170/429 (39%), Positives = 252/429 (58%), Gaps = 8/429 (1%)

Query: 3   NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRP 62
             VV+G QWGDEGKGK+VD L+++AD++ R QGGNNAGHT+ V+ + Y   LLPSG++ P
Sbjct: 33  VTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINP 92

Query: 63  DKMSIIGSSVVVDPHAFISEIESLAHQGICV--TPNNLRIANNASLILSIHRDLDMLREG 120
           +  + IG+ VV+       E E    +G  +      L I++ A ++   H+  D ++E 
Sbjct: 93  NVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQ 152

Query: 121 ALS-PCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLT-DVEHISKKIEQLLLHHNALRRSF 178
                 G ++GTT++GIGP Y  +  R  +R+ DL  D +  S++ + L   + ++   +
Sbjct: 153 QRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSI---Y 209

Query: 179 GEKEVLYKTILEELMYAREKILPFM-DVIWSLLERESRKGAHILFEGAQGFLLDNDHGTY 237
              E+  +  L++L    EKI P + D ++ L E        IL EGA   LLD D GTY
Sbjct: 210 PTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTY 269

Query: 238 PFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGK 297
           PFVTSSN        G G+ P ++G V GVVKAYTTRVG G FPTE  N+ G+ L+  G+
Sbjct: 270 PFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGR 329

Query: 298 EFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVD 357
           EFG  T R+RRCGWLDL  ++ + +ING   +ALTKLD+LD   E+K+ V Y++DG  + 
Sbjct: 330 EFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIP 389

Query: 358 FLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIG 417
            +P +     + E  Y  L GW    +  R F +LP+ A+NY+R IE+ L++PV  + +G
Sbjct: 390 HIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVG 449

Query: 418 PERENTLIM 426
             RE+ + +
Sbjct: 450 KSRESMIQL 458