RPSBLAST alignment of GI: 254780613 and protein with PDBid: 2v40

>2v40_A Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A* Length = 459
 Score =  439 bits (1131), Expect = e-124
 Identities = 165/426 (38%), Positives = 243/426 (57%), Gaps = 6/426 (1%)

Query: 5   VVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDK 64
           VV+G QWGDEGKGK+VD L+++AD++ R QGGNNAGHT+ V+ + Y   LLPSG++ P+ 
Sbjct: 35  VVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNV 94

Query: 65  MSIIGSSVVVDPHAFISEIESLAHQGICV--TPNNLRIANNASLILSIHRDLDMLREGAL 122
            + IG+ VV+       E E    +G  +      L I++ A ++   H+  D ++E   
Sbjct: 95  TAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQR 154

Query: 123 SPCGA-HIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                 ++GTT++GIGP Y  +  R  +R+ DL        +  ++L +    +  +   
Sbjct: 155 QEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQY--KSIYPTL 212

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESR-KGAHILFEGAQGFLLDNDHGTYPFV 240
           E+  +  L++L    EKI P +      L          IL EGA   LLD D GTYPFV
Sbjct: 213 EIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFV 272

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSN        G G+ P ++G V GVVKAYTTRVG G FPTE  N+ G+ L+  G+EFG
Sbjct: 273 TSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFG 332

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
             T R+RRCGWLDL  ++ + +ING   +ALTKLD+LD   E+K+ V Y++DG  +  +P
Sbjct: 333 VTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIP 392

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
            +     + E  Y  L GW    +  R F +LP+ A+NY+R IE+ L++PV  + +G  R
Sbjct: 393 ANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSR 452

Query: 421 ENTLIM 426
           E+ + +
Sbjct: 453 ESMIQL 458